231
annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 1

Embed Size (px)

Citation preview

Page 1: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 1

Page 2: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 2

Page 3: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 3

PROFIL PERUSAHAAN

Company profile

Berdasarkan Akta Pendirian No. 5 tanggal 1 Juni 1990, Perusahaan Sat Nusapersada menjadi badan hukum yang berhak untuk melakukan usahanya secara mandiri dengan ruang lingkup usaha industri perakitan elektronik.

Pursuant to Article of Association No.5 dated June 1, 1990, Sat Nusapersada become a legal entity having the right to execute its business independently with the scope of business of electronic manufacturering service (EMS).

NAMAPT SAT NUSAPERSADA Tbk

BIDANG USAHAINDUSTRI PERAKITAN ELEKTRONIK

TANGGAL PENDIRIAN1 JUNI 1990

DASAR HUKUM PENDIRIANAkta Pendirian No. 5 tanggal 1 Juni 1990Perubahan terakhir Akta No. 105 tanggal 26 Juni

2008

MODAL DASARRp 738.000.000.000

MODAL DITEMPATKAN DAN DISETOR PENUHRp 265.717.200.000

PENCATATAN DI BURSASaham Perseroan telah dicatatkan di Bursa Efek Indonesia pada tanggal 8 November 2007 dengan

Kode Saham di Bursa: PTSN

KANTOR PUSATJl Pelita VI No.99 Batam 29432 - IndonesiaTelp : +62 778 425 888Fax : +62 778 426 988www.satnusa.com

NAMEPT SAT NUSAPERSADA Tbk

LINE OF BUSINESSELECTRONIC MANUFACTURER SERVICES

DATE OF ESTABLISHMENT1 JUNE 1990

LEGAL BUSINESSArticle of Association No.5 dated June 1, 1990Latest Amended Notarial Deed No.105 dated

June 26, 2008

AUTHORIZED CAPITALRp 738,000,000,000

SUBSCRIBED AND FULLY PAID CAPITALRp 265,717,200,000

STOCK EXCHANGE REGISTRATIONThe Company’s shares were listed on Indone-sia Stock Exchange on 8 November 2007 with

Shares Code : PTSN

HEAD OFFICEJl Pelita VI No.99 Batam 29432 - IndonesiaTelp : +62 778 425 888Fax : +62 778 426 988www.satnusa.com

Page 4: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 4

ProfilPerusahaanCompany profile

24 25 Sejarah Singkat Brief History

30 Visi, Misi dan Budaya Our Vision, Mission and Culture

34 Struktur Organisasi Organizational Structure

36 Riwayat Hidup Dewan Komisaris Profiles of the Board of Commissioners

38 Riwayat Hidup Direksi Profiles of the Board of Directors

41 Riwayat Hidup Unit Audit Internal Profile of the Internal Audit

42 Riwayat Hidup Sekretaris Perusahaan Profile of the Corporate Secretary

42 Riwayat Hidup Komite Audit Profiles of the Audit Committees

44 Informasi Entitas Anak dan Afiliasi Subsidiaries and Affiliated Companies

50 Nama dan Alamat Lembaga dan/atau Profesi Penunjang Pasar Modal Name and Address of Institution and/or Supporting Profession in the Capital Market

50 Alamat Kantor Pusat dan Entitas Anak Address of Head Office and Subsidiaries

51 Auditor Independen Perseroan Corporate Independent Auditor

Daftar Isi Table of Contents

08 Kinerja 2012 2012 Performance

09 Ikhtisar Keuangan Financial Highlights

09 Ikhtisar Operasional Operational Highlights

10 Ikhtisar Saham Stock Highlights

12 Peristiwa Penting 2012 2012 Significant Events

14 Penghargaan dan Serfitifikasi Award and Certification

16 Laporan Dewan Komisaris Report from the Board of Commissioners

20 Laporan Direksi Report from the Board of DirectorsLaporan Manajemen

Management Report

16

Komposisi Karyawan Employee Composition

Profil Sumber Daya Manusia Human Resources Profile

Pelatihan Yang Dilaksanakan di Sat Nusa Training Conducted at Sat Nusa

Page 5: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 5

Sumber Daya ManusiaHuman Resources

Komposisi Karyawan Employee Composition

Profil Sumber Daya Manusia Human Resources Profile

Pelatihan Yang Dilaksanakan di Sat Nusa Training Conducted at Sat Nusa

52

Pembahasan dan Analisis Manajemen

Management’s Discussion and Analysis

5860 Pendapatan Usaha Revenues

62 Beban Pokok Penjualan Cost of Revenue

64 Laba Kotor Gross Profit

65 Beban Usaha dan Laba (Rugi) Usaha Operating Expenses and Income (Loss) from Operation

66 Pendapatan (Beban) Lain-lain Other Income (Expenses)

66 Laba (Rugi) Bersih dan Profitabilitas Net Income (Loss) and profitability

67 Aset Assets

70 Liabilitas Liabilities

71 Ekuitas Equity

71 Kemampuan Membayar hutang Solvency

71 Kolektibilitas Piutang Collectibility

72 Arus Kas Cash Flow

73 Transaksi yang Mengandung Benturan Kepentingan dan Transaksi dengan Pihak yang Me miliki Hubungan Istimewa Afiliasi Conflict of Interest and Related Parties (Affiliates) Transactions

73 Struktur Modal Capital Structure

73 Tingkat Likuiditas Liquidity

74 Ikatan Material Atas Investasi Barang Modal Material Commitments Related To Capital Investment

74 Informasi dan Fakta Material yang Terjadi Setelah Tanggal Laporan Akuntan Material Information or Sub sequent Event to the Accountant’s Report Date

74 Informasi Material Material Information

74 Realisasi Penggunaan Dana Hasil Penawaran Umum Realization of use of funds from IPO Proceeds

75 Kebijakan Dividen Dividend Policy

76 Target/Proyeksi Perusahaan Corporate Target/Projection

76 Perubahan Kebijakan Akuntansi yang Signifikan Significant Changes in Accounting Policy

76 Perubahan Peraturan Perundang- undangan Changes in Laws and Regulations

77 Tinjauan Operasional Operational Overview

82 Aspek Pemasaran Marketing Aspects

84 Prospek Usaha Business Prospect

54

55

56

Page 6: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 6

Informasi Bagi Pemegang Saham

Information for Shareholders

106 106 Komposisi Pemegang Saham Shareholders Composition

107 Informasi Mengenai Pemegang Saham Utama Information on Major Shareholder

107 Kronologi Pencatatan Saham Chronology of Stock Listing

88 Strategi dan Kebijakan CSR CSR Strategy and Policies

90 Program CSR 2013 CSR Program 2013

91 Kegiatan Manajemen Lingkungan Environmental Management Activities

95 Kesehatan dan Keselamatan Kerja (K3) serta Lingkungan Occupational Health, Safety and Environment

97 Tingkat Perpindahan Karyawan dan Tingkat Kecelakaan Employee Turnover Levels and Accident Rates

98 Pengembangan Sosial dan Kemasyarakatan Social and Community Development

99 Perlindungan untuk Pekerjaan, Kesehatan dan Keselamatan Kerja Protection for Employment, Occupational Health and Safety

104 Tanggung Jawab Produk Product Responsibility

104 Informasi Produk Product Information

105 Pelayanan Pengaduan dan Klaim Pelanggan Accommodating Customer’s Complaint and Claim

Tanggung Jawab Sosial Perusahaan

Corporate Social Responsibility

86

Page 7: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 7

Tata Kelola Perusahaan

Corporate Governance

Tanggung Jawab PelaporanResponsibility for Reporting

Referensi Peraturan OJK (d/h Bapepam LK)-No. X.K.6OJK (d/h Bapepam -LK) No.X.K.6 Cross Reference

Laporan Keuangan KonsolidasiConsolidated Financial Statements

108

142

143

148

109 Tujuan Penerapan GCG GCG Objectives

110 Prinsip Dasar GCG Good Corporate Governance Principles

112 Struktur GCG Good Corporate Governance Structure

116 Dewan Komisaris Board of Commissioners

119 Direksi Board of Directors

124 Laporan Komite Committee Report

126 Sekretaris Perusahaan Corporate Secretary

127 Audit Internal Internal Audit

129 Sistem Pengendalian Internal Internal Control System

131 Manajemen Risiko Risk Management

134 Perkara Penting Yang Dihadapi Sat Nusa Material Litigation Involving Sat Nusa

135 Akses Terhadap Informasi Access to Information

136 Sistem Pelaporan Pelanggaran Whistle Blowing System

139 Kode Etik Code of Conduct

Page 8: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 8

PendapatanRevenues

Laba KotorGross Profit

Laba BersihNet Income

Laba Bersih per 1.000 SahamNet Income per 1,000 Shares

2.04%

39.23%

194.21%

194.21%

USD 239

USD 8.1

USD 981

USD 0.55

juta million

juta million

ribu thousand

2012KINeRJAPeRFORMANCe

Pada tahun 2012, Perseroan mencatat pertumbuhan pendapatan sebesar 2,04% menjadi USD 239 juta yang terdiri dari sektor Konsumen elektronik 53,23%, Otomotif 33,90%, Networking 11,96% dan sektor lainnya sebesar 0,91%. Penerapan pengendalian biaya produksi secara konsisten dan pen-gadaan SMT revamp project serta fasilitas produksi yang terintegrasi mampu meningkatkan marjin laba kotor pada tahun 2012 menjadi 3,39% dari 2,48% pada tahun 2011. Perseroan mencatat laba bersih sejumlah USD 981 ribu pada tahun 2012, dengan pertumbuhan sebesar 194,21% disertai laba bersih per 1.000 saham yang meningkat menjadi USD 0,55 per 1.000 lembar saham dari negatif USD 0,59 per 1.000 lembar saham di tahun sebelumnya.

In 2012, The Company booked revenue growth by 2.04% to USD 239 million, con-tributed from Consumer electronic sector 53.23%, Automotive 33.90%, Network-ing 11.96% and other sectors 0.91%. Through a consistent implementation of pro-duction costs control and SMT revamp project as well as integrated production facility, gross profit margin succesfully increased to 3.39% in 2012 from 2.48% in 2011. The Company recorded net income of USD 981 thousand for year 2012, an in-crease of approximately 194.21% with earnings per 1,000 share increased to USD 0.55 per 1,000 share from minus USD 0.59 per 1,000 share in the previous year.

Page 9: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 9

Ikhtisar KeuanganFinancial Highlights

IKHTISAR OPERASIONAL

Angka-angka pada seluruh tabel dan grafik dalam Laporan Tahunan ini menggunakan notasi Bahasa inggris Numerical notations in all tables and graphs in this Annual Report are in english

Dinyatakan dalam Dolar Amerika Serikat, kecuali dinyatakan lain

Expressed in United States Dollars, unless otherwise stated

LAPORAN LABA RUGI KOMPREHENSIF KONSOLIDASI

2010 2011 2012 CONSOLIDAtED StAtEMENtS OF COMPREHENSIvE INCOME

Pendapatan 243,751,631 234,583,722 239,373,814 Revenues

Beban Pokok (236,537,253) (228,757,722) (231,262,443) Cost of Revenues

Laba Kotor 7,214,378 5,826,000 8,111,371 Gross Profit

Beban Usaha (7,098,298) (7,394,188) (7,367,493) Operating Expenses

Laba (Rugi) Usaha 116,080 (1,568,188) 743,878 Income (Loss) from Operations

Pendapatan (Beban) lain-lain (1,254,121) 492,629 846,086 Other Income (Expenses)

Laba (Rugi) Sebelum Pajak (1,138,041) (1,075,559) 1,589,964 Income (Loss) Before Tax

Pendapatan (Beban) Pajak - Bersih 52,538 34,512 (609,158) Tax Income (Expense)- Net

Laba (Rugi) Bersih (1,085,503) (1,041,047) 980,806 Net Income (Loss)

Laba (Rugi) Bersih Komprehensif (1,085,503) (1,041,047) 980,806 Net Comprehensive Income (Loss)

Laba (Rugi) Bersih Yang Dapat Diatribusikan Kepada :

Net Income (Loss) Attributable to:

Pemilik Entitas Induk (1,085,503) (1,041,047) 980,806 Owner of the Parent Company

Kepentingan Non Pengendali - - - Non-Controlling Interest

Jumlah (1,085,503) (1,041,047) 980,806 Total

Laba (Rugi) Bersih Komprehensif Yang Dapat Diatribusikan Kepada :

Net Comprehensive Income (Loss) Attributable to

Pemilik Entitas Induk (1,085,503) (1,041,047) 980,806 Owner of the Parent Company

Kepentingan Non Pengendali - - - Non-Controlling Interest

Jumlah (1,085,503) (1,041,047) 980,806 Total

Laba (Rugi) Bersih Per 1.000 Saham Dasar (0.61) (0.59) 0.55 Net Income (Loss) per 1,000

Basic Share

LAPORAN POSISI KEUANGAN KONSOLIDASI

CONSOLIDAtED StAtEMENtS OF FINANCIAL POSItION

Aset Lancar 47,943,338 37,980,659 49,453,506 Current Assets

Aset Tidak Lancar 45,525,566 47,354,256 42,782,109 Non Current Assets

Total Aset 93,468,904 85,334,915 92,235,615 Total Assets

Liabilitas Jangka Pendek 37,841,300 30,515,990 36,081,628 Current Liabilities

Liabilitas Jangka Panjang 1,890,626 2,122,994 2,477,250 Non Current Liabilities

Ekuitas 53,736,978 52,695,931 53,676,737 Equity

RASIO KEUANGAN FINANCIAL RAtIO

Marjin Laba Kotor (%) 2.96 2.48 3.39 Gross Profit Margin (%)

Rasio Lancar (X) 1.27 1.24 1.37 Current Ratio (X)

Rasio Liabilitas / Total Aset (%) 43 38 42 Debt to Assets Ratio (%)

Rasio Liabilitas / Ekuitas (%) 74 62 72 Debt to Equity Ratio (%)

Rasio Laba (Rugi) / Total Aset (%) (1.16) (1.22) 1.06 Return on Assets (%)

Rasio Laba (Rugi) / Ekuitas (%) (2.02) (1.98) 1.83 Return on Equity (%)

2010 2011 2012Jumlah Tenaga Kerja 5,568 4,663 4,546 Number of Employees

Jumlah Entitas Anak 1 1 1 No of Subsidiary Company

Jumlah SMT Line 30 21 21 No of SMT Lines

Jumlah Mesin Plastic Molding 30 31 34 No of Plastic Molding Machines

Jumlah Mesin Metal Stamping 17 17 17 No of Metal Stamping Machines

OPERATIONAL HIGHLIGHTS

Page 10: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 10

21 December 2012

11 September 2012

VOLU

ME

TRA

NSA

KSI

| Tr

ad

ing

Vo

lum

e

HA

RGA

SA

HA

M |

SHa

re

PriC

e

02 January 2012

31 December 2012Rp 127,-

Rp 76,-Rp 80,-

58.75%

Rp 135,-

0 0

20 1,500,000

3,000,00040

4,500,00060

6,000,00080

100

120

140

160

JAN

UA

Ry

FEBR

UA

Ry

MA

RCH

APR

IL

MAy

JUN

E

JULy

AU

GU

ST

SEPT

EMBE

R

OCT

OBE

R

NO

VEM

BER

DEC

EMBE

R

GRAfIK PERGERAKAN SAHAM PTSNDI BURSA EfEK INDONESIA

AT INDONESIA STOCK EXCHANGEPTSN STOCK PRICE MOVEMENT

Grafik berdasarkan pada harga penutupan 2012 The graph was based on closing price for 2012

Page 11: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 11

Harga PembukaanOpening (Rp)

tertinggiHighest(Rp)

terendahLowest (Rp)

Harga PenutupanClosing (Rp)

volume transaksiTransaction Volume

Januari 80 100 76 91 780,500 January

Februari 91 115 73 88 8,290,500 February

Maret 88 100 77 92 1,216,500 March

April 92 120 90 96 5,560,000 April

Mei 96 108 81 94 264,500 May

Juni 90 99 70 90 891,000 June

Juli 90 96 73 83 2,938,000 July

Agustus 89 96 77 87 16,477,500 August

September 86 88 76 88 882,000 September

Oktober 82 95 80 86 3,746,500 October

Nopember 86 125 82 100 4,237,000 November

Desember 90 155 90 127 7,448,500 December

Q1 Q2 Q3 Q4 FY

Pembukaan (Rp) 80 92 90 82 80 Opening (Rp)

Tertinggi (Rp) 115 120 96 155 155 Highest (Rp)

Terendah (Rp) 73 70 73 80 70 Lowest (Rp)

Penutupan (Rp) 92 90 88 127 127 Closing (Rp)

Volume Transaksi 10,287,500 6,715,500 20,297,500 15,432,000 52,732,500 Trading Volume

Kapitalisasi pasar (‘000)

162,973,216 159,430,320 155,887,424 224,973,896 224,973,896 Market Capitalization (‘000)

Jumlah saham yang beredar

531,388,000 531,388,000 531,388,000 531,388,000 531,388,000 Number of shares issued

Saham ditempatkan dan disetor

1,771,448,000 1,771,448,000 1,771,448,000 1,771,448,000 1,771,448,000 Subscribed and Fully Paid Shares

Q1 Q2 Q3 Q4 FY

Pembukaan (Rp) 76 82 81 67 76 Opening (Rp)

Tertinggi (Rp) 86 92 120 92 120 Highest (Rp)

Terendah (Rp) 75 79 75 62 62 Lowest (Rp)

Penutupan (Rp) 83 81 80 85 85 Closing (Rp)

Volume Transaksi 5,174,000 28,181,000 29,817,500 3,880,000 67,052,500 Trading Volume

Kapitalisasi pasar (‘000)

147,030,184 143,487,288 141,715,840 150,573,080 150,573,080 Market Capitalization (‘000)

Jumlah saham yang beredar

531,388,000 531,388,000 531,388,000 531,388,000 531,388,000 Number of shares issued

Saham ditempat-kan dan disetor

1,771,448,000 1,771,448,000 1,771,448,000 1,771,448,000 1,771,448,000 Subscribed and Fully Paid Shares

MONTHLY STOCK PeRFORMANCe OF PTSN 2012KINERJA SAHAM PTSN BULANAN TAHUN 2012

KINeRJA SAHAM PTSN TRIWULANAN PeRIODe 2012 QUARTeRLY STOCK PeRFORMANCe OF PTSN FOR 2012 PeRIOD

KINeRJA SAHAM PTSN TRIWULANAN PeRIODe 2011 QUARTeRLY STOCK PeRFORMANCe OF PTSN FOR 2011 PeRIOD

Page 12: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 12

Significant EventsPeristiwa Penting

2012

inauguration of the new Purchasing officePErEsmian kantor Purchasing Baru

Peresmian kantor purchasing baru di kantor pusat Sat Nusa pada tanggal 11 November 2012. Acara pertama dimulai dengan pidato yang dibawakan oleh Direktur Utama PT Sat Nusapersada Tbk Pak Abidin dan diikuti dengan pidato dari tamu terhormat Perseroan, Presiden Direktur KETM, Pak Norio Sato dan Acara pemotongan pita mengakhiri acara peresmian tersebut.

The inauguration of the new purchasing office at Sat Nusa HQ building was officiated on last November 11, 2012. Opening speech was the first programme delivered by the President Director of PT Sat Nusapersada Tbk Mr. Abidin and followed by speech from our Honourable guest the Managing Director of KETM, Mr.Norio Sato and Ribbon Cutting marked the end of the ceremony of the inauguration.

Page 13: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 13

raPat umum PEmEgang saham (ruPs) gEnEral mEEting of sharEholdErs (gms)

Rapat Umum Pemegang Saham Tahunan (RUPST) PT Sat Nusapersada Tbk diselenggarakan pada tang-gal 26 Juni 2012 untuk melakukan persetujuan laporan tahunan dan pengesahan laporan keuangan untuk tahun fiskal 2011. RUPS memberikan wewenang kepada Direksi untuk menunjuk kantor akuntan publik independen untuk mengaudit laporan keuangan Perseroan untuk tahun yang berakhir pada tanngal 31 Desember 2012 serta pengangkatan anggota Dewan Komisaris dan anggota Direksi sehubungan dengan habisnya masa jabatannya.

PT Sat Nusapersada Tbk Annual General Meeting of Shareholders (AGMS) was held on 26 June 2012 for ap-proval of the annual report and ratification of financial report for the fiscal year of 2011. The AGMS authorized the Board of Directors to appoint an independent public accounting firm to audit the Company’s financial state-ments for the year ended December 31, 2012 and re-appointment of the Board of Commissioners and Board of Directors in relation to the completion of its service periode.

PuBlic EXPosE | PuBlic EXPosE

Pada 18 Desember 2012, Public Expose diadakan di Kantor Pusat Batam. Public Expose dihadiri oleh seluruh Manajemen Perseroan termasuk Abidin sebagai Presiden Direktur, Bidin Yusuf sebagai Direktur Operasi dan Megawati sebagai Direktur Keuangan (Tidak Terafiliasi), disertai Rusdiana sebagai Sekre-taris Perusahaan. Perseroan membahas kinerja Perseroan tahun 2012 dan target penjualan 2013 serta prospek industri di masa depan. Setelah presentasi, dilanjutkan dengan acara terakhir berupa sesi tanya jawab.

On December 18, 2012, Public Expose was held in Batam at Head Quarter Office. Public Expose was attended by all the Management of the Company including Abidin as President Director, Bidin Yusuf as Operational Direc-tor and Megawati as Finance Director (Non Affiliated), accompanied by Rusdiana as Corporate Secretary. The company discussed about its performance for 2012 and its 2013 sales target as well as Industry outlook in the future. Following the presentation, a Q&A session was opened and also as closing of the event.

Page 14: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 14

04 INTERNASIONAL AwARDS

OUTSTANDING ACHIEVEMENT AwARDS

qUALITy CREATES

FUTURE

CONTINUOUSIMPROVEMENT

VALUEADDED

qUALITyACHIEVEMENT

PEN

GH

AR

GAA

N

DA

N S

ERTI

FIK

ASI

AWAR

D A

ND

CER

TIFI

CATI

ON • TEAC : Sertifikat Penghargaan atas Prestasi Keunggulan Kelas Dunia.

• JVCKenwood: Sertifikat Penghargaan atas kontribusi penting dalam penurunan biaya dan pencapaian kualitas.

• JVCKenwood: Sertifikat Penghargaan atas kontribusi penting dalam Produksi dan pencapaian kualitas.

• JVCKenwood : Penghargaan atas prestasi luar biasa dalam pencapaian positif.

• TEAC : Certificate of Appreciation for Honorable Achievement of World Class Excellence.

• JVCKenwood: Certificate of Appreciation for substantial contribution in Cost Down and Quality Achievement.

• JVCKenwood: Certificate of Appreciation for substantial contribution in Production and Quality Achievement.

• JVCKenwood : Outstanding Achievement Award for Positive Accomplishment.

Page 15: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 15

aWarD anD CerTifiCaTionPENGHARGAAN DAN SERTIFIKASI

Pak aBidin (kiri) sElaku dirEktur utama Pt sat nusaPErsada tbk mEnErima PEnghargaan outstanding achiEvEmEnt award dari Pak norio sato (kanan) sElaku managing dirEctor kEnwood ElEctronics tEchnologiEs (m) sdn. Bhd

Mr. Abidin (left), as the President Director of PT Sat Nusapersada Tbk received Outstanding Achievement Award from Mr. Norio Sato (Right) as the Managing Director of Kenwood Electronics Technologies (M) Sdn. Bhd.

Page 16: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 16

LAPORAN DewAN KOMISARIS

RePORT FROM BOARD OF COMMISSIONeRS

Page 17: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 17

Tahun 2012 menjadi tahun yang penting bagi Sat Nusa karena merupakan titik balik dari kinerja keuangan dan operasional Perseroan. Kami mendukung setiap langkah pembangunan yang diambil oleh Manaje-men selama 2012. Dari sisi kinerja, berkat kerja keras Manajemen dan seluruh jajaran karyawan ser-ta dukungan seluruh stakeholders, di tengah kondisi pasar dengan berbagai tantangan, Perseroan telah menunjukkan kinerja operasional dan keuangan dengan hasil yang memuaskan. Sepanjang tahun 2012 Sat Nusa telah mampu mengatasi berbagai hambatan sekaligus tantangan dan membukukan pertumbuhan yang positif. Penjualan bersih tumbuh 2,04% dibandingkan tahun 2011 mencapai USD 239 juta pada tahun 2012, sementara laba bersih menca-pai USD 981 ribu dari rugi bersih sebesar USD 1 juta di tahun 2011.

Memasuki tahun 2012, prospek ekonomi global masih belum menunjukkan titik terang. Krisis utang zona euro merupakan tantangan utama, dan bukan hanya untuk para pemimpin bisnis di Eropa. Uni Eropa (UE) merupakan mitra dagang terbesar China, dan China adalah mitra dagang kedua terbesar Uni Eropa sete-lah Amerika Serikat. China merupakan salah satu eksportir terbesar di dunia, tetapi perlambatan di Eropa telah membebani pertumbuhan ekonominya. Salah satu rintangan utama Perseroan adalah men-ingkatnya tekanan pada penjualan Perseroan yang mayoritas berorientasi ekspor dan tereskpos terha-dap pasar tersebut.

Yang menjadi perhatian dan tantangan utama bagi Perseroan adalah meminimalkan dampak dari ketidakpastian ekonomi global. Ketidakpastian dalam perekonomian global telah berdampak pada prospek pertumbuhan bisnis tidak hanya di negara maju, teta-pi di seluruh dunia.

For Sat Nusa, 2012 has been an important period of both financial and operation turnaround. We sup-port every step of development taken by Manage-ment during 2012. Appraised from its performance, resulting from the hard work of Management and all employees, supported by all stakeholders, the Company has delivered satisfying operational and financial performance amidst market conditions presenting various challenges. Throughout 2012, Sat Nusa was capable of overcoming various ob-structions and also confronting challenges, book-ing positive growth. Net sales grew 2.04% com-pared to 2011, achieving USD 239 million in 2012, while the current year’s profit reached USD 981 thousand from a net loss of approximately USD 1 million in 2011.

Going into 2012, the global economic outlook re-mains highly uncertain. The eurozone sovereign debt crisis is perhaps the key challenge, and not just for business leaders in Europe. The European Union (EU) is China’s largest trading partner, and China is the EU’s second largest trade partner after the United States. China remains one of the world’s largest exporter, but the slowdown in Europe has weighed on economic growth. One of the principal obstacle for Sat Nusa was the increasing pressure on our sales which mainly export-oriented and ex-posed to those markets.

Our overriding concern, however, remains the challenge of minimizing the impact from global economic uncertainty. The uncertainty in the global economy has affected business growth prospects not just in mature economies, but across the world.

Pemegang saham yang terhormat,Dear distinguished shareholders,

Page 18: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 18

KinErJA2012

Kami sangat bersyukur terhadap peningkatan kinerja Perseroan ditahun 2012. Meskipun dalam kondisi ekonomi yang kurang baik, kami melihat upaya gigih yang dilakukan oleh jajaran Direksi dalam memban-gun kerjasama yang lebih solid di seluruh lini peru-sahaan, mengembangkan strategi yang tepat untuk meningkatkan kinerja organisasi dan operasional, membangun kerjasama dengan mitra strategis, dan terus meningkatkan pembangunan sumber daya ma-nusianya.

Upaya pengembangan sumber daya manusia terus di-lakukan oleh Direksi sebagai aset strategis Perseroan dalam mempertahankan keunggulan dalam kondisi pasar yang semakin kompetitif. Dewan Komisaris mendukung upaya Direksi untuk secara terus me-nerus melakukan berbagai program pengembangan sumber daya manusia secara terstruktur dan teren-cana diantaranya dengan menjalin kerjasama dengan berbagai lembaga pendidikan terkemuka.

Sat Nusa menunjukkan perbaikan rasio keuangan yang signifikan pada tahun 2012 dibandingkan den-gan tahun sebelumnya. Pada tahun 2012, Sat Nusa berhasil meningkatkan marjin laba kotor dari 2,48% tahun 2011 menjadi 3,39% pada tahun 2012. Selain itu, Sat Nusa mampu mencapai beberapa prestasi ditengah ketidakpastian ekonomi global dan menu-tup tahun dengan laba positif seperti yang ditunjuk-kan oleh peningkatan baik Return on Assets dan Re-turn on Equity. Tahun 2012, Sat Nusa membukukan Return on Asset sebesar 1,06% dan Return on Equity sebesar 1,83% dari negatif 1,22% dan negatif 1,98% pada tahun 2011. Pada akhir tahun 2012, Sat Nusa berhasil mempertahankan Rasio Lancar positif dan meningkat dari 1,24 pada 2011 menjadi 1,37 dalam 2012.

2012PErformAnCE

We are grateful with Sat Nusa’s 2012 improved per-formance. Despite during unfavorable economic conditions, we saw the Board of Directors’ per-sistent efforts in building more solid cooperation across the Company lines, developing appropri-ate strategies to promote organizational and op-erational performance, building cooperation with strategic partners, and continuously improving its human resources development.

The efforts toward human resources development are continuously implemented by the Board of Directors, in recognizing them as a strategic cor-porate asset in maintaining Sat Nusa competitive edge in today’s competitive markets. The Board of Commissioners supports the Board of Directors’ efforts to continuously generate human resource development programs structurally, according to plan, such as through working out a closer coop-erative program with foremost educational institu-tions.

Sat Nusa demonstrated significant financial ratio improvement in 2012 as compared to previous year. In 2012, Sat Nusa succeeded in improving the gross profit margin from 2.48% in 2011 to 3.39% in 2012. Apart from that, Sat Nusa was able to complete several important achievements during the period of global economic uncertainty and to end the year in black as shown by improved both Return on As-sets and Return on Equity. In 2012, Sat Nusa regis-tered 1.06% on Return on Assets and 1.83% Return on Equity from a negative 1.22% and negative 1.98% in 2011 respectively. By the end of year 2012, Sat Nusa managed to maintain positive and improved Current Ratio from 1.24 in 2011 to 1.37 in 2012.

Dewan Komisaris menyambut positif upaya-upaya Direk-si dan segenap karyawan dalam beberapa tahun terakhir dalam menciptakan landasan yang kokoh, sehingga Sat Nusa mampu mencatatkan pencapaian yang sangat baik pada ta-hun 2012.The Board of Commissioners positively welcome the Directors’ and all the employees’ efforts in these recent years in creating a solid foundation, therefore Sat Nusa succeedded obtaining a very good achievement in 2012.

Page 19: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 19

PAndAngAnATAsProsPEKUsAhAyAngdisUsUndirEKsi

Berkaca pada pencapaian operasional dan finansial ditahun 2012, Dewan Komisaris menaruh harapan dan kepercayaan yang tinggi pada prospek usaha Sat Nusa di tahun-tahun mendatang yang disusun Di-reksi.

Namun, mengingat sifat bisnis Layanan Manufaktur Elektronik yang sangat kompleks saat ini, dimana faktor-faktor eksternal seperti kenaikan harga ko-moditas, perlambatan pertumbuhan ekonomi global, persaingan yang ketat dan kebijakan kenaikan upah minimum dapat mempengaruhi kinerja Perseroan secara signifikan. Dewan Komisaris berniat untuk memperkuat peran pengawasannya sehingga Pers-eroan masih akan mampu meningkatkan kinerja keuangan dan operasional serta meningkatkan kin-erja anak perusahaan untuk memberikan kontribusi positif kepada Perusahaan.

Akhirnya, atas nama Dewan Komisaris, saya hendak mengucapkan terima kasih kepada Para Pemegang Saham atas segenap dukungan yang diberikan, dan kepada Manajemen serta seluruh Karyawan atas ker-ja kerasnya sehingga Perusahaan dapat membuku-kan kinerja yang solid di tahun 2012,

Penghargaan juga kami sampaikan kepada segenap Pelanggan, Mitra Kerja dan Mitra Usaha Perseroan mengingat segenap pencapaian Sat Nusa pada tahun 2012 juga tidak terlepas dari peran dan kontribusi yang telah diberikan.

ViEws on BUsinEss ProsPECTs Pro-PosEdByThEBoArdofdirECTors

Reflecting on outstanding operational and finan-cial achievements recorded in 2012, the Board of Commissioners places high expectation and con-fidence in Sat Nusa’s business prospects for the coming years, as prepared by the Board of direc-tors.

However, considering the highly complex nature of Electronic Manufacturing Service business to-day, whereby external factors such as increases in commodities prices, slow down in global economic development, tight competition and minimum wages increment policy could influence the Com-pany’s performance to a large degree, the Board of Commissioners intend to strengthen our super-visory role so that the Company will still be able to improve its financial and operation performance as well as enhance the performance of its subsidi-ary to give positive contribution to the Company.

In closing, on behalf of the Board of Commission-ers, I would like to express my appreciation to the shareholders for all the support and to the man-agement and employees of Sat Nusa for the hard work that had enabled the Company to achieve a solid performance in 2012.

We would also like to appreciate all our customers, business partners and colleagues of Sat Nusa for their contributions to the Company’s performance in 2012.

sofjan wanandikomisaris utamaPresident Commissioner

Page 20: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 20

LAP

OR

AN

DIR

eK

SI

Re

PO

RT

FRO

M B

OA

RD

OF

DIR

eC

TOR

S

Page 21: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 21

Pemegang saham yang terhormat,Dear distinguished shareholders,

Dengan penuh rasa syukur kepada Tuhan Yang Maha Kuasa, kami melaporkan pencapaian kinerja Pers-eroan pada tahun 2012. Berkat rahmatNya, kerja keras seluruh staf dan didukung kondisi keuangan yang solid serta sistem yang efektif, Perseroan men-catat suatu kinerja keuangan yang baik walaupun ke-tika memasuki tahun tersebut Perseroan dibayangi berbagai macam situasi dan kepercayaan bisnis yang kurang mendukung.

Penyelesaian krisis hutang di Eropa yang tidak kun-jung selesai serta adanya pemangkasan anggaran belanja negara - negara Eropa yang terjadi sepanjang tahun 2012 mendorong Perseroan menyesuaikan se-mua penetapan target. Guna mengantisipasi kondisi yang terjadi pada saat itu, Perseroan berupaya untuk lebih meningkatkan keseimbangan antara produksi dan persediaan, mengkaji kembali semua rencana investasi dan memperketat penggunaan arus kas Perseroan. Secara intensif Perseroan juga menjaga struktur biaya produksi, mendorong berbagai upaya efisiensi serta terus meningkatkan sinergi semua lini bisnis.

KinErJAPErsEroAn

Dibayangi oleh gangguan dalam rantai pasokan elek-tronik yang disebabkan oleh bencana alam yang mel-anda Jepang, banjir di Thailand dan langkah-langkah penghematan anggaran belanja negara yang diterap-kan oleh banyak negara maju, Sat Nusa memperkira-kan banyak pelanggan akan memangkas perkiraan penjualan pada tahun 2012 untuk melakukan konsoli-dasi dan mempertahankan bisnis mereka maka akan berdampak pada penurunan penjualan Perseroan se-hingga top manajemen menetapkan target penjualan untuk 2012 menjadi USD 226.568.133 dengan mem-pertimbangkan kondisi perekonomian global.

Pada akhir tahun, Sat Nusa berhasil membukukan total penjualan yang melampaui target Penjualan sebesar 5,65%. Penjualan yang meningkat telah pula menghasilkan peningkatan laba Perseroan. Hal ini menunjukkan bahwa Sat Nusa mengalami pertum-buhan kinerja yang baik dan perbaikan aspek opera-sional dibandingkan dengan tahun 2011. Keberhasi-lan ini merupakan hasil dari peningkatan kualitas perencanaan dan pelaksanaan dari seluruh mata rantai operasional dengan sistem yang terpadu, serta kapabilitas personil.

By the grace of God Almighty, it gives us great pleasure to report to you Sat Nusa’s performance for 2012. Through all of our employees’ hard work, supported by effective systems and a solid finan-cial structure, Sat Nusa recorded a good financial performance, despite being initially overshadowed by the uncertainties surrounding the economy and business confidence earlier in the year.

Settlement of the sovereign debt crisis in Europe that is far from complete and implementation of austerity measures that happened in some of the European countries in 2012 led us to adjust all of our targets. To anticipate the conditions at that time, we strived to balance production and inven-tory, re-evaluate all of our investment plans and monitor our cash flows. We also reviewed our pro-duction expenses carefully, pushed to enhance ef-ficiency, as well as continue to enhance synergies across all business lines.

ComPAnyPErformAnCE

Overshadowed by the disruption in electronic sup-ply chain caused by natural disasters that hit Ja-pan, the flood in Thailand and austerity measures implemented by many developed countries, Sat Nusa expected many customers would slash their sales forecast in 2012 in order to consolidate and sustaining their business hence resulting in a drop in our sales. The top management has set the sales target for 2012 to be USD 226,568,133 taking into account adverse global economic condition.

By the end of the year, Sat Nusa managed to book total sales exceeding our target by 5.65%. Sales growth has resulted in expanded Company profits, showing performance in the growth of Sat Nusa and in improvements in its operational aspects, compared to those of 2011. This success is the re-sult of the improved quality of planning and execu-tion of all operational aspects under an integrated system, as well as in personnel capabilities.

Page 22: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 22

Perseroan menutup akhir tahun 2012 dengan posisi keuangan yang solid. Dimana per 31 Desember 2012, Perseroan memiliki kas dan setara kas sebesar USD 8.072.410 yakni mengalami peningkatan signifikan dari USD 731.401 ditahun 2011. Selain daripada itu, Perseroan juga tidak memiliki pinjaman bank per 31 Desember 2012. Salah satu faktor peningkatan pada kas dan setara kas dikarenakan oleh kas bersih yang digunakan untuk aktivitas investasi mengalami penu-runan dari USD 7.922.148 ditahun 2011 menjadi USD 2.195.333 ditahun 2012. Hal ini dikarenakan pada ta-hun 2011, adanya pembelian capital expenditure yang cukup signifikan untuk “SMT Revamp Project” yakni peremajaan mesin SMT.

Seiring dengan posisi keuangan Perseroan yang kuat disepanjang tahun 2012, Perseroan mengambil lang-kah strategis dengan mengajukan pengurangan har-ga atau diskon dari pemasok dengan memperpendek jangka waktu pembayaran dengan selalu memper-timbangkan efek ekonomis terhadap keuntungan Pe-rusahaan.

Perseroan mengambil langkah inisiatif dalam me-berikan layanan baru kepada pelanggan Perseroan yakni “Layanan Design” melalui kerjasama dengan perusahaan design sebagai terobosan dalam pem-berian pelayanan terintegrasi kepada pelanggan. Ini merupakan salah satu strategi Perseroan untik men-ingkatkan ketergantungan pelanggan pada Perusa-haan sehingga keberlangsungan bisnis dapat lebih terjamin.

KEndAlA-KEndAlA

Melihat dinamika yang terjadi beberapa tahun bela-kangan ini khususnya pulau Batam dimana terjadi kenaikan Upah Minimum Kota (UMK) sebesar 18,80%ditahun 2012 dan menjadi mimpi buruk bagi pelaku usaha sehingga beberapa perusahaan terpaksa harus menggulung tikar. Perseroan harus bekerja ek-stra keras untuk mengurangi dampak kenaikan UMK terhadap profitabilitas Perseroan dengan melakukan pendekatan kepada pelanggan untuk meninjau kem-bali harga jual dan mengintensifikasikan penggunaan semi-automated robot kit. Dalam hal melakukan pe-masaran, Perseroan lebih menfokuskan pada proyek yang lebih “machine intensive” dibandingkan dengan “labor intensive” untuk mengurangi ketergantungan terhadap tenaga kerja manusia.

gAmBArAnProsPEKUsAhA

Tahun 2013 ini, Indonesia dikejutkan dengan peneta-pan kenaikan upah yang sangat signifikan di sejumlah wilayah. Di wilayah Jakarta dan kota-kota sekitarnya, kenaikan upah minimum mencapai lebih dari 40%.

The Company managed to end 2012 with a solid fi-nancial position. Where per December 31, 2012, the Company had cash and cash equivalents of USD 8,072,410 which is a significant increase from USD 731,401 in 2011. Apart from that, the Company has no bank loans as of 31 December 2012. One of the factors in the increase in cash and cash equiva-lents was due to the net cash used in investing activities decreased from USD 7,922,148 in 2011 to USD 2,195,333 in 2012. This is due to there was a quite significant capital expenditure in 2011 for the rejuvenation of SMT machines or known as “SMT Revamp Project”.

Along with the Company’s strong financial posi-tion throughout the year 2012, the Company took a strategic step by proposing reductions or dis-counts from vendors by shortening the payment period taking into account the economic effects of the Company’s profits.

Company has taken the initiative in providing new service to customers of the Company namely “De-sign service” collaborating with design firm as a breakthrough in the provision of integrated servic-es to customers. This is one of our strategy to in-crease customer reliance on the Company’s busi-ness so that business continuity can be assured.

ChAllEngEs

Looking at the dynamic changes that occurred in recent years especially in Batam island in which there was an increase of the Minimum Wage Em-ployment (UMK) of 18.80% in 2012 and it becomes a nightmare for businesses resulting in some com-panies were forced to fold. The Company had to work extra hard to minimize the impact on mini-mum wages surges to the profitability of the Com-pany by approaching the customer to review the selling prices, intensify the use of semi-automated robot kit. In the search for new potential business, the company focused more on projects that are more “machine intensive” as opposed to “labor in-tensive” to reduce reliance on human labor.

oVErViEwofBUsinEssProsPECT

In 2013, Indonesia was surprised by the determina-tion of significant wage increases in a number of areas. In Jakarta and its surrounding cities, mini-mum wage increases by more than 40%.

Page 23: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 23

Pada akhir tahun 2012, gubernur Kepri mengadakan forum diskusi dengan serikat buruh dan Asosiasi Pengusaha (Apindo) guna membahas kenaikan Upah Minimum Kota. Untuk tahun 2013, telah ditetapkan upah minimum untuk sektor manufaktur sebesar Rp 2.162.400 yang meningkat dari Rp 1.402.000 ditahun 2012 atau setara dengan kenaikan sebesar 54,23%. Lonjakan upah minimum tersebut semakin menam-bah beban bagi Sat Nusa. Dengan kenaikan upah minimum yang begitu signifikan ditahun 2013, ditam-bah dengan demo buruh besar besaran yang terjadi diakhir tahun 2012, membuat iklim usaha Indonesia menjadi tidak kondusif khususnya pulau Batam. Ke-naikan Upah minimum memaksa Perseroan untuk menaikkan harga jual sehingga membuat daya saing Perseroan berkurang dengan kompetitornya diluar negeri.

Hal tersebut berpotensi memiliki dampak negatif terhadap penjualan Perseroan ditahun 2013. Jika hal tersebut terjadi, Perseroan berencana untuk me-mangkas sebagian jumlah tenaga kerja secara berta-hap dengan tidak memperpanjang sebagian kontrak karyawan yang berakhir.

TATAKElolAPErUsAhAAn

Dalam menjalankan bisnis Perusahaan, Sat Nusa memegang erat komitmen terhadap pelaksanaan prinsip-prinsip Good Corporate Governance (GCG). Prinsip prinsip tersebut telah menjadi budaya yang senantiasa melandasi setiap langkah bisnis Peru-sahaan, serta mampu meningkatkan nilai bagi pe-megang saham. Perseroan menyadari bahwa pen-erapan GCG mempunyai relevansi terhadap kinerja perseroan karena nilai akhir penerapan GCG adalah meningkatkan kinerja serta citra perusahaan yang baik. Oleh karena itu, praktik terbaik penerapan GCG menjadi acuan dalam melakukan perbaikan terhadap instrumen kelengkapan pedoman pelaksanaan GCG.

Sat Nusa berkomitmen penuh melaksanakan tata kelola di seluruh tingkatan dan jenjang organisasi dengan berpedoman pada berbagai ketentuan dan persyaratan terkait dengan pelaksanaan Tata Kelola perusahaan yang Baik atau GCG.

Akhirnya, Perseroan mengucapkan terima kasih dan penghargaan kepada seluruh jajaran karyawan Sat Nusa atas dedikasi, loyalitas yang tinggi, semangat inovasi, kebersamaan dan kerja keras serta keingi-nan untuk memberikan yang terbaik bagi Sat Nusa.

At the end of 2012, Kepri governor held a discus-sion forum with labor unions and business people association (Apindo) to address annual increment of minimum wages. For 2013, minimum wage has been set for the manufacturing sector amounted to Rp 2,162,400 which increased from Rp 1,402,000 in 2012, equivalent to an increase of 54.23%. The spike in minimum wages, will further put up more burden for Sat Nusa. With the significant increase in minimum wages in 2013, coupled with massive labor demonstrations that occurred at the end of 2012, resulting the business climate in Indonesia not condusive anymore especially in Batam island. The increase in minimum wages forced Sat Nusa to raise its selling prices hence reducing its com-petitive edges as compared to its oversea competi-tors.

This could potentially have a negative impact on Company’s sales in 2013. if that happens, the Com-pany plans to streamdown its workforce gradually by not extending some of the employees contract.

CorPorATEgoVErnAnCE

In performing the Company’s business, Sat Nusa holds on the commitment to implementing good corporate governance principles. These principles have become a culture that always underlies every step of the Company’s business, and that is able to increase shareholders’ value. The Company real-izes that GCG implementation has direct relevance to the Company’s performance, as the ultimate value of GCG is to improve performance and build a positive image of the Company. GCG best practices acts as a reference in refining GCG instruments.

Sat Nusa is fully committed to implement corpo-rate governance at all levels of the organization, based on GCG regulations and requirements to optimize Good Corporate Governance implementa-tion.

At last, we sincerely thank and express apprecia-tion to all Sat Nusa’s employees, in view of their dedication, unwavering loyalty, innovation spirit, teamwork, perseverance and motivation to give their best to Sat Nusa.

abidindirektur utamaPresident Director

Page 24: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 24

Page 25: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 25

PT Sat Nusapersada Tbk didirikan pada tahun 1990 dan berlokasi di Jl. Pelita VI No 99, Batam 29432, Indonesia sebagai perusahaan yang menyediakan jasa untuk manufaktur elektronik. Sat Nusa terus memperluas dan meningkatkan kualitas layanannya dengan menyediakan layanan yang lebih terintegrasi untuk memberi nilai tambah bagi pelanggannya.

Pada tahun 1996, Perseroan mendirikan Surface Mount Technology (SMT) dan Auto Insert (AIM) de-partemen yang mampu menangani penyisipan IC mikro, Jumper wire, Axial dan Radial.

Auto spindle dan Spray painting didirikan pada ta-hun 2007 untuk memberikan layanan yang lebih ter-padu kepada pelanggan. Pada tanggal 8 November 2007 Perseroan go public dengan menjadi produsen pertama elektronik berteknologi tinggi yang terdaf-tar di Bursa Efek Indonesia (BEI) dengan kode sa-ham “PTSN”. Nilai nominal Rp 150 per saham dan 4.920.000.000 saham sebagai modal dasar, dengan total nilai sebesar Rp 738 miliar. Modal ditempatkan dan disetor penuh untuk publik 1.771.448.000 sa-ham dengan total nilai Rp 265.717.200.000.

Melalui penawaran umum perdana di Bursa Efek Indonesia (BEI), Perseroan mengakuisisi PT SM En-gineering, yang terletak di Lot 8 Citra Buana Center Park III, Jl. Engku Putri, Batam Center 29432, Indo-nesia, dalam penyediaan jasa Metal stamping di in-dustri elektronik, dengan 99,96% kepemilikan oleh PT Sat Nusapersada Tbk. Bersamaan dengan itu, Perseroan juga membeli aset dan bisnis PT Sat Nu-sapersada Brothers di mana total produksi dipindah-kan ke Pabrik 10 dipertengahan tahun 2008, mem-berikan jasa plastic injection, spray painting dan powder coating.

PT Sat Nusapersada Tbk was founded in 1990 and located at Jl. Pelita VI No. 99, Batam 29432, In-donesia as a Company that provides services for electronics manufacturing. We continually expand and improve the quality of our services by providing more integrated services to add more value to our customers.

In 1996, we established Surface Mount Technology (SMT) and Auto Insert (AIM) department that is ca-pable of handling the insertion of micro IC, Jumper wire, Axial and Radial.

Auto Spindle and Spray painting was established in 2007 to provide more integrated service to our customers. On 8th November 2007 the company went public by becoming the first high technol-ogy electronics manufacturer who listed at Indo-nesian Stock Exchange (IDX) with ticker symbol “PTSN”. Nominal par value of IDR 150 per share and 4,920,000,000 shares as the authorized capital, the total worth was IDR 738 billions. The issued and fully paid capital for public was 1,771,448,000 shares with the total value of IDR 265,717,200,000.

Through the initial public offering in Indonesia Stock Exchange (IDX), the Company acquired PT SM Engi-neering, located at Lot 8 Citra Buana Center Park III, Jl. Engku Putri, Batam Center 29432, Indonesia, in the provision of Company’s metal stamping ser-vices in electronic industry, with the 99,96% of own-ership by PT Sat Nusapersada Tbk. Simultaneously, the Company also acquired the business and assets of PT Sat Nusapersada Brothers in which the total production moved to Factory 10 in middle of 2008, providing Company’s plastic injection, spray paint-ing and powder coating services.

TENTANG SAT NUSAPERSADA

ABOUT SAT NUSAPERSADA

ALAMAT KANTOR PUSAT DAN ENTITAS ANAK

ADDRESS OF HEAD OFFICE AND SUBSIDIARIESSM ENGINEERINGLot 8 Citra Buana Centre Park III, Jalan Engku Putri, Batam Centre 29432Kepri – IndonesiaTel : (+62778) 471 688Fax :(+62778) 471 234Email : [email protected] website : www.satnusa.com

Pt SAt NUSAPERSADA tbkKANtOR PUSAt | HEAD OFFICE

Jl Pelita VI No.99 Batam 29432 - Kepri - Indonesia

Telp : +62 778 425 888Fax : +62 778 426988

Email : [email protected] www.satnusa.com

Page 26: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 26

Pada bulan Juli 2008 Perseroan mengakuisisi 100% Sat Nusa (Putian) Electronic Co, Ltd, yang terletak di Linan Industri, Kabupaten No.88 Ke-camatan Xianyou, Kota Putian, Provinsi Fujian, China, dengan total nilai Rp 57 miliar, sebagai pe-nyedia layanan perakitan dan distribusi elektronik dan duplikasi berbagai segmen usaha Perseroan di China. Pada tahun 2010, Perseroan mengimple-mentasikan rencana restrukturisasi dengan mel-akukan divestasi di China dan mengkonsolidasikan bisnis dengan mendirikan pabrik 11 di mana telah dirampung pada bulan April 2011.

In July 2008 we acquired 100% Sat Nusa (Putian) Electronic Co., Ltd, located at Linan Industrial District No.88, Xianyou County, Putian City, Fujian Province, China, with total value of IDR 57 billions, as a pro-vider of assembly services and electronic distribution and duplication of various segments of the Company’s business and services in China. In 2010, we imple-mented restructuring plan by carrying out divestment in China and consolidate the business by setting up factory 11 which completed in April 2011.

VERTICAL INTEGRATION

INtEGRASI vERtIKAL

SMT

METAL STAMPING

4

PLASTIC INJECTION

FINA

LA

SSEMB

LY

17 Stamping MachinesMachine range from 45 - 300 Tonnages

Production Precision up to 30 micronwire cutting up to 2 micron

Die Stamp up to 3mm in thickness

34 Injection MachinesMachine range from 50 - 380 Tonnages

Gear run out control up to 50 Micron (JGMA3)High stoke count injection & insert molding

Product length up to 600mm

21 SMT linesDual Line concepts

Component Per Hour (CPH) 100,000Chip 0402 (01005)

Flip Chip (C4 Process)Placing Accuracy 30 micron

We offer a fully integrated suite of electronic manufacturing Services that can streamline your supply chain process. The convenience of Vertical integration has the advantage of reducing production lead-time and inventory handled, delivering considerable cost savings.

Perseroan menawarkan layanan Electronic Manufacturing Services yang terintegrasi yang dapat merampingkan proses rantai pasokan Anda. Kenyamanan Integrasi Vertikal memiliki keuntungan mengurangi lead-time dan persediaan produksi, memberikan penghematan biaya yang cukup besar.

Sesuai dengan Akta No 105 tanggal 26 Juni 2008, Jenis usaha Perseroan meliputi perakitan komponen elektronik yang meliputi perakitan komponen jadi untuk produksi alat-alat elektronika serta bidang usaha terkait.

in accordance with act no. 105 dated June 26, 2008, the Company’s business include the type of electronic component as-sembly includes assembly of finished components for the production of electronic devices and related business fields.

Page 27: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 27

KATEgoriUniTProdUKsiProdUCTionUniTs’CATEgory

ProdUK-ProdUKProdUCTs

JaringandanPeralatanKomputerNetwork Equipment and Computers

Video Editing Perihperal, Battery Contact for Laptop, Smart Card Reader, Scanner, Network Power Supply, Transformer, Computer Network Hub, Mouse, Wireless Card, CD ROM, Disk Drive, Power Supply, Thumb Drive, Floopy Disc

PeralatanElektronikrumahTanggaConsumer Electronics and Devices

Mobile Bluetooth, Exhaust Fan, Camera Lens, Device, Digital Camcorder, TV Power Supply, , Watch, Home Audio, DVD Travel Unit, Plasma TV Components, DVD Mechanism Port, LCD TV ,LED TV, Emergency Light, Bosch, Bosch Neff, Vacuum Cleaner, Microwave Oven, Display Unit, Camera, Digital Media Player, Display Control Module for Carriage, Image Capture, Video Capture, TV Tuner Board, Security Device, Set-Top Box, Ticket Vend-ing Machine, TV Media Box, Shaver, Currency Counter, Remote Control, Multimedia Tuner, Ice Maker, Hand Iron, IC Frame Box, Pricing Display Box, Packing IC, Heating Gun, Electronic Typing Machine, Vacuum Cleaner, Microwave Control Panel, Display Alarm

ProdukTelekomunikasiTelecom Products

Telecomunication, Passanger Intercomm Com-munication Unit, Nokia Mobile Phone, Tape Assy, HP Charger, Passenger Audio Communication Unit

ElektronikotomotifAutomotive Electronics

Motor Controller, MRT Door Opening, Bluetooth in Vehicle, Car Electronics, Car Audio Complete Set, Bicycle

Page 28: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 28

Page 29: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 29

In line with Sat Nusa’s Strategy to provide Fully Integrated Suite of Solution from SMT, Plastic Moulding, Metal Stamping to Final As-sembly, Sat Nusa fabricates the metal and plastic parts in house and assembles into Complete Set. Sejalan dengan Strategi Sat Nusa untuk menyediakan Layanan Solusi Terpadu dari SMT, Plastik Moulding, Metal Stamping sampai dengan Perakitan Produk Jadi, Sat Nusa telah memproduksi bagian logam dan plastik secara internal dan dirakit menjadi produk jadi.

car audiokenwood

Page 30: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 30

• Achieveperformancetargetsthroughthegrowthofourbusinessunits• ToensuretheachievementofQualityExcellenceinallaspectsofoperationsandinthemanagementofhu-

man resources• Operatewithinthevaluesandprinciplesof“QualityCreatesFuture”fromproductdesign,deliveringser-

vices, and timely fulfilment of our commitment to customers and business partner• Maximizethedesignandimplementationoffullturnkeyprojectsandhightechnologytosupportthedevel-

opment of high-end products with high profit margin• Aggressivelyexpandinternationalnetwork

•Mencapaitarget-targetkinerjamelaluipertumbuhanunit-unitbisnisPerseroan•MemastikanpencapaianKualitasTerbaikpadasemuaaspekoperasidanpengelolaansumberdaya

manusia• Beroperasiberdasarkannilai-nilaidanprinsip-prinsip“KualitasMenciptakanMasaDepan”,mulai

dari desain produk, layanan pengiriman, dan pemenuhan komitmen kami secara tepat waktu kepada para pelanggan dan mitra usaha

•Memaksimalkandesaindanimplementasiproyek-proyekproduksiappakaidanteknologitinggiuntukmendukung pengembangan produk-produk berkualitas terbaik dengan margin keuntungan yang tinggi

• Secaraagresifmemperluasjejaringinternasional

• EstablishpositioninAsiaasahigh-technologyelectronicsmanufacturer• Enhancethecompany’sprofitandsustainablegrowththroughtheprovision

of integrated solution to customers• Consistentlyprovidegreatervalueforshareholdersbyoptimizingcompany

performance and development

•Menjadipemainbisnisyangdiakuidalamindustrimanufaktureletronikberteknologi tinggi di kawasan Asia

•MeningkatkankeuntungandanpertumbuhanberkelanjutanPerseroanmelalui penyediaan solusi terpadu bagi pelanggan

• Secarakonsistenmemberikannilailebihbesarkepadaparapemegangsaham dengan mengoptimalkan kinerja dan perkembangan Perseroan

corporatevision & Mission

Visi-Vision

misi-mission

Page 31: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 31

corporate valuebudaya Perusahaan

IDEAS

OPERATIONAL

GOOD CORPORATE GOVERNANCE

PRINCIPLES PRINCIPLES

CORPORAtEvALUE

INtEGRItY, DISCIPLINE, ECO-FRIENDLY, ADDED vALUE, SAFEtY

QUALItY, COSt, DELIvERY, SERvICE tRANSPARENCY, ACCOUNtABILItY, RESPONSIBILItY, INDEPENDENCY, FAIRNESS

QCDS TARIF

Sat Nusa memiliki komitmen tinggi untuk memban-gun budaya budaya yang berlaku di perusahaan se-hingga diharapkan akan mewujudkan lingkungan kerja yang kondusif untuk mencapai visi dan misi perusahaan. Budaya Perusahaan terdiri dari Integri-tas, Disiplin, Ramah Lingkungan, Nilai Tambah dan Keselamatan. Sistem nilai yang dikembangkan dalam perusahaan, diharapkan dapat mengubah sikap dan perilaku Sumber Daya Manusia (SDM) sehingga me-munculkan motivasi yang tinggi, kepuasan kerja men-ingkat, sikap dan tindakan terarah, pergaulan yang lebih akrab, disiplin meningkat, tumbuhnya kemauan untuk terus belajar serta memiliki tanggung jawab untuk memberikan yang terbaik bagi Perseroan.

Sat Nusa is highly commited to build the corporate value applicable in the company in order to be able to create conducive working environment to real-ize the vision and mission of the company. Company Values consists of Integrity, Discipline, Eco-Friend-ly, Added Value, and Safety. The values developed in the company are expected to alter the attitude and behavior of the human resources of the company to bring out the strong motivation, increase the work satisfaction, direct attitude and behavior, cre-ate friendly relations, increase discipline, grow the passion to keep studying, and have responsibility to give the best to the company.

Page 32: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 32

Memberikan nilai tambah kepada pelanggan melalui rangkaian integrasi vertikal dan solusi terpadu serta penyempurnaan bekerlanjutan yang mampu memperpendek rantai pasokan. Konsep integrasi vertikal bertujuan untuk mengurangi produksi lead-time dan penurunan inventaris bahan baku yang memberikan penghematan biaya yang signifikan.

Delivering added value in the eyes of our customers through our vertical integrated suite of solution capable of streamlining supply chain process. The concept of Vertical integration aims to reduce production lead-time and inventory handled, delivering considerable cost savings.

Perseroan mematuhi standar keselamatan dan kesehatan yang berlaku untuk melindungi karyawan, pel-anggan, pemasok dan masyarakat di mana Perseroan beroperasi dengan melakukan identifikasi bahaya dan pengendalian risiko yang tepat serta meningkatkan kesadaran dan pengetahuan tentang keselamatan dan kesehatan kerja.

We adhere to the highest standards to ensure the safety and health of our employees, our customers and the people of the communities in which we operate. We continuously make every effort to prevent injuries and occu-pational illnesses. We put a strong effort on increasing awareness and knowledge on safety and safe behaviour.

Perseroan terus menerus mendorong aktivitas penghematan pemakaian sumber daya alam, mengurangi pencemaran lingkungan serta turut melestarikan lingkungan melalui prinsip 3R (reduce, reuse dan re-cylce).

We constantly monitor our air, water and land quality to ensure our operations do not pollute the environment. By controlling the consumption of chemical in our operation, we are reducing the risk of polluting our environ-ment through our chemical waste management.

eco-friendly

added value

safety

raMah lingkungan

nilai taMbah

keaManan

ideas

discipline disiPlinPerseroan mempertahankan disiplin kerja yang tinggi untuk menegakkan kode etik, peraturan dan regu-lasi perusahaan sehingga masing-masing dari kami berperilaku secara profesional dan disiplin setiap saat. Mempertahankan disiplin di tempat kerja sangat penting dalam menciptakan lingkungan kerja yang aman dan nyaman bagi karyawan dan manajemen.

We are maintaining a strict discipline at our work place to uphold Corporate code of conduct, rules and regula-tions so that each of us behave in a professional and disciplined manner at all times. Maintaining discipline in the workplace is vital in creating a safe and comfortable working environment for both employees and the management.

integrity integritasKami secara pribadi bertanggung jawab untuk standar tertinggi dari perilaku masing-masing, termasuk kejujuran dan keadilan dalam semua aspek pekerjaan, memenuhi komitmen sebagai warga negara dan karyawan yang bertanggung jawab dan secara konsisten akan memperlakukan pelanggan dan sumber daya perusahaan dengan baik.

We are each personally accountable for the highest standards of behavior, including honesty and fairness in all aspects of our work. We fulfill our commitments as responsible citizens and employees. We will consistently treat customers and company resources with the respect they deserve.

Page 33: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 33

quality

cost

delivery

service

quality cost delivery service

kualitas

biaya

PengiriMan

servis

Berkat perjuangan Perseroan untuk selalu melakukan penyempurnaan (kaizen), sehingga memberikan manfaat langsung bagi pelanggan Perseroan. Keseriusan Sat Nusa dalam menjaga kualitas seluruh pros-es produksinya sangat penting untuk memastikan bahwa produk yang dihasilkan oleh Perseroan memiliki kualitas tertinggi.

Thanks to the company’s constant striving for improvement (kaizen), which has direct benefits for our custom-ers. Sat Nusa’s insistence on maintaining quality throughout the production process is vital to ensuring that our products are of the highest quality.

qcds

Dengan memilih Sat Nusa untuk memproduksi produk mereka, pelanggan dipastikan telah membuat pili-han yang baik. Kaizen memastikan bahwa Sat Nusa menerapkan inovasi produk yang efektif dan memak-simalkan produktivitas. Kualitas produk Sat Nusa memungkinkan pelanggan Perseroan untuk menikmati pengembalian yang tinggi atas investasi mereka.

By choosing Sat Nusa to manufacture their products, customers can be sure of having made a good choice. Kaizen ensures that Sat Nusa products feature effective innovations and maximising productivity. The quality of Sat Nusa’s products allows their customers to enjoy a high return on their investment.

Sat Nusa memiliki sistem yang memastikan bahwa hasil produksi sesuai dengan pengiriman tepat waktu. Alur kerja Sat Nusa yang lancar dan dioptimalkan secara terus menerus, sirklus kerja yang diukur dan direncanakan dengan hati-hati dan pergerakan barang sesuai permintaan, memungkinkan Perseroan un-tuk secara konsisten memenuhi harapan pelanggannya.

Sat Nusa’s system ensures that production output corresponds with on time delivery. Sat Nusa’s smooth, continuous and optimised workflows, with carefully planned and measured work-cycle times and on-demand movement of goods, allow them to consistently meet their customer’s expectations.

Memberikan pelayanan terbaik kepada pelanggan merupakan prioritas utama Perseroan. Segala sesuatu yang dilakukan berdasarkan pada tujuan ini baik secara langsung maupun tidak langsung. Perseroan menghormati pelanggannya, memahami kebutuhan dan keinginan mereka, dan melakukan yang terbaik untuk memenuhinya melalui layanan yang Perseroan berikan. Setiap pelanggan yang senang dan puas merupakan tonggak sejarah bagi Perseroan.

Delivering the best service to our customers is our highest priority. Everything we do serves this purpose di-rectly or indirectly. We respect our customers, understand their needs and wants, and do our best to fulfill them through the services we deliver. Each happy and satisfied customers is a milestone for us.

Page 34: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 34

KOMISARIS INDEPENDEN

KOMITE AUDIT

KOMISARIS UTAMA

DIREKTUR UTAMA

KOMISARIS

DIREKTUR KEUANGAN (tidak terafiliasi) DIREKTUR OPERASIONAL

SEKRETARIS PERUSAHAANAUDIT INTERNAL

PEMASARAN & PENJUALAN

TIM INOVASI

PERENCENAAN PERUSAHAAN PRODUKSI

AKUNTANSI

LOGISTIKKEUANGAN

SUMBER DAYA MANUSIA

CORPORATE COMMUNICATION

HUBUNGAN INVESTOR

HUKUM

TEKNOLOGY INFORMASI

INDEPENDENT COMMISSIONER

AUDIT COMMITTEE

PRESIDENT COMMISSIONERSOFJAN wANANDI

USMAN FAN ANAS, S.E

ANAS, S.E

ABIDIN

MEGAwATI

SANTOSO, S.E

PONIAN HERMIN

A.HAN

STEVEN ANDISI

ALEx CHANDRA

wILSON YAP, S.H

TAN SIANG HUA

KUSTINA

LICEN

RUSDIANA

RUSDIANA

SMAILLY ANDY

SMAILLY ANDY

BIDIN YUSUF

PRESIDENT DIRECTOR

COMMISSIONER

FINANCE DIRECTOR (non affiliated) OPERATIONAL DIRECTOR

CORPORATE SECRETARYINTERNAL AUDIT

MARKETING & SALES

INNOVATION TEAM

CORPORATE PLANNING PRODUCTION

ACCOUNTING

FINANCE LOGISTIC

HUMAN RESOURCES

KOMUNIKASI PERUSAHAAN

INVESTOR RELATION

LEGAL

INFORMATION TECHNOLOGY

STR

UKT

UR

OR

GAN

ISAS

IORGANIZAT

ION

S

TRU

CTU

RE

Page 35: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 35

USMAN FANKOMISARIS COMMISSIONERUMUR | AGE 42

SOFJAN WANANDIKOMISARIS UTAMA

PRESIDENT COMMISSIONERUMUR | AGE 71

ANAS, S.EKOMISARIS INDEPENDEN

INDEPENDENT COMMISSIONERUMUR | AGE 50

BIDIN YUSUFDIREKTUR OPERASIONAL OPERATIONAL DIRECTORUMUR | AGE 54

SANtOSO, S.EKEPALA UNIT AUDIT INTERNALHEAD OF INTERNAL AUDITUMUR | AGE 49

ABIDINDIREKTUR UTAMA

PRESIDENT DIRECTORUMUR | AGE 50

MEGAWAtIDIREKTUR KEUANGAN (TIDAK TERAFILIASI)

FINANCE DIRECTOR (NON AFFILIATED)UMUR | AGE 35

ANAS, S.EKETUA KOMITE AUDIT

CHIEF OF AUDIT COMMITTEEUMUR | AGE 50

RUSDIANASEKRETARIS PERUSAHAAN

CORPORATE SECRETARyUMUR | AGE 40

YURI HERONOANGGOTA UNIT AUDIT INTERNAL

MEMBER OF INTERNAL AUDITUMUR | AGE 41

GLENN MARTINUS MARJONO, S.E., M.M. CPAANGGOTAMEMBERUMUR | AGE 33

NETTY, S.EANGGOTAMEMBER

UMUR | AGE 28

THE PROFILE riWayaT HiDUp

Page 36: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 36

SOFJAN WANANDIKOMISARIS UTAMA • PRESIDENT COMMISSIONER

TIDAK TERAFILIASI (NON-AFFILIATED)

Sejak tahun 2007, Sofjan Wanandi diangkat sebagai Komisaris Utama Perseroan. Hingga kini, beliau juga merupakan anggota Direksi Santini Group sejak tahun 1999 dan Centre for Strategic and International Studies (CSIS) sejak tahun 1973. Selama bertahun-tahun Sofjan Wanandi menjabat posisi penting di Ge-mala Group (Direktur Utama, 1980-1999) dan Prakarti Yoga Group (Presiden Direktur, 1996-1999; Direktur, 1974-1996). Beliau juga aktif sebagai anggota Dewan Penasihat PT Thiess Contractors Indonesia sejak tahun 2005 dan Deutsche Bank Asia sejak tahun 2007, selain pernah menjadi anggota Dewan Penasihat di Capital Group Companies (1996-1998) dan Carlyle Group (1998-2000). Sofjan Wanandi sekarang juga menjadi anggota Konsulat Internasional Asia Society, Direktur Utama Komite Pemulihan Ekonomi Na-sional (KPEN) Kamar Dagang dan Industri (KADIN) Indonesia, Wakil Direktur Utama Konsul Pengawasan Nasional KADIN Indonesia, dan Ketua Umum Dewan Pimpinan Nasional (DPN) Asosiasi Pengusaha In-donesia (APINDO). Beliau ditunjuk berdasarkan akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perseroan No.14 tanggal 7 Agustus 2007, dibuat oleh Fathiah Helmi, S.H., Notaris di Jakarta.Beliau memperoleh gelar Sarjana Ekonomi dari Universitas Indonesia dan Universitas Padjadjaran.

Since 2007, Sofjan Wanandi has been assigned as the Company’s President Commissioner. Until present, he is also a member of Board of Directors’ of Santini Group since 1999 and of Centre for Strategic and International Studies (CSIS) since 1973. For years, Sofjan Wanandi employed the key positions of Gemala Group (Chairman, 1980-1999) and Prakarti Yoga Group (President Director, 1996-1999; Director, 1974-1996). He is also active as a member of Advisory Board of PT Thiess Contractors Indonesia since 2005 and Deutsche Bank Asia since 2007, and formerly was a member of Advisory Board of Capital Group Companies (1996-1998) and Carlyle Group (1998-2000). Presently, Sofjan Wanandi is also a member of Asia Society International Council, the Executive Chairman of National Economy Recovery Committee (KPEN) of lndonesian Chamber of Commerce and lndustry (KADIN), the Vice Chairman of National Supervisory Council of lndonesian KADIN, and the Chairman of DPN of Employers Association of Indonesia. He was appointed by deed No.14 through Extraordinary Shareholders Meeting of the Company, dated August 7, 2007, made by Fathiah Helmi, SH, Notary in Jakarta. He earned a Bachelor of Economics from the University of Indonesia and University of Padjadjaran.

Riwayat Hidup dewan KomisaRisPROFILES OF THE BOARD OF COMMISSIONERS

Page 37: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 37

Since 2007, Usman Fan has been served as the Company’s Commissioner. Until now, he is also the Commis-sioner of PT. BPR Mutiara Cemerlang Barelang since 2009, Commissioner of PT Guna Surya Binamandiri since 2004, President Director of PT Putra Andalas Sejati and PT Fanindo Propertindo since 2001, and PT Fanindo Chiptronic since 1994. Previously, Usman Man was the President Director of PT Sat Techindo (2000-2002) and PT Fanindo Genmik Perkasa (1994-2005). He was appointed by deed No.14 through Extraordinary Shareholders Meeting of the Company, dated August 7, 2007, made by Fathiah Helmi, SH, Notary in Jakarta. He accomplished Business Management Diploma study at Stanford City College, Singapore.

USMAN FANKomisaris • CommissionerTERAFILIASI (AFFILIATED)

Sejak tahun 2007, Usman Fan menjabat sebagai Komisaris Pers-eroan. Sampai sekarang, Beliau juga menduduki posisi Komisaris Utama PT. BPR Mutiara Cemerlang Barelang sejak tahun 2009, Komisaris PT Guna Surya Binamandiri sejak tahun 2004, Presiden Direktur PT Putra Andalas Sejati dan PT Fanindo Cipta Propertindo sejak tahun 2001, dan PT Fanindo Chiptronic sejak tahun 1994. Se-belumnya Usman Fan pernah menjabat sebagai Presiden Direk-tur PT Sat Techindo (2000-2002) dan PT Fanindo Genmik Perkasa (1994-2005) . Beliau ditunjuk berdasarkan akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perseroan No.14 tanggal 7 Agustus 2007, dibuat oleh Fathiah Helmi, S.H., Notaris di Jakarta. Beliau menamatkan studi Diploma Manajemen Bisnis di Stanford City College, Singapura.

Since 2007, Anas, S.E. has been assigned as the Company’s Independent Commissioner. Until present, he is also served as the President Director of PT Panca Wira Seraya and PT Intan Wira Seraya since 1995, and PT Graha Seraya Pratama (Novotel Batam) since 1992. Currently, Anas, S.E. is also the Director of PT Trimitra Batam Per-tama since 2000, PT Uniseraya and PT Panca Eka Bina Plywood Industry since 1995, PT Adithya Seraya Korita since 1994, and PT Batama Nusa Permai since 1992. He is Vice Rector II of Batam International University, the President of Indonesian Hotel and Restaurant Association in Batam, and the Founder of Clarissa Foundation (Global Indo-Asia School, Batam) and Kallista Foundation (Kallista School. Batam). He was appointed by deed No.14 through Extraordinary Shareholders Meeting of the Company, dated August 7, 2007, made by Fathiah Helmi, SH, Notary in Jakarta. He gained Bachelor Degree of Economy from Trisakti University, Jakarta.

ANAS, S.EKomisaris independen • independent CommissionerTIDAK TERAFILIASI (NON-AFFILIATED)

Sejak tahun 2007, Anas, S.E. ditunjuk menjadi Komisaris Inde-penden Perseroan. Sampai saat ini, Beliau juga menjabat sebagai Direktur Utama PT Panca Wira Seraya dan PT Intan Wira Seraya sejak tahun 1995, dan PT Graha Seraya Pratama (Novotel Batam) sejak tahun 1992. Hingga sekarang, Anas, S.E. juga menjabat se-bagai Direktur PT Trimitra Batam Pertama sejak tahun 2000, PT Uniseraya dan PT Panca Eka Bina Plywood Industry sejak tahun 1995, PT Adithya Seraya Korita sejak tahun 1994, dan PT Batama Nusa Permai sejak tahun 1992. Beliau juga adalah Wakil Rek-tor II Universitas Internasional Batam, Ketua Asosiasi Perhotelan dan Restoran Indonesia di Batam, serta pendiri Yayasan Clarissa (Sekolah Global Indo-Asia, Batam) dan Yayasan Kallista (Sekolah Kallista. Batam). Beliau ditunjuk berdasarkan akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perseroan No.14 tanggal 7 Agustus 2007, dibuat oleh Fathiah Helmi, S.H., Notaris di Jakarta. Beliau meraih gelar Sarjana Ekonomi dari Universitas Trisakti, Jakarta.

Page 38: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 38

ABIDINDIREKTUR UTAMA

PRESIDENT DIRECTOR

BIDIN YUSUFDIREKTUR OPERASIONAL OPERATIONAL DIRECTOR

MEGAWAtIDIREKTUR KEUANGAN (TIDAK TERAFILIASI)

FINANCE DIRECTOR (NON AFFILIATED)

Riwayat Hidup diReKsiPROFILES OF THE BOARD OF DIRECTORS

Page 39: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 39

ABIDINdireKtur utama • president direCtorTERAFILIASI (AFFILIATED)

Sejak tahun 1990, Abidin menjabat sebagai Direktur Utama Perseroan. Beliau pernah menjadi Manajer Produksi PT Singamip (1989-1990) dan General Manager PT Hi Tech Agratekron Sempurna (1987-1989). Abidin juga merupakan Ketua Dewan Pimpinan Kota (DPK) APINDO Batam dari tahun 2003-2009, Ketua Dewan Pengurus Propinsi (DPP) APINDO Kepulauan Riau dari tahun 2004-2009, dan Dewan Penasihat Paguyuban Sosial Marga Tionghoa Indonesia (PSMTI) sejak tahun 1998.Dewan Kehormatan APINDO Kepri sejak tahun 2009. Beliau ditunjuk berdasarkan akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perseroan No.14 tanggal 7 Agustus 2007, dibuat oleh Fathiah Helmi, S.H., Notaris di Jakarta.

Since 1990, Abidin has been served as the Company’s President Director. Previously, he was the Production Manager of PT Singamip (1989-1990) and General Manager of PT Hi Tech Agratekron Sempurna (1987-1989). Abidin has also been the Chairman of DPK APINDO Batam since 2003 and DPP APINDO Riau Island since 2004, and Board of Advisors member of PSMTI. Honorary Board of APINDO Kepri since 2009. He was appointed by deed No.14 through Extraordinary Shareholders Meeting of the Company, dated August 7, 2007, made by Fathiah Helmi, SH, Notary in Jakarta.

BIDIN YUSUFdireKtur operasional • operational direCtorTERAFILIASI (AFFILIATED)

Sejak tahun 2007, Bidin Yusuf diangkat sebagai Direktur Operasional Perseroan. Sebelumnya, beliau adalah General Manager PT Sat Nusapersada Brothers (1995-2007) dan Perseroan (1999-2007), serta Supervisor di PT McDermott Indonesia (1982-1995). Beliau ditunjuk berdasarkan akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perseroan No.14 tanggal 7 Agustus 2007, dibuat oleh Fathiah Helmi, S.H., Notaris di Jakarta. Beliau memiliki gelar Diploma dari International Correspondence Schools.

Since 2007, Bidin Yusuf has been assigned as the Company’s Operational Director. Formerly, he was the General Manager of PT Sat Nusapersada Brothers (1995-2007) and the Company (1999-2007), and Supervisor of PT Mc-Dermott Indonesia (1982-1995). He was appointed by deed No.14 through Extraordinary Shareholders Meeting of the Company, dated August 7, 2007, made by Fathiah Helmi, SH, Notary in Jakarta. He obtained his Diploma degree from International Correspondence Schools.

MEGAWAtIFINANCE DIRECTOR (NON AFFILIATED)DIREKTUR KEUANGAN (TIDAK TERAFILIASI)

Sejak tahun 2007, Megawati ditunjuk sebagai Direktur Keuangan (Tidak Terafiliasi) Perseroan. Sebel-umnya, beliau adalah Manajer Akuntansi PT Sat Nusapersada (2005-2007) dan Manajer Keuangan PT Kyotronics Indonesia (1997-2005). Megawati pernah meraih penghargaan Medali Emas (urutan pertama di dunia) untuk kategori profesional Manajemen Akuntansi dan Medali Perak (urutan kedua Singapura) untuk kategori profesional Manajemen Keuangan dari Dewan Penguji Kamar Dagang dan Industri Lon-don. Beliau ditunjuk berdasarkan akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Pers-eroan No.14 tanggal 7 Agustus 2007, dibuat oleh Fathiah Helmi, S.H., Notaris di Jakarta. Beliau menyan-dang gelar Diploma dari Thames Business School, Singapura.

Since 2007, Megawati has been appointed as the Company’s Finance Director (Non Affiliated). Before, she was the Company’s Accounting Manager (2005-2007) and the Finance Manager of PT Kyotronics Indonesia (1997-2005). From LCCI Examination Board, Megawati attained the Gold Medal (First World) for Management Ac-counting professional category and the Silver Medal (Second Singapore) for Financial Accounting professional category. She was appointed by deed No.14 through Extraordinary Shareholders Meeting of the Company, dated August 7, 2007, made by Fathiah Helmi, SH, Notary in Jakarta She gained her Diploma degree from Thames Business School, Singapore.

Page 40: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 40

Page 41: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 41

SANTOSO, S.E.Ketua unit audit internal • Head oF internal audit

Sejak tahun 2009, Santoso, S.E. diangkat sebagai ketua unit audit internal. Sebelumnya memangku jabatan auditor Perusahaan sejak tahun 2007 dan menjabat sebagai staf audit sejak tahun 1998, Beliau pernah menjabat sebagai pembukuan di PT Bangun Kayu Irian, PT Lembah Hijau Semesta, PT Anam Kosong Anam (1988-1997), sebagai pembukuan PT Astrido (1988). PT Bank Indonesia Raya (1988), PT Bank Angka-sa Putra (1982-1988). Pernah kuliah di Sekolah Tinggi Akuntansi dan Adminstrasi Jakarta dan mendapat diploma Pembukuan terampil dan Diploma Akuntan tingkat Mahir, dan sekarang sedang menyelesaikan kuliah fakultas ilmu sosial dan politik serta Master Manajemen. Beliau ditunjuk sebagai Kepala Unit Audit Internal berdasarkan pada surat No.004/PTSN/III/2010 tertanggal 12 Maret 2010.

Since 2009, Santoso, S.e. has been appointed as head of internal audit. Previously worked as auditor in the Com-pany since 2007 and served as an audit staff since 1998, he worked as bookkeeper at PT Bangun Kayu irian, PT lembah Hijau Semesta, PT anam Kosong anam (1988-1997), and worked as bookkeeper at PT astrido (1988). PT Bank indonesia raya (1988), PT Bank angkasa Putra (1982-1988). Studied at accounting and administra-tion College of Jakarta and attained skilled accounting diploma and advanced diploma in accounting degree, and now is pursuing degree in social sciences and politics as well as master in management. He was appointed as the Head of internal audit based on a letter no.004/PTSn/iii/2010 dated march 12, 2010.

YURI HERONO, S.E.anGGota unit audit internal • memBer oF internal audit

Sejak tahun 2012, yuri Herono diangkat sebagai anggota unit Internal Audit. Sebelumnya, beliau pernah bek-erja di bagian Account Officer PT. Bank Central Dagang (1996 – 1999). Senior Account Officer PT. Sat Nusa-persada Brothers (1999 – 2007). Beliau memperoleh gelar Sarjana Ekonomi dari Sekolah Tinggi Ilmu Ekonomi PERBANAS Jakarta Indonesia. Beliau ditunjuk sebagai Anggota Unit Audit Internal berdasarkan pada surat No.035/PTSN/X/2012 tertanggal 16 Oktober 2012.

Since 2012, Yuri Herono has been assigned as member of internal audit. Before, he worked in PT. Bank Central dagang, Jakarta, as account officer (1996 - 1999). Senior account officer at PT Sat nusapersada Brothers, Batam (1999-2007). He attained Bachelor in economics from Sekolah Tinggi ilmu ekonomi PerBanaS, Ja-karta indonesia. He was appointed as the member of internal audit based on a letter no.035/PTSn/X/2012 dated october 16, 2012.

SANTOSO, S.E. YURI HERONO, S.E.

Riwayat Hidup unit audit inteRnalPROFILES OF THE INTERNAL AUDIT

Page 42: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 42

RUSDIANASEKRETARIS PERUSAHAANCORPORATE SECRETARy

Sejak tahun 2007, Rusdiana memangku jabatan Sekre-taris Perusahaan Perseroan. Sebelumnya, beliau men-jabat sebagai Sekretaris sekaligus Manajer Keuangan Perseroan sejak tahun 1997. Rusdiana pernah menjabat sebagai Staf Akuntansi dan Keuangan di PT Sistemindra Kontrolindo—Yokogawa (1994-1997), Asisten Supervisor Akuntansi di Delta Holidays, Jakarta (1993-1994), dan Auditor Junior di Kantor Akuntan Publik Drs. Sasongko Mulyo, Jakarta (1992-1993). Beliau meraih gelar Diplo-ma Akuntansi dari Sekoloh Tinggi Ilmu Ekonomi (STIE) Indonesia, Jakarta. Beliau ditunjuk sebagai Sekretaris Perusahaan berdasarkan pada surat penunjukkan cor-porate secretary tertanggal 1 Agustus 2007.

Since 2007, rusdiana has been served as the Company’s Corporate Secretary. Formerly, she was assigned as the Company’s Secretary cum Finance manager since 1997. rusdiana was the accounting and Finance Staff of PT Sistemindra Kontrolindo—Yokogawa (1994-1997), accounting assistant Supervisor of delta Holidays, Ja-karta (1993-1994), and Junior auditor of drs. Sasongko mulyo Public accountant office, Jakarta (1992-1993). She achieved her accounting diploma degree from indonesian economy College, Jakarta. She was appointed as Corporate Secretary based on the letter of appointment of corporate secretary, dated august 1, 2007.

AN

AS,

SE.

KETU

A K

OM

ITE

AU

DIT

C

HIE

F O

F A

UD

IT C

OM

MIT

TEE

GLE

NN

MA

RTIN

US

MA

RJO

NO

,S.E

., M

.M.C

PAA

NG

GO

TAM

EMBE

R

NET

TY, S

.EA

NG

GO

TAM

EMBE

R

Riwayat Hidup seKRetaRis peRusaHaanPROFILES OF THE CORPORATE SECRETARY

Riwayat Hidup Komite auditPROFILES OF THE AUDIT COMMITTEES

Page 43: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 43

ANAS, S.E.Ketua Komite audit • CHieF oF audit Committee

Sejak tahun 2008, Anas, S.E. menjabat sebagai Ketua Komite Audit. Penjelasan lainnya sesuai dengan profil Beliau sebagai Komisaris Independen Perseroan yang ditampilkan sebelumnya pada bagian Profil Dewan Komisaris. Beliau ditunjuk sebagai Ketua Komite Audit berdasarkan pada surat keputusan Dewan Komisaris 001/SK/PTSN/IV/2008 tanggal 28 April 2008.

Since 2008, Anas, S.E. has been assigned as the Company’s Chief of Audit Committee. Other descriptions are in accordance with his profile as the Company’s Independent Commissioner displed before in the Board of Commissioners’ Profile section. He was appointed as Chairman of the Audit Committee by the Board of Com-missioners through decree No. 001/SK/PTSN/IV/2008 dated 28 April 2008.

GLENN MARTINUS MARJONO, S.E., M.M. CPAanGGota • memBer

Sejak tahun 2008, Glenn Martinus Marjono, S.E., Ak., M.M., CPA ditunjuk menjadi Anggota Komite Audit. Saat ini, beliau juga merupakan Kepala Tim Konsultan Manajemen di PT Aegis MAAS Consulting sejak ta-hun 2004 setelah menjadi Konsultan Senior di perusahaan yang sama sejak tahun 2003 serta dosen koor-dinator mata kuliah Pemeriksaan Internal dan Pemeriksaan Manajemen di Trisakti School of Management sejak tahun 2005. Beliau juga pernah bekerja sebagai Budget & Cost Controller Supervisor (2002-2003) dan Management Trainee (2001-2002) di PT Tang Mas (Grup 2 Tang), serta Auditor Junior di Kantor Akun-tan Publik Bismar Sitanggang dan Rekan (2000-2002). Beliau menyandang gelar Magister Manajemen dan Sarjana Ekonomi dari Universitas Tarumanegara, Jakarta, lulus Pendidikan Profesi Akuntan di Institut Teknologi & Bisnis Kalbe, Jakarta dan memperoleh Register Akuntan Negara dengan gelar Akuntan serta lulus ujian Certified Public Accountant dari Ikatan Akuntan Publik Indonesia, Jakarta dengan gelar IdCPA. Beliau ditunjuk sebagai Anggota Komite Audit berdasarkan pada surat keputusan Dewan Komisaris 001/SK/PTSN/IV/2008 tanggal 28 April 2008.

Since 2008, Glenn Martinus Marjono, S.E., Ak., M.M., CPA has served as an Audit Committee Member. Until present, he is the Group Leader of Management Consulting of PT Aegis MAAS Consulting since 2004 as for-merly was the Senior Consultant of the same company since 2003 and Coordinator Lecturer for Internal Audit and Management Audit at Trisakti School of Management since 2005. Before, he was employed as the Budget & Cost Controller Supervisor (2002-2003) and Management Trainee (2001-2002) of PT Tang Mas (Group of 2 Tang), and also the Junior Auditor of Bismar Sitanggang and Partners Public Accountant Firm (2000-2001). He obtained Master Degree in Management and Bachelor Degree from Tarumanegara University, Jakarta, has graduated the Accountant Profession Degree at Kalbe Technology & Business Institute, Jakarta and get the State Accountant Register with Accountant title and passed the Indonesian Certified Public Accountant exam from the Indonesian Institute of Certified Public Accountant, Jakarta with IdCPA title. He was appointed as member of the Audit Committee by the Board of Commissioners through decree No. 001/SK/PTSN/IV/2008 dated 28 April 2008.

NETTY, S.E.anGGota • memBer

Sejak tahun 2012, Netty, S.E. diangkat sebagai anggota Komite Audit menggantikan Ernyan Tan melalui Surat Keputusan Perseroan nomor 001/SK/PTSN/X/2012. sebelumnya beliau merupakan manajer ope-rasional di PT Barelang Mobilindo Station bergerak dibidang car rental service (2010-2012) dan seba-gai akuntan PT Stainlessindo Anugrah Karya yang bergerak dibidang fabrikasi (2008-2010) dan manajer akuntansi PT Barelang mobilindo station (2001-2008) dan beliau memperoleh gelar sarjana ekonomi di STIE Gici Business School.

Since 2012, Netty, S.E. was appointed as a member of the Audit Committee replacing Ernyan Tan by Company’s decree number 001/SK/PTSN/X/2012. Previously she was the operations manager in PT Barelang Mobilindo Station engaged in car rental service (2010-2012) and as an accountant in PT Stainlessindo Anugrah engaged in fabrication work (2008-2010) and as accounting manager in PT Barelang Mobilindo Station (2001-2008 ) and she earned a degree in economics in STIE Gici Business School.

Page 44: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 44

PT SM ENGINEERINGsubsidiaRy of pt sat nusapeRsada tbk

eNTITAS ANAK PT SAT NUSAPeRSADA Tbk

Page 45: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 45

INFORMATION ON SUBSIDIARy

NAMA | NAMEPT SM ENGINEERING

BIDANG USAHA | LINE OF BUSINESSMETAL STAMPING INDUSTRy

tAHUN PENDIRIAN | YEAR OF EStABLISHMENt2002

KEPEMILIKAN SAHAM | OWNERSHIP99.96%

ALAMAt KANtOR | COMPANY ADDRESSLot 8 Citra Buana Centre Park III,

Jalan Engku Putri, Batam Centre 29432Kepri – Indonesia

Tel : (+62778) 471 688Fax :(+62778) 471 234

Email : [email protected] website : www.satnusa.com

INFORMASI ENTITAS ANAk

PT SM Engineering didirikan pada tahun 2002 yang bergerak pada Industri Metal Stamping. Sebuah titik balik bagi Perseroan terjadi pada tahun 2007 dimana Perseroan diakuisisi oleh PT Sat Nusapersada Tbk. Perseroan telah berkembang pesat sejak diakuisisi serta telah berhasil memperoleh reputasi yang baik dan pengakuan dari pelanggan yang terhormat atas kualitas dan pelayanan yang prima. Perseroan beru-paya mencapai standar ISO baik dalam segi Kualitas maupun Manajemen Lingkungan. Perseroan terus berupaya untuk memberikan pelayanan terbaik ke-pada pelanggan melalui prinsip Kualitas Mencipta-kan Masa Depan.

PT SM Engineering was established in 2002 which operates in Metal Stamping Industry. A turning point for the Company came in 2007 where it was acquired by PT Sat Nusapersada Tbk. The Company has been growing rapidly since the acquisition and has suc-cessfully obtained good reputation and recognition from its valuable customers for its quality and ex-cellence services. The Company strives towards ISO for both Quality and Environment Management Standard. The Company continues its best to serve the customers better through the principle of Quality Creates Future.

DESKRIPSI ENTITAS ANAK

SUBSIDIARY COMPANY DESCRIPtION

SM ENGINEERING BERSERTIFIKAT ISO 9001:2008, ISO 14001:2004 DAN SONY GREEN PARTNERSM ENGINEERING IS CERTIFIED FOR ISO 9001:2008, ISO 14001:2004 AND SONY GREEN PARTNER

subsidiaRy of pt sat nusapeRsada tbkeNTITAS ANAK PT SAT NUSAPeRSADA Tbk

Page 46: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 46

Change of ShiftKOORDINASI PENGGANtIAN SHIFt

1. PENGARAHAN PADA SAAt PERGANtIAN SHIFt (shift’s briefing )

2. KOMUNIKASI (communication)

3. KEBERSIHAN (houseKeePing)

4. tEPAt WAKtU (on time)

5. LAPORAN (rePeort)

Briefing shift berikutnya diselesaikan paling lama 5 menit sebelum jam kerja pergantian shift dimulai. NEXT shift’s briefing MUST be done latest 5 minutes before change of shift is started.

Komunikasi antar shift dilakukan 5 menit sebelum jam pergantian shift dimulai.Communication between shifts MUST be done 5 minutes before Change of Shift is started

Pada waktu bersamaan, kegiatan bersih-bersih mesin dan sekitarnya dilakukan oleh shift sebelumnya.At the same time, clean-up activities surrounding the machine must be carried out by previous shift.

Shift berikutnya langsung menjalankan mesin, tepat pada waktu jam pergantian shiftNext shift MUST start running the machine on-time

Shift sebelumnya menyelesaikan laporanPrevious shift MUST finish the report

Page 47: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 47

ARUS INFORMASI UNTUK MASALAH KUALITAS / PENGIRIMAN

wiThiN 1ST hOUR

wiThiN 1 DAY

wiThiN 1 wEEK OR DURiNG NEXT CS REViEwDALAM 1 MINGGU ATAU PADA SAAT PENINJAUAN CS BERIKUTNyA

DALAM KURUN wAKTU 1 HARI

DALAM 1 JAM PERTAMA

Quality/Shipment problem information flow

informasi masalah kualitasQuality ProBlEm information

sEgEra mEnginformasikan manajEr gad dan manajEmEn

IMMEDIATELY INFORM GAD MANAGER AND MANAGEMENT

PEmilik ProsEs - mEnghasilkan laPoran masalah kualitas / PEngiriman

PROCESS OWNER - GENERATE qUALITY/SHIPMENT PROBLEM REPORT

manajEr Qad mEnilai PErlunya kaji ulang manajEmEn

qAD MANAGER ASSESS NEED FOR MANAGEMENT REVIEW

mEngamBil tindakan (akar PEnyEBaB & PEnanggulangan)

TAKE ACTION ( ROOT CAUSE & COUNTERMEASURE )

tindak lanjut laPoran tEntang akar PEnyEBaB & PEnanggulangan

FOLLOW UP REPORT ON ROOT CAUSE & COUNTER MEASURES

JUDGEMENT

masalah kualitas fatalFATAL qUALITY PROBLEM

PErtimBangan

cat 1

masalah kualitas ringan

masalah lintasan, kualitas Part atau masalah PEngiriman

MINOR qUALITY PROBLEM

SERIOUS LINE, PARTS qUALITY OR SHIPMENT qUALITY

cat 3

cat 4

masalah kualitas sEriusSERIOUS qUALITY PROBLEM

cat 2

Page 48: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 48

Heat sinks are used to enhance heat dissipation from hot surfaces. A heat sink does this by increasing the surface area that is in con-tact with the cooling fluid or air.

Heat sink digunakan untuk meningkatkan pembuangan panas dari permukaan yang panas. Sebuah heat sink melakukan hal ini dengan meningkatkan luas permukaan yang bersentuhan dengan cairan pendingin atau udara.

We offer our experience and assistance with the metal fabrication of existing products or development of pro-totypes for future projects. We work closely with our customer to understand their needs and advice most cost effective solution for a given application.

Perseroan menawarkan pengalaman dan bantuan dalam fabrikasi logam dari produk yang sudah ada atau pengembangan prototipe untuk proyek-proyek masa depan. Perseroan bekerja sama dengan pelanggan Perseroan untuk memahami kebutuhan mereka dan memberikan saran yang paling efektif untuk aplikasi tertentu.

Perseroan memfabrikasi bagian logam untuk printer dan scanner Epson. Company fabricates metal parts for Epson printers and scan-ners.

oUrgoAlsArEToProVidEyoUThEBEsThEATsinKThATisThEmosTCosTEffECTiVEAndhighEsTqUAliTy.oUrEmPloyEEswillrEndErThEirBEsTsUPPorTTomAKEThishAPPEn

Tujuan Perseroan adalah untuk menghasilkanheatsink terbaik dengan biaya paling hemat dan kualitas terbaik. Karyawan perseroan akan memberikan dukungan kepada perseroan untuk melakukan apa yang terbaik untuk membuat hal ini terjadi.

hEATsinK

PrinTErAndsCAnnErPArTs

ProdUCTPErsEroAn

oUrProdUCTs

Page 49: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 49

The company implements Enterprise resource Planning(ErP)systemtofacilitatestheflowofinformationandcoor-dinates all resources and activities within the business or-ganization,integratedwithqrcodesystemandfirstinfirstout(fifo)concepttobettersupportoursupplyChainman-agement(sCm).

Perseroan menerapkan sistem Enterprise Resource Planning (ERP) untuk mem-fasilitasi aliran informasi dan mengkoordinasikan semua sumber daya dan kegia-tan dalam organisasi, terintegrasi dengan sistem kode QR dan konsep First in First Out (FIFO) untuk lebih mendukung Supply Chain Manajemen (SCM ) Perseroan.

Page 50: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 50

NAMA DAN ALAMAT LEMBAGA DAN ATAU PROFESI PENUNJANG PASAR MODALName and Address of Institution and or Supporting Profession in the Capital Market

BIRO ADMINIStRASI EFEK | SHARE REGIStRARPT. RAyA SAHAM REGISTRAGedung Plaza Sentral, Lt.2Jl. Jend. Sudirman Kav.47-48Jakarta 12930

KANtOR AKUNtAN PUBLIKPUBLIC ACCOUNTANTKANTOR AKUNTAN JOHAN MALONDA MUSTIKA & REKANJl. Pluit Raya 200 Blok V/1-5Jakarta 14450

ALAMAT KANTOR PUSAT DAN ENTITAS ANAKADDRESS OF HEAD OFFICE AND SUBSIDIARIES

SM ENGINEERINGLot 8 Citra Buana Centre Park III, Jalan Engku Putri, Batam Centre 29432Kepri – IndonesiaTel : (+62778) 471 688Fax : (+62778) 471 234Email : [email protected] website : www.satnusa.com

Pt SAt NUSAPERSADA tbkKANtOR PUSAt | HEAD OFFICEJl Pelita VI No.99 Batam 29432 - Kepri - IndonesiaTelp : +62 778 425 888Fax : +62 778 426 988Email : [email protected] www.satnusa.com

Page 51: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 51

Auditor eksternal melakukan pemeriksaan laporan keuangan Sat Nusa di tahun 2012 ditetapkan pada Rapat Tahunan Pemegang Saham berdasarkan rekomendasi dari De-wan Komisaris dan Komite Audit. Untuk menjamin independensi dan kualitas lapo-ran audit, Auditor Eksternal yang ditunjuk tidak boleh memiliki saham di perusahaan. Auditor Eksternal yang ditunjuk bertanggung jawab untuk mengekspresikan penda-patnya tentang kesesuaian antara laporan keuangan yang telah diaudit dan standar laporan keuangan yang berlaku.

Perseroan telah menunjuk auditor eksternal sesuai dengan Rapat Umum Pemegang Saham Tahunan PT Sat Nusapersada Tbk pada tanggal 26 Juni 2012, yang menyetujui pengangkatan Akuntan Publik Johan Malonda Mustika & Rekan (JM), untuk mengaud-it Laporan Keuangan untuk tahun buku 2012 berdasarkan rekomendasi dari Dewan Komisaris. Johan Malonda Mustika & Rekan (JM) terdaftar di Bapepam. Total Biaya Audit Laporan Keuangan Konsolidasi untuk tahun 2012 adalah sebesar Rp 285 juta (Termasuk tunjangan dan pemotongan pajak) Akuntan Publik Johan Malonda Mustika & Rekan (JM) telah menjadi auditor Perseroan sejak tahun 2010. Mereka telah menyelesaikan tugas secara mandiri, sesuai dengan standar profesional untuk Akuntan Publik, kontrak kerja dan ruang lingkup audit yang telah disepakati. Akuntan Publik Johan Malonda Mustika & Rekan (JM) tidak memberi-kan jasa konsultasi lain untuk Sat Nusa. Akuntan yang telah menandatangani Laporan Auditor Independen untuk tahun 2012 adalah Drs. Putu Astika.

External auditor performing the inspection to Sat Nusa’s financial statement in year 2012 is stipulated on the Annual Meeting of Shareholders conducted based on the recommendation of Board of Commissioners and Audit Committee. To assure the independence and quality of the audit report, the pointed External Auditor must not have a stake in the company. The ap-pointed External Auditor is responsible to express his/her opinion on the conformity between the audited financial report and the prevailing standard of financial report.

The Company has appointed an external auditor in line with the Annual General Meeting of Shareholders of PT Sat Nusapersada Tbk on 26 June 2012, which approved the appointment of Public Accountants Johan Malonda Mustika & Partner (JM), to audit the Financial State-ment for fiscal year 2012 based on the recommendation of the Board of Commissioners. Johan Malonda Mustika & Partner (JM) is registered with Bapepam. The total fee for the Audit of the Consolidated Financial Statements for 2012 was Rp 285 million,- (Inclusive of allowance and witholding tax) Public Accountants Johan Malonda Mustika & Partner (JM) has been the Company’s auditor since fiscal year 2010. They have completed their tasks independently, in accordance with the professional standards for Public Accountants, the work contract and the agreed audit scope. Public Accountants Johan Malonda Mustika & Partner (JM) do not provide any other consultancy services to Sat Nusa. The accountant who has signed the Independent Auditor’s Report for 2012 is Drs. Putu Astika.

auditorindEPEndEn PErsEroanCORPORATE INDEPENDENT AUDITOR

Page 52: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 52

MANAGEMENT FOCUS ON HUMAN RESOURCES AS ONE OF THE KEY ASPECTS TO ENHANCE BUSINESS PERFORMANCE

salah satu asPEk utama yang mEnjadi fokus manajEmEn sat nusa untuk mEndukung PEningkatan kinErja Bisnis adalah sumBEr daya manusia (sdm)

hUmAnrEsoUrCEssUmBErdAyAmAnUsiA

Page 53: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 53

sAT nUsA mEnyAdAri BAhwA PErTUmBUhAn Bisnis yAngBErKElAnJUTAn hAnyA dAPAT diCAPAi mElAlUi PEngEm-BAngAndAnPEningKATAnKUAliTAssUmBErdAyAmAnUsiA,UnTUKmEnJAdiAsETBAgiPErsEroAn.

SAT NUSA REALIzES THAT SUSTAINABLE BUSINESS GROWTH CAN ONLY BE ACHIEVED THROUGH DEVELOPMENT AND UPGRADING OF HUMAN RESOURCES QUALITY, TO BECOME AN ASSET FOR THE COMPANY.

Sat Nusa’s performance in 2012 is inseparable from the contribution of the Company’s employees. Sat Nusa views the employees as the Company’s main asset, playing a vital role in supporting sustainabil-ity.

The development of human resources in Sat Nusa is not only the responsibiliy of the human resources Division, but of all management members, who are responsible for developing human resourc-es through a process which is geared towards strengthening corporate mission, aligned to Sat Nusa Mission, to ensure the achievement of Quality Excellence in all aspects of operations and in the management of human resources.

Sat Nusa upholds the principle of fairness in man-aging its human resources. The Company offers equal opportunities to all employees to develop their careers and to do their work as professionals without discriminating on the grounds of ethnicity, religion, race, class, gender or physical condition.

Kinerja Sat Nusa sepanjang tahun 2012 tidak ter-lepas dari kerja keras dan kontribusi segenap kar-yawan Perseroan. Sat Nusa memandang karyawan sebagai aset utama Perseroan, berperan penting dalam mendukung kesinambungan usaha.

Pengembangan sumber daya manusia di Sat Nusa bukan hanya menjadi tanggung jawab Divisi SDM, melainkan tanggung jawab dari semua ang-gota manajemen, yang bertanggung jawab untuk mengembangkan sumber daya manusia melalui proses yang mengarah pada penguatan misi Pers-eroan, sejalan dengan misi Perseroan, untuk men-jamin tercapainya Kualitas Prima dalam semua aspek operasi dan dalam pengelolaan sumber daya manusia.

Sat Nusa menjunjung tinggi prinsip keadilan dalam mengelola sumber daya manusianya. Perseroan menawarkan kesempatan yang sama kepada selu-ruh karyawan untuk mengembangkan karir mereka dan untuk melakukan pekerjaan mereka sebagai profesional tanpa diskriminasi atas dasar suku, agama, ras, gender kelas, atau kondisi fisik.

Page 54: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 54

Considering their age, 1,433 people (31.52%) of the total employees were 18-25 years old, 2,168 people (47.69%) were 26-35 years old, 887 people (19.51%) were 36-45 years old, 51 people (1.12%) were 46-55 years old and 7 people (0.15%) were older than 55 years old. Overall, the percentage of the total numbers of employees who were between 26-35 years old was the highest.

Berdasarkan jenjang usia, sebanyak 1.433 orang (31,52%) dari jumlah karyawan yang berusia antara 18–25th, 2.168 orang (47,69%) berusia antara 26-35 th, 887 orang (19,51%) berusia antara 36-45 th, 51 orang (1,12%) berusia antara 46-55 th dan 7 orang (0,15%) berusia > 55 th. Secara keseluruhan, jumlah karyawan yang berusia 26-35 tahun menduduki persentase pal-ing tinggi.

31.52% 47.69% 19.51%

1.12%

0.15%umur|age 18-25 umur|age 26-35 umur|age 36-45

umur|age46-55

umur|age55 & above

humanresourcesrecruitmentProcessThe availability of qualified human resources be-gins with an intelligent selection and recruitment process, involving management, who take part in ensuring that the competence and character of the candidates are in line with organization needs. To make sure that the recruitment process works objectively, Sat Nusa has setup standard-ized tests, assessments and interview. Sat Nusa also recruits potential fresh graduates through collaboration with universities, in the form of ap-prenticeships and in-campus recruitment.

Sat Nusa believes that recruitment and selec-tion process is an important and strategic phase to prepare employees who are able to give excel-lent performance at present and in the future. The company policy in recruitment and selection pro-cesses deliberately prioritizes internal employees for senior employee position by still considering competency standard which have been set, while an external recruitment is used as a counterbal-ance to achieve ideal employee structure in terms of competency and educational background.

ProsesPerekrutansumberdayamanusiaKetersediaan sumber daya manusia yang berkualitas dimulai dari proses seleksi dan rekrutmen yang baik, yang melibatkan manajemen, yang mengambil bagian dalam memastikan bahwa kompetensi dan karakter calon yang sesuai dengan kebutuhan organisasi. Untuk memastikan bahwa proses perekrutan berjalan secara obyektif, Sat Nusa telah menetapkan standar dalam pengujian, penilaian dan wawancara. Sat Nusa juga merekrut lulusan baru yang potensial melalui kerjasa-ma dengan perguruan tinggi, dalam bentuk magang dan perekrutan-kampus.

Sat Nusa menganggap bahwa proses rekrutmen dan seleksi merupakan tahapan penting dan strategis un-tuk mempersiapkan tenaga kerja yang mampu men-unjukkan kinerja unggul saat ini dan di masa yang akan datang. Kebijakan Perseroan dalam proses rekrut dan seleksi karyawan senior lebih mengutamakan kar-yawan internal dengan tetap memperhatikan standar kompetensi yang telah ditetapkan, sedangkan rekrut eksternal sebagai penyeimbang sehingga mengarah pada struktur karyawan yang ideal dari segi kompe-tensi dan pendidikan.

KOMPOSISI KARyAwAN BERDASARKAN USIACOMPOSITION Of EMPLOYEES BY AGE

Angka berdasarkan pada data per 31 Desember 2012

Angka berdasarkan pada data per 31 Desember 2011

The figures were based on data as of 31 december 2012

The figures were based on data as of 31 december 2011

35.62% 49.47% 13.94% 0.86% 0.11% percentage1 8 - 2 5 2 6 - 3 5 3 6 - 4 5 4 6 - 5 5 5 6 - a b o v e u m u r | a g e

Page 55: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 55

As of 31 December 2012, Sat Nusa had a total workforce of 4,546 employees, which comprised 743 permanent employees and 3,803 contract em-ployees. The total employees decreased by 2.5% in 2012 as compared to previous year. This decline was due to manpower reduction in line with the decline in our total revenue in 2012.

Pada tanggal 31 Desember 2012, Sat Nusa memiliki total tenaga kerja 4.546 karyawan, yang terdiri 743 kar-yawan tetap dan 3.803 karyawan kontrak. Jumlah kar-yawan mengalami penurunan sebesar 2,5% pada 2012 dibandingkan dengan tahun sebelumnya. Penurunan ini disebabkan oleh penurunan tenaga kerja seiring dengan penurunan pendapatan total tahun 2012.

HUMAN RESOURCES PROFILE

NUMBER OF EMPLOYEES

PROFIL SUMBER DAyA MANUSIA

JUMLAH TENAGA KERJA

4,500

2012

2011

5,380 5,461 5,568 4,663 4,5462007 2008 2009 2010 2011 2012

EMPLOYEE COMPOSItION BASED ON EDUCAtION

EDUCATION PERMANENT CONTRACT

01 S1 & S2 | Bachelor and Master 33 32 6502 Diploma | Diploma 37 32 6903 SLTA Sederajat | Senior High School or Equivalent 426 2,338 2,76404 SLTP Sederajat | Junior High School or Equivalent 70 1,082 1,15205 SD | Elementary 177 319 496

743 3,803 4,546

P E N D I D I K A N TETAP KONTRAKNO TOTAL

KOMPOSISI KARyAwAN BERDASARKAN TINGKAT PENDIDIKAN

EDUCATION PERMANENT CONTRACT

01 S1 & S2 | Bachelor and Master 30 21 5102 Diploma | Diploma 32 31 6303 SLTA Sederajat | Senior High School or Equivalent 363 1,998 2,36104 SLTP Sederajat | Junior High School or Equivalent 69 1,167 1,23605 SD | Elementary 384 568 952

878 3,785 4,663

P E N D I D I K A N TETAP KONTRAKNO TOTAL

Based on education background in 2012, as many as 65 permanent and contract employees held graduate degree of Bachelor or Master, 69 employees were diploma, 2,764 high school or equivalent graduates, 1,152 junior high school graduates or equivalent and 496 Primary School graduate. Overall, the number of employees of high school graduates or equivalent and below were more dominant, it is associated with the character of the company’s operations.

Berdasarkan jenjang pendidikan tahun 2012, sebanyak 65 orang karyawan tetap dan kontrak adalah lulusan S1 atau S2, 69 orang lulusan Diploma, 2.764 orang lulu-san SLTA sederajat, 1.152 orang lulusan SLTP sederajat dan 496 orang lulusan SD. Secara keseluruhan, jumlah karyawan lulusan SLTA sederajat dan di bawahnya lebih dominan, hal ini terkait dengan karakter kegiatan ope-rasional Perseroan.

Page 56: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 56

PELATIHAN DAN PENGEMBANGAN SDMHR TRAINING AND DEVELOPMENT

Human resources training and development pro-grams were consistently carried out to get top-quality, competent and professional HR in line with business development and challenges. As a fundamental for competency development, Sat Nusa has formulated a database in the form of classification covering the combination of their capability and skill owned by every employee starting from staff level.

Program pelatihan dan pengembangan sumber daya manusia dilakukan secara konsisten untuk mendapat-kan SDM yang unggul, kompeten dan profesional seja-lan dengan tuntutan dan perkembangan bisnis. Seba-gai dasar pengembangan kompetensi, Sat Nusa telah menyusun database dalam bentuk klasifikasi yang berisi gambaran tentang kondisi masing-masing kar-yawan mulai dari tingkat staff yang dibuat berdasarkan kombinasi kemampuan dan keterampilan yang dimi-liki.

opportunityequalityinhrTraininganddevel-opmentTraining and development program is meant for every position level and every type of job starting from the lowest level, i.e. employees in grade I to the highest level, i.e. Board of Directors. Every employee has the same opportunity to participate in the training. The implementation of competency improvement is suited with the needs of each po-sition level.

The Expenses for hr Training and develop-mentIn 2012, Sat Nusa has spent Rp 193 million for ex-ternal training fund, 614 % higher than that of in 2011 which was only Rp 27 million.

Persamaan Kesempatan dalam Pelatihan danPengembangansdmProgram pelatihan dan pengembangan ditujukan ke-pada semua tingkatan jabatan dan jenis pekerjaan, mulai dari level terendah, yaitu karyawan golongan I hingga level tertinggi yaitu Direksi. Setiap karyawan memiliki kesempatan yang sama untuk mengikuti pelatihan. Pelaksanaan peningkatan kompetensi disesuaikan dengan kebutuhan pada masing-masing level jabatan.

BiayaPelatihandanPengembangansdmSelama tahun 2012, Sat Nusa telah mengeluarkan dana pelatihan eksternal sebesar Rp 193 juta menin-gkat 614 % terhadap tahun 2011 yang mencapai Rp 27 juta.

JEnisPElATihAn TyPEofTrAining dEPArTmEnT

Pelatihan mengenai Switch HP Training HP Switch MIS (IT)

Pelatihan pengupahan terlengkap di Indonesia

Complete remuneration training in Indonesia Corporate Planner & HRD

Seminar CRP Top Grading and Talent Mapping

CRP Top Grading and Talent Mapping Seminar HRD

Pelatihan pengembangan aplikasi Micro-soft Sharepoint 2010

Training Microsoft Sharepoint 2010 application development

MIS & Purchasing

UKL & UPL UKL & UPL Quality Assurance

Training Keahlian Kepabeanan Customs Expertise Training Shipping

Sertifikasi hubungan Industrial dan Ketenagakerjaan

Certification of Industrial and Labor relations HRD

Six Sigma Green belt Six Sigma Green belt Production

Pelatihan perawatan forklift Training for forklift maintenance Shipping

Biaya pendaftaran S2 Hukum Registration for Degree Master in Law Legal

Pelatihan SMK3 EOHS Training Quality Assurance

Page 57: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 57

PELATIHAN INTERNALiN hOUSE TRAiNiNG

Internal training programs were conducted con-tinuously in order to increase the knowledge and skills of employees, devoted to employee from group 1-8. Some in-house training conducted in-ternally in 2012 include:

Program pelatihan internal dalam rangka peningka-tan pengetahuan dan keterampilan karyawan dilak-sanakan secara berkesinambungan, ditujukan untuk karyawan golongan 1- 8. Beberapa pelatihan In House Training yang dilaksanakan secara internal tahun 2012 diantaranya adalah:

NoJEnisPElATihAnTrAiningiTEms

1 2 3 4 5 6 7 8

1 Company Policy A • • • • • • • • BASIC

2 Company Objectives & Targets A • • • • • • • • BASIC

3 Company Regulations and Procedures A • • • • • • • • BASIC

4 Part Identification A • • • • • • • • BASIC

5 Mounting Specification A • • • • • • • • OJT

6 Manual Insert (Component) O • • • • • • • OJT

7 Training soldering specification and method O • • • • • • • OJT

8 Introduction of feeder size and usage O • • • • • • • OJT

9 Training type of direct specification O • • • • • • • • OJT

10 Understand first production piece O • • • • • • OJT

11 Production Control Flowchart A • • • • • • BASIC

12 AMMS-MMS OS O • • • • • • • OJT

13 Packing Standard O • • • • • • • OJT

14 ESD Standard O • • • • • • • • OJT

15 Production machine / equipment OS O • • • • • • • • BASIC

16 Documentation (Part list, Drawing, Modification, Memorandum ) O • • • • • • • BASIC

17 Inventory Control O • • • • • • OJT

18 Understand each customer standard and requirement A • • • • • BASIC

19 Advanced SMT Knowledge T • • • BASIC

20 Presentation skill, communication skill, management skill A • • BASIC

21 New Customer / Product coordination A • BASIC

22 RoHS Orientation A • • • • • • • • BASIC

Co

mP

ETEn

Cy

Ch

ECK

iTEm

KET

ErA

ng

An

rEm

Ar

Ks

JABATAn/JoBTiTlE

JABATAn/JoBTiTlE

1. OPERATOR2. SUPPORTER3. LEADER4. FORELADY / MAN5. SUPERVISOR6. SUPERINTENDENT7. ASSISTANT MANAGER8. MANAGER

A = APPRAISALO = OBSERVATIONT = PAPER TEST / CERTIFICATE

rECords: oJT=onJoBTrAining

Page 58: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 58

PeMBAHASAN DANANALISIS MANAJeMeNManagement’s Discussion and Analysis

eNHANCINg VALUe CReATION THROUgH A

SOLID PeRFORMANCe239

980

USD

USD

JUTA / MILLIoN

RIBU / THoUSAND

PENDAPATAN DITAHUN 2012

LABA BERSIH DITAHUN 2012

REvENUES IN 2012

NET INcoME IN 2012

Meningkatkan Penciptaan Nilai Melalui Kinerja Yang Sehat

Sat Nusa berhasil membukukan kinerja keuangan yang memuaskan, dengan pertumbuhan

penjualan dan profitabilitas dan diikuti dengan peningkatan nilai

bagi pemegang saham

Sat Nusa posted favorable financial results, with strong top line and profitability

growth, thus yielding value creation to shareholders

Page 59: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 59

FOR THE YEARS ENDEDUNTUK TAhUN YANG BERAKhiR PADA TANGGAL-TANGGAL

31 DECEMBER 201231 DECEMBER 2011

Tinjauan KeuanganFinancial Overview

Tinjauan OperasionalOperational Overview

Aspek PemasaranMarketing Aspects

Prospek UsahaBusiness Prospect

Page 60: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 60

Pembahasan dan analisis berikut mengacu pada Lapo-ran Keuangan Konsolidasi Sat Nusa untuk tahun-tahun yang berakhir pada 31 Desember 2012 dan 2011 yang disajikan dalam buku Laporan Tahunan ini. Laporan Keuangan tersebut telah diaudit oleh Kantor Akuntan Publik Johan Malonda Mustika & Rekan (JM).

Sepanjang tahun 2012, Sat Nusa berhasil membuku-kan pendapatan sebesar USD 239 juta atau meningkat sebesar 2,04% dibandingkan dengan tahun 2011. Hal tersebut tidak terlepas dari pemulihan yang terjadi paska bencana alam yang menimpa negara Jepang dan Thailand sehingga mempengaruhi rantai pasokan khususnya pada industri elektronik ditahun 2011.

The following discussion and analysis refers to Sat Nusa’s Consolidated Financial Statements for the years ending 31 December 2012 and 2011, which are presented in this Annual Report. The Annual Financial Statements have been audited by the Public Accountants Johan Malonda Mustika & Partner (JM).

During 2012, Sat Nusa succeeded in booking rev-enues of USD 239 million, increased by 2.04% from 2011. It is closely linked to the recovery that occurred post-natural disaster that hit Japan and Thailand thus affecting the supply chain especial-ly in the electronics industry in 2011.

TINJAUAN KEUANgAN TAHUN 20122012 Financial Review

PENDAPATAN USAHA

PENDAPATAN USAHA

INDUSTRY : USD 236,876,417

CONSIGNMENT : USD 2,497,397

REvENUES

REvENUES

239,373,81498.96

2012

%%% 1.04

23

9,3

73,8

14

23

4,5

83

,72

2

24

3,7

51,

63

1

USD

US

D

US

D

US

D

2010 2011 2012

Selama tahun 2012, Sat Nusa berhasil membukukan Pendapatan sebesar USD 239 juta yang berasal dari dua segmen usaha, yaitu In-dustri dan Jasa perakitan. Kontribusi masing-masing segmen terse-but terhadap Pendapatan di tahun 2012 adalah sebagai berikut : In-dustri 98,96% dan Jasa perakitan 1,04%.

In 2012, Sat Nusa booked a revenues of USD 239 million derived from our two business segments: Industry and Consignment. The contribution of each segment to our revenues in 2012 was as follows: Industry 98.96% and consignment 1.04%.

Page 61: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 61

Company’s revenue can be categorized into sev-eral groups according to product application as follows:

Pendapatan Perseroan dapat dikategorikan kedalam beberapa beberapa kelompok sesuai dengan aplikasi produk sebagai berikut :

adalah peralatan elektronik yang ditujukan untuk penggunaan sehari-hari, paling sering dalam hiburan, komunikasi dan produktivitas kantor.

are electronic equipment intended for everyday use, most often in entertainment, communications and office pro-ductivity.

adalah perangkat elektronik yang digunakan dalam industri mobil, seperti car audio unit, motor controller dan lain-lain.

are the electronic devices used in automobiles industry such as car audio unit, motor controller and etc.

adalah perangkat keras yang digunakan dalam jarin-gan dan juga dikenal sebagai peralatan jaringan, alat jaringan komputer.

are hardware used in networking and may also be known as network equipment, computer networking devices.

adalah perangkat keras lainnya seperti produk teleko-munikasi dan alat meteran listrik.

are other hardware devices such as telecommunication products and electric measurement products.

53.23%

consumer electronics

automotive peripheral

networking peripheral

other peripheral

konsumen electronik

perangkat otomotif

perangkat networking

perangkat lainnya

11.96%

0.91%

33.90%

Page 62: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 62

BEBAN POKOK PENJUALAN

coST oFREVENUEBeban pokok penjualan Perusahaan di tahun 2012 sebesar USD 231 juta yang terdiri dari 3 komponen terbesar yakni pemakaian bahan baku sebesar USD 201 juta, upah langsung sebesar USD 8,7 juta dan total beban depresiasi sebesar USD 5,9 juta. Beban pokok tersebut mengalami peningkatan sebesar 1,09% jika dibandingkan dengan tahun sebelumnya dimana kenaikan tersebut sesuai dengan kenaikan pada Pendapatan tahun 2012.

The cost of revenue in 2012 amounted to USD 231 million which consist of 3 major components name-ly consumption of raw material amounted to USD 201 million, direct labor cost amounted to USD 8.7 million and total depreciation expense amounted to USD 5.9 million. Cost of revenue increased by 1.09% compared to previous year in which the increase is line with revenues increment in 2012.

Page 63: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 63

Pada tahun 2012, pendapatan Perseroan men-galami pertumbuhan sebesar 2,04% namun be-ban pokok penjualan hanya mengalami kenaikan sebesar 1,09%. Hal ini tidak terlepas dari upaya Perseroan dalam mengurangi total tenaga kerja dan meningkatkan lini produksi dengan menerap-kan penggabungan proses, inovasi, keseimbangan lintasan untuk mengurangi kemacetan dan meng-gunakan robot kit otomatis. Langkah ini berfungsi sebagai tindakan perbaikan Perseroan untuk mem-inimalkan ketergantungan tenaga kerja manusia di tengah tekanan peningkatan upah minimum dari tahun ke tahun.

Intensifikasi pada efisiensi konsumsi listrik dengan penggunaan lampu hemat energi pada departe-men produksi dan kantor utama yang memancar-kan kualitas cahaya yang sama dengan biaya yang lebih rendah. Memperkuat komunikasi antara de-partemen fasilitas dan departemen produksi dalam mengelola konsumsi listrik di masing-masing de-partemen dengan bijaksana. Misalnya, mematikan kompresor atau airconditioner saat tidak diguna-kan. Tujuan utamanya adalah untuk mencegah pemborosan energi yang disebabkan oleh ketidak-tahuan manusia dan kurangnya komunikasi.

In 2012, revenues grew by 2.04% but the cost of rev-enues only increased by 1.09%. This was attributable to Sat Nusa’s efforts in reducing its total workforce and improved the production lines by implement-ing combine process, innovation, line balancing to reduce bottleneck and implementing semi to auto-mated robot kits. These moves served as our coun-ter-measure to minimize the human labor force dependency amid the increasing pressure of rising labor cost from year to year.

Intensification on efficiency of electrical consump-tion by embarking on the use of energy saving light across major production departments and main of-fice which emit the same quality of light with lower cost. Strengthen the communication between facility department and production departments in manag-ing the electricity consumption in each department wisely. For example, turning off the compressor or airconditioners when not in use. The main goal is to prevent any energy waste caused by human igno-rance and lack of communication.

revenue growth

cost of revenue growth

average direct manpower

pertumbuhan pendapatan

pertumbuhan beban pokok penjualan

2012 : 3,2552011 : 3,574

rata-rata tenaga kerja langsung

8.92%

Page 64: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 64

Seiring dengan terjadinya peningkatan penjualan di tahun 2012 sebesar USD 4,7 juta atau 2,04% diband-ingkan dengan tahun sebelumnya, Laba kotor Sat Nusa mengalami peningkatan yang signifikan sebe-sar USD 2,29 juta atau sekitar 39,23% dibandingkan dengan tahun sebelumnya. Marjin kotor Perseroan naik menjadi 3,39% ditahun 2012 dari 2,48% ditahun 2011. Beberapa faktor utama peningkatan marjin laba kotor dikarenakan adanya peningkatan efisien-si produksi yang tidak terlepas dari peran perema-jaan lini produksi mesin SMT yang dilakukan pada quarter terakhir tahun 2011 serta kontribusi dari peningkatan order untuk produk baru yang bermar-jin tinggi.

Pada tahun 2011, total biaya upah langsung sebesar USD 7.876.339 dan terjadi kenaikan upah minimum sebesar 18,8% diawal tahun 2012 serta kenaikan penjualan sebesar 2,04% selama tahun 2012, den-gan demikian proyeksi biaya upah langsung pada ta-hun 2012 seharusnya USD 9.548.158, namun berkat usaha dan kebijakan yang dilakukan, Perseroan berhasil menekan kenaikan upah biaya langsung aktual pada tahun 2012 menjadi USD 8.728.378 seh-ingga terjadi efisiensi sebesar USD 819.780.

In 2011, total direct labor expense amounted to USD 7,876,339 and there was an increase of mini-mum wage by 18.8% in the beginning year of 2012 and sales increased by 2.04% during 2012, thus the projected direct labor expense in 2012 should be USD 9,548,158, but thanks to the efforts and poli-cies carried out, the Company managed to push the actual increment of direct labor expenses in 2012 to USD 8,728,378 resulting in an efficiency of USD 819,780.

Along with the increase in revenue in 2012 amounted to USD 4.7 million or 2.04% compared to the previous year, Sat Nusa’s gross profit experienced a signifi-cant increase of USD 2.29 million or approximately 39.23% compared with the previous year. The Compa-ny’s gross margin rose to 3.39% in 2012 from 2.48% in 2011. Few main factors in contributing to the increase in gross margins were higher production efficiency associated with the rejuvenation of SMT production line machine carried out in last quarter of 2011 as well as the contribution of an increase in orders from new products with high-margin.

LABA KOTOR

gRoSS PRoFIT

DIReCT LABOR eXPeNSeDIReCT LABOR eXPeNSe

eFFICIeNCy efisiensi

PROJeCTeD eXPeNSeS

ACTUAL eXPeNSeS

proyeksi biaya

biaya aktual

USD 9,548,158

USD 8,728,378USD 819,780

biaya upah langsungbiaya upah langsung

USD 7,876,339

20112012

REvENUE

MINIMUM WAGESupah minimum

pendapatan

2.04%

18.8%

2012 2011 2012 2011

Penjualan 236,876,417 231,946,353 2,497,397 2,637,369 Revenue

Beban Pokok (229,557,812) (226,960,686) (1,704,631) (1,797,036) Cosf of Revenue

Laba Kotor 7,318,605 3.09% 4,985,667 2.15% 792,766 31.74% 840,333 31.86% Gross Profit

DIBAwAH INI ADALAH KLASIFIKASI LABA KOTOR BeRDASARKAN KATegORI The following is the classification of gross profit by category

INDUSTRI | INDUSTRy JASA PERAKITAN | CONSIGNMENT

Marjin laba kotor untuk kategori industri naik dari 2,15% ditahun 2011 menjadi 3,09% ditahun 2012. Sedangkan margin laba kotor untuk kategori Jasa Perakitan mengalami sedikit penurunan dari 31,86% ditahun 2011 menjadi 31,74% ditahun 2012.

Gross margin profit for the industry category rose from 2.15% in 2011 to 3.09% in 2012. While the gross profit margin for consignment category decreased slightly from 31.86% in 2011 to 31.74% in 2012.

Page 65: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 65

BEBAN USAHA DAN LABA (RUGI) USAHAoPERATINg ExPENSES AND INcoME (LoSS) FRoM oPERATIoN

Beban Usaha Sat Nusa mengalami penurunan sebe-sar 0,36% menjadi USD 7.367.493 pada tahun 2012, didorong oleh penurunan pada Beban Penjualan sebesar 9,72% menjadi USD 558.402 sedangkan terjadi peningkatan pada Beban umum dan admin-istrasi sebesar USD 33.420 atau 0,49% dibandingkan dengan tahun sebelumnya.

Penurunan dalam kelompok Beban Penjualan teru-tama disebabkan oleh penurunan pada jasa pemasa-ran sebesar 13,02% atau menjadi USD 330.307 dan merupakan 59,15% dari total Beban Penjualan serta terjadi penurunan pada pengangkutan sebesar USD 10.281 atau 10,65% dibandingkan dengan tahun se-belumnya.

Selain daripada itu, peningkatan pada beban umum dan administrasi dikarenakan oleh peningkatan ca-dangan imbalan kerja sebesar USD 85.145 atau seki-tar 17,86% berdasarkan hasil perhitungan aktuaria independen atas estimasi liabilitas imbalan kerja untuk semua karyawan tetap. Pergerakan nilai ca-dangan imbalan kerja tergantung pada asumsi yang digunakan (discounted factor) serta realisasi gaji yang berbeda dengan asumsi. Diikuti dengan kenai-kan pada jasa profesional sebesar USD 33.480 atau 35,21% dibandingkan dengan tahun sebelumnya.

Sat Nusa’s Operating Expenses decreased by 0.36% to USD 7,367,493 in 2012, driven by a decrease in selling expenses of 9.72% to USD 558,402, while there was an increase in general and administra-tive expenses of USD 33,420 or 0.49% compared to previous year.

The decline in selling expense category was pri-marily due to a decrease in marketing expenses by 13.02% to USD 330,307 which represents 59.15% of the total selling expenses and there was a decline in freight expenses by USD 10,281 or 10.65% compared to previous year.

Other than that, the increase in general and admin-istrative expenses due to the increase in provision for employee benefits by USD 85,145 or approximate-ly 17.86% based on the results of an independent actuarial calculation for the estimated liability for employee benefits for all permanent employees. The value of provision for employees benefit highly rely on the use of assumption (discounted factor) and the realization of actual salary which differs from the assumption. Followed by an increase in professional fees of USD 33,480 or 35.21% compared to previous year.

Beban Penjualan 558,402 8% 618,517 8% -9.72% Selling Expense

Umum dan Administrasi 6,809,091 92% 6,775,671 92% 0.49% General and Administrative

Total 7,367,493 100% 7,394,188 100% -0.36% Total

20112012KETERANgAN DEScRIPTIoN

BeBAN USAHA oPERATINg ExPENSES

Di tahun 2012, Sat Nusa berhasil membukukan laba usaha sebesar USD 743.878 dari kerugian ditahun 2011 sebesar USD 1.568.188. Hal itu menyebabkan marjin laba usaha Sat Nusa naik menjadi 0,31% di tahun 2012 dibandingkan dengan -0,67% di tahun 2011.

In 2012, Sat Nusa managed to booked profit from operations of USD 743,878 from loss in 2011 which amounted to USD 1,568,188 . This caused Sat Nusa’s income from operations margin become 0.31% in 2012 compared to -0.67% in 2011.

LABA (RUgI) USAHAINcoME (LoSS) FRoM oPERATIoNS

Page 66: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 66

Pendapatan lain-lain meningkat dari USD 492.629 di tahun 2011 menjadi USD 846.086 di tahun 2012. Pen-ingkatan pada pendapatan lain-lain terutama disebab-kan oleh adanya laba selisih kurs bersih ditahun 2012 sebesar USD 277.430 dari rugi selisih kurs bersih sebesar USD 141,606 ditahun 2011.

Selain daripada itu, adanya penerimaan dari jasa giro dan bunga deposito sebesar USD 34.478 ditahun 2012 atau meningkat sebesar USD 29.170 dari USD 5.308 ditahun sebelumnya.

Other income increased from USD 492,629 in 2011 to USD 846,086 in 2012. The increase in other in-come primarily due to net foreign exchange gains in 2012 of USD 277,430 from a net foreign exchange loss of USD 141.606 in 2011.

Other than that, there was a receipt of interest on current accounts and deposits amounting to USD 34,478 in 2012, an increase of USD 29,170 from USD 5,308 a year earlier.

PeNDAPATAN (BeBAN) LAIN LAINoTHER INcoME (ExPENSES)

Perseroan berhasil membukukan laba sebelum pa-jak penghasilan sebesar USD 1.589.964 ditahun 2012 dari rugi sebelum pajak ditahun 2011 sebesar USD 1.075.559. Hal tersebut dikarenakan adanya pening-katan pada laba kotor ditahun 2012 serta penurunan beban usaha sebesar USD 26.695.

Sat Nusa recorded a profit before income tax of USD 1,589,964 in 2012 from a loss before tax of USD 1,075,559 in 2011. This is due to the increase in gross profit in 2012 as well as a decrease in oper-ating expenses by USD 26,695.

LABA (RUgI) SeBeLUM PAJAK PeNgHASILAN INcoME (LoSS) BEFoRE INcoME TAx

Sat Nusa berhasil mengakhiri tahun 2012 dengan Laba Bersih sebesar USD 980.806 dimana terjadi perbaikan sebesar 194,21% dibandingkan dengan Rugi Bersih tahun 2011 sebesar USD 1.041.047. Selain itu, Imbal Hasil atas Aset meningkat menjadi 1,06% di tahun 2012 dari -1,22% di tahun 2011. Margin Laba (Rugi) Bersih tahun 2012 membaik menjadi 0,41% dari -0,44% di ta-hun 2011 dan Imbal Hasil atas Ekuitas di tahun 2012 naik menjadi 1,83% dari -1,98% di tahun 2011.

Sat Nusa managed to end the year 2012 with a net profit of USD 980,806 where there was an improve-ment of 194.21% as compared to a Net Loss of USD 1,041,047 in 2011. In addition, Return on Assets in-creased to 1.06% in 2012 from -1.22% in 2011. Net Income (Loss) Margin in 2012 improved to 0.41% from -0.44% in 2011 and Return on Equity in the year 2012 increased to 1.83% from -1.98% in 2011.

LABA (RUgI) BeRSIH DAN PROFITABILITASNET INcoME (LoSS) AND PRoFITABILITY

RASIO (%) 2012 2011 RAtIOS (%)

Marjin Laba (Rugi) Bersih 0.41% -0.44% Net Income (Loss) Margin

Imbal Hasil atas Aset 1.06% -1.22% Return on Assets

Imbal Hasil atas Ekuitas 1.83% -1.98% Return on Equity

Page 67: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 67

POSISI KEUANGAN SAT NUSA

ASeT ASSETS

SAT NUSA FINANcIAL PoSITIoNDiskusi dan analisis finansial berikut harus dibaca bersamaan dengan Laporan Keuangan Konsolidasi Perseroan untuk tahun yang berakhir pada tanggal-tanggal 31 Desember 2012 dan 31 Desember 2011, yang telah disusun sesuai dengan prinsip-prinsip akuntansi yang berlaku umum di Indonesia dan di-lampirkan dalam Laporan Tahunan 2012 ini.

The following financial discussion and analysis should be read in conjunction with the Company’s consolidated financial statements for the year end-ed on December 31st, 2012 and December 31st, 2011, which have been prepared in conformity with gener-ally accepted accounting principles in Indonesia and included in this 2012 Annual Report.

Di tahun 2012, Total Aset Sat Nusa sebesar USD 92.235.615 yang terdiri dari 54% Aset Lancar dan 46% Aset Tidak Lancar. Nilai Total Aset ini meningkat USD 6.900.700 atau 8,09% dari USD 85.334.915 pada tahun 2011. Kenaikan pada aset tersebut terutama didorong oleh peningkatan pada kas dan setara kas sebesar USD 7.341.009 menjadi USD 8.072.410 di tahun 2012 dari USD 731.401 ditahun 2011. Hal ini disebabkan oleh adanya penurunan pada arus kas untuk perolehan aset tetap.

In 2012, Sat Nusa’s total assets amounted to USD 92,235,615 consisting of 54% Current Assets and 46% Non-Current Assets. Total value of these as-sets increased by USD 6,900,700 or 8.09% from USD 85,334,915 in 2011. The increase in assets was mainly driven by an increase of USD 7,341,009 in cash and cash equivalents to USD 8,072,410 in 2012 from USD 731,401 in 2011. It is caused by a decrease in cash used for acquisition of fixed assets.

Page 68: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 68

Aset Lancar Sat Nusa meningkat USD 11.472.847 atau 30,21% dari tahun 2011. Hal ini terutama dis-ebabkan oleh peningkatan pada Kas dan Setara Kas sebesar 1.003,69% dan Piutang Usaha kepada Pihak Ketiga sebesar 28,77%.

Sat Nusa Current Assets increased by USD 11,472,847 or 30.21% from 2011. This was mainly due to the in-crease in Cash and Cash Equivalents by 1,003.69% and Accounts Receivable to third parties by 28.77%.

ASET LANCARcURRENT ASSETS

ASEt LANCAR (USD) (USD)

CURRENt ASSEtS

Kas dan Setara Kas 8,072,410 16.32% 731,401 1.93% 1,003.69% Cash and Cash Equivalents

Piutang Usaha kepada Pihak Ketiga

28,676,116 57.99% 22,269,919 58.63% 28.77% Trade Receivables to Third Parties

Piutang Lain-lain 49,707 0.10% 17,125 0.05% 190.26% Other Receivables

P e r s e d i a a n 12,442,418 25.16% 14,769,474 38.89% -15.76% Inventories

Pajak Dibayar di Muka - 0.00% 13,685 0.04% -100.00% Prepaid Taxes

Biaya Dibayar di Muka 212,855 0.43% 179,055 0.47% 18.88% Prepayments

Jumlah Aset Lancar 49,453,506 100.00% 37,980,659 100.00% 30.21% Total Current Assets

2012 2011Kontribusi KontribusiContribution Contribution

Pos ini terdiri dari Kas dan Bank sebesar USD 8.072.410. Komposisi Kas dan Setara Kas ini adalah

This item consists of cash and bank accounts amounting to USD 8,072,410. The cash and cash equivalent consists of

KAS DAN SETARA KAS cASH AND cASH EqUIvALENT

USD 7,855,956 USD 90,553 USD 125,385 USD 516

DOLLAR (USD) DOLLAR(SGD) RUPiAh(iDR) RiNGGiT (MYR)97.32% 1.12% 1.55% 0.01%

KOMPOSISI MATA UANG DALAM KAS DAN SETARA KASCURReNCIeS COMPOSITION OF CASH AND CASH eQUIVALeNTS

KOMPOSISI ASET LANCARCOMPOSITION OF CURReNT ASSeTS

FY 2012 % FY 2011 %

Kas Cash on Hand

Rupiah 11,038 0.14% 9,057 1.24% 21.87% Rupiah

SGD 6,150 0.08% 1,922 0.26% 219.98% SGD

MYR 516 0.01% 493 0.07% 4.67% MYR

Total Kas 17,704 0.22% 11,472 1.57% 54.32% Total Cash on Hand

Bank Bank

USD 3,205,956 39.71% 463,466 63.37% 591.73% USD

SGD 84,403 1.05% 150,460 20.57% -43.90% SGD

IDR 114,347 1.42% 105,774 14.46% 8.11% IDR

JPY - 0.00% 229 0.03% -100.00% JPY

Total Bank 3,404,706 42.18% 719,929 98.43% 372.92% Total Bank

Deposito Berjangka Time Deposit

USD 4,650,000 57.60% - 0.00% USD

Total Deposito Berjangka 4,650,000 57.60% - 0.00% Total Time Deposito

TotalKasdansetaraKas 8,072,410 100.00% 731,401 100.00% 1,003.69% TotalCashandCashEquivalent

DESCRIPtIONKEtERANGAN(USD) (USD)

KOMPOSISI KAS DAN SETARA KAS COMPOSItION OF CASH AND CASH EQUIvALENtS

Page 69: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 69

Piutang Usaha - Bersih mengalami kenaikan 28,77% dari tahun 2011 atau sebesar USD 6.406.197 men-jadi USD 28.676.116 di tahun 2012 sejalan dengan kenaikan pada Pendapatan Usaha Perseroan. Tiga (3) pelanggan Perseroan dengan Piutang usaha ter-besar adalah Kenwood 53,03%, Panasonic AVC Net-work 12,22% dan Japan Servo Motor 11,22%. Per-putaran piutang usaha terhadap penjualan sebesar 8,35x ditahun 2012 dari 10,53x ditahun 2011. Ber-dasarkan pengalaman dan penelaahan, manajemen berkeyakinan, Perusahaan tidak mengalami kesuli-tan atas kolektibitas piutang usaha, sehingga tidak dilakukan penyisihan piutang tak tertagih.

There was an Increase of 28.77% or USD 6,406,197 in Net Trade Receivable to USD 28,676,116 in year 2012 compared to previous year and this was in line with the increase in Sat Nusa’s revenues. Top three (3) customers with highest trade receivables were as follow Kenwood 53.03%, Panasonic AVC Net-work 12.22% dan Japan Servo Motor 11.22%. Trade receivable turnover amounted to 8.35x in the year 2012 from 10.53x in 2011. Based on the review of the status of each individual receivable account at year-end, the management believes that all such receivables are collectible. Accordingly, no allow-ance for doubtful accounts was provided.

Dibandingkan dengan tahun 2011, Penurunan per-sediaan 15,76% atau USD 2.327.056 menjadi USD 12.442.418 di tahun 2012 merupakan salah satu ke-bijakan manajemen dalam memperkuat likuiditas Perseroan.

Compared to 2011, There was a decrease of 15.76% or USD 2,327,056 in inventories to USD 12.442.418 in 2012. This was one of the management policies to strengthen its liquidity.

PeRSeDIAAN | INveNTORIeS

PIUTANg USAHA | TRADE REcEIvABLES

Aset tidak lancar menurun sebesar 9,66% menjadi USD 42.782.109 ditahun 2012. Hal ini terutama dis-ebabkan oleh penurunan pada Aset Tetap – Bersih 9,10% atau sebesar USD 4.258.745 ditahun 2012.

Non-current assets decreased by 9.66% to USD 42,782,109 in 2012. This was mainly due to a de-crease in Net Fixed Assets by 9.10% or USD 4,258,745 in 2012.

ASeT TIDAK LANCAR | NoN cURRENT ASSETS

ASEt tIDAK LANCAR FY 2012 (USD)

FY 2011 (USD)

NON-CURRENt ASSEtS

Aset Pajak Tangguhan - 0.00% 379,473 0.80% -100.00% Deferred Tax Assets

Aset Tetap - Bersih 42,519,643 99.39% 46,778,388 98.78% -9.10% Fixed Assets - Net

Aset Lain-lain : Other Assets :

J a m i n a n 55,842 0.13% 58,254 0.12% -4.14% Guarantees

Biaya Ditangguhkan - Bersih

206,624 0.48% 138,141 0.29% 49.57% Deferred Charges-Net

Jumlah Aset tidak Lancar 42,782,109 100.00% 47,354,256 100.00% -9.66% total Non Current Assets

KoMPoSISI ASET TIDAK LANcAR coMPoSITIoN oF NoN cURRENT ASSETS

Aset Tetap Bersih mengalami penurunan sebesar 9,10% menjadi USD 42.519.643 di tahun 2012 dika-renakan oleh biaya penyusutan aset tetap sebesar USD 6.397.322 ditahun 2012. Disamping itu, Aset Pa-jak Tangguhan ditahun 2011 mengalami perubahan menjadi Kewajiban Pajak Tangguhan ditahun 2012 di-karenakan oleh adanya pemanfaatan akumulasi rugi fiskal tahun sebelumnya untuk mengkompensasi bi-aya pajak yang timbul dari laba fiskal ditahun 2012.

Net Fixed assets decreased by 9.10% to USD 42,519,643 in 2012 due to fixed assets depreciation expense of USD 6,397,322 in 2012. In addition, de-ferred tax assets in 2011 had turn into Deferred Tax Liabilities in 2012 due to the use of accumulated fis-cal loss carried forward from previous years to off-set income tax from fiscal income in 2012.

Page 70: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 70

Sat Nusa membukukan Total Liabilitas di akhir ta-hun 2012 sebesar USD 38.558.878 yang terdiri dari 93,58% Liabilitas jangka pendek dan 6,42% Liabilitas Tidak Lancar. Nilai Total Liabilitas ini meningkat USD 5.919.894 atau 18,14% dari USD 32.638.984 pada akhir tahun 2011. Kenaikan pada Liabilitas tersebut terutama disebabkan oleh kenaikan pada Liabilitas Jangka Pen-dek sebesar USD 5.565.638 atau 18,24 % dari akhir ta-hun 2011 sebesar USD 30.515.990.

Sat Nusa booked Total Liabilities at the end of 2012 amounting to USD 38,558,878, consisting of 93.58% and 6.42% of Current Liabilities and Non-current liabilities respectively. These Total Liabilities value increased by USD 5,919,894 or 18.14% from USD 32,638,984 by the end of 2011. In-crease in Liabilities was largely attributable to an increase in Current Liabilities of USD 5,565,638 or 18.24% from the 2011 year-end position of USD 30,515,990.

LIABILITAS | LIABILITIES

KoMPoSISI LIABILITAS LANcAR COMPOSITION OF CURReNT LIABILITIeS

LIABILItAS JANGKA PENDEK FY 2012 (USD)

FY 2011 (USD)

CURRENt LIABILItIES

Hutang Usaha kepada Pihak Ketiga

33,864,958 93.86% 27,436,763 89.91% 23.43% Trade Payables to Third Parties

Hutang Lain-lain 1,346,913 3.73% 2,626,687 8.61% -48.72% Other Payables

Hutang Pajak 146,916 0.41% 108,566 0.36% 35.32% Taxes Payable

Beban Masih Harus Dibayar

722,841 2.00% 343,974 1.13% 110.14% Accrued Expenses

Jumlah Liabilitas Jangka Pendek

36,081,628 100.00% 30,515,990 100.00% 18.24% total Current Liabilities

Komposisi Liabilitas Tidak Lancar sebesar USD 2.477.250 terdiri dari Liabilitas Pajak Tangguhan 8,10% dan Liabilitas Imbalan Kerja 91,90%. Peningkatan jumlah liabilitas jangka panjang sebesar USD 354.256 atau 16,68% terutama disebabkan oleh kenaikan pada Liabilitas Imbalan Kerja sebesar USD 365.115 atau 19,1% dibandingkan dengan tahun 2011. Kenaikan pada Liabilitas Imbalan Kerja dikarenakan oleh adan-ya peningkatan cadangan tahun berjalan akibat penu-runan tingkat diskonto Aktuaria dari 7,1% tahun 2011 menjadi 6,2% ditahun 2012 serta kenaikan pada upah riil tahun 2012 yang berbeda dengan asumsi aktuaria.

Composition of Non-current liabilities amounting to USD 2,477,250 comprised of Deferred Tax Lia-bility 8.10% and Estimated Liabilities for Employee Benefits 91.90%. The increase in Non Current Li-abilities of USD 354,256 or 16.68% was principally attributable to increases in Employee Benefit Li-abilities of USD 365,115 or 19.1% compared to 2011. The increase in Employee Benefit Liabilities was caused by an increase in the current year provi-sion for employment benefit driven by a decrease in discount rates from 7.1% in 2011 to 6.2% in the year 2012 and realization of wages increment in 2012 which differs from actuarials assumptions.

LIABILITAS JANgKA PANJANg | NoN cURRENT LIABILITIES

Di akhir tahun 2012, Liabilitas Jangka Pendek naik 18,24% menjadi USD 36.081.628. Komposisi dari Lia-bilitas Jangka Pendek ini adalah Hutang Usaha 93,86%, Hutang Lain-lain 3,73%, Beban yang Masih Harus Dibayar 2,00% dan Hutang Pajak 0,41%. Kenaikan jum-lah Liabilitas Jangka Pendek sebesar USD 5.565.638 terutama disebabkan oleh meningkatnya hutang us-aha kepada pihak ketiga sebesar USD 6.428.195 atau sebesar 23,43% ditahun 2012.

At the end of 2012, Current Liabilities increased by 18.24% to USD 36,081,628. The composition of this Current Liabilities were Trade Payables 93.86%, Other Payables 3.73%, Accrued Expenses 2.00% and Taxes Payable 0.41%. The increase in Current Liabilities amounting to USD 5,565,638 primarily due to an increase in trade payables to third par-ties by USD 6,428,195 or by 23.43% in the year 2012.

LIABILITAS JANgKA PeNDeK | cURRENT LIABILITIES

Page 71: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 71

KoMPoSISI LIABILITAS TIDAK LANcAR COMPOSITION OF NON CURReNT LIABILITIeS

LIABILITAS JANgKA PANJANg

FY 2012 (USD)

FY 2011(USD)

LoNg TERM LIABILITIES

Hutang Lain-lain - 169,981 8.01% -100.00% Other Payables

Liabilitas Pajak Tangguhan 200,723 8.10% 41,601 1.96% 382.50% Deferred Tax Liabilities

Liabilitas Imbalan Kerja 2,276,527 91.90% 1,911,412 90.03% 19.10% Estimated Liabilities for Employee Benefits

Jumlah Liabilitas Jangka Panjang

2,477,250 100.00% 2,122,994 100.00% 16.68% total Non Current Liabilities

Ekuitas meningkat USD 980.806 atau 1,86% dari USD 52.695.931 pada tahun 2011 menjadi USD 53.676.737 pada tahun 2012. Peningkatan ini terutama disebabkan oleh meningkatnya saldo laba sebagai dampak dari laba bersih yang dibukukan pada tahun berjalan.

Equity increased by USD 980,806 or 1.86% from USD 52,695,931 in 2011 to USD 53,676,737 in 2012. The increase was largely due to an increase in retained earnings due to the net income booked in current year.

EKUITAS | EqUITY

KEMAMPUAN MEMBAYAR HUTANg | SoLvENcY

Kemampuan membayar hutang diukur dengan menggu-nakan ratio liabilitas terhadap ekuitas yaitu perbandin-gan total liabilitas terhadap total ekuitas. Ratio liabilitas terhadap ekuitas Perseroan mengalami perubahan dari 62% tahun 2011 menjadi 72% tahun 2012. Ini menunjuk-kan kemampuan Perseroan dalam memenuhi seluruh kewajibannya masih sangat baik. Dengan posisi leverage yang baik akan meningkatkan kemampuan Perseroan dalam mendapatkan dana eksternal bagi ekspansi di masa datang. Disamping itu, Rasio Liabilitas terhadap Total Aset mengalami kenaikan dari 38% ditahun 2011 menjadi 42% ditahun 2012.

Solvability was measured by debt to equity ratio that is the comparison between total liabilities over total equity. Company’s debt to equity ratio has changed from 62% in 2011 to 72% in 2012. This showed that the Company’s ability in fulfill-ing its total liabilities is in excellent condition. With high leverage position it will increase the Company’s ability of seeking external funding for future expansion. In addition, Total Liabilities to Total Assets ratio has increased from 38% in 2011 to 42% in the year 2012.

RASIo SoLvABILITAS FY 2012(%)

FY 2011(%)

SoLvABILITY RATIo

Rasio Liabilitas terhadap Total Aset 42% 38% Debt to assets ratio

Rasio Liabilitas terhadap Ekuitas 72% 62% Debt to equity ratio

PER 31 DESEMBER 2012, PERSERoAN TIDAK MEMILIKI PINJAMAN BANK YANg BELUM DILUNASI. As of 31 December 2012, the compAny hAs no outstAnDing bAnk loAn.

CAtAtANNOTE

Pada akhir tahun 2012, kemampuan perusahaan dalam menagih piutang (collection period) mengalami penu-runan dari 34 hari pada tahun 2011 menjadi 43 hari pada tahun 2012. Bila dikaji dari 3 (tiga) tahun terakhir, ting-kat kolektibilitas piutang terbaik terjadi pada tahun 2011, dan terburuk terjadi pada tahun 2012.

At the end of 2012, the Company’s collection period had deteriorated from 34 days in 2011 to 43 days in 2012. When analyzed from the last 3 (three) years, the performance level of the best receivable collectability occurred in 2011, and the worst occurred in 2012.

KoLEKTIBILITAS PIUTANg | coLLEcTIBILITY

FY 2010 FY 2011 FY 2012

Jumlah hari piutang tertahan

42 34 43 Trade Receivable Turnover days

TABEL PERBANDINgAN KoLEKTIBILITAS PIUTANg 2010 - 2012TABLE coMPARISoN oF AccoUNT REcEIvABLE coLLEcTIoN 2010 - 2012

Page 72: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 72

fy2012(Usd)

fy2011(Usd)

Arus Kas dari Aktivitas Operasi

9,577,823 6,078,685 58% Cash flows from Operating Activities

Arus Kas dari Aktivitas investasi

(2,195,333) (7,922,148) -72% Cash Flows from Investing Activities

Arus Kas dari Aktivitas Pendanaan

(41,481) (51,982) -20% Cash Flows From Financing Activities

Kas dan Setara Kas Awal Tahun

731,401 2,626,846 -72% Cash and Cash Equivalent at The Beginning of the Year

KasdansetaraKasAkhirTahun

8,072,410 731,401 1,004% CashandCashEquivalentatTheEndoftheyear

ARUS KAS | cASH FLowS

Posisi kas Perseroan tahun 2012 mengalami kenai-kan sebesar 1.003,69% atau USD 7.341.009. Kenaikan tersebut terutama dikarenakan oleh adanya pemba-yaran atas perolehan aset tetap di tahun 2011.

In 2012 the Company’s cash position increased by 1,003.69% or USD 7,341,009. The increase was primarily due to the payment for the purchase of fixed assets in the year 2011.

Selama tahun 2012, arus kas masuk berasal dari pen-erimaan kas dari pelanggan sebesar USD 232.967.617 yakni turun sebesar 3,18% atau sebesar USD 7.648.410 dibandingkan dengan tahun sebelumnya dan peneri-maan restitusi pajak penghasilan badan sebesar USD 13.685 mengalami penurunan sebesar USD 82.449 atau 85,76% dibandingkan dengan tahun 2011.

Arus kas dari aktivitas operasi yang digunakan un-tuk melakukan pembayaran terhadap para pemasok, komisaris, direksi, karyawan dan pajak penghasilan badan sebesar USD 223.403.479. Arus kas Perseroan dari aktivitas operasi meningkat sebesar 57,56% atau USD 3.499.138 dibandingkan dengan tahun 2011.

During the year 2012, cash inflows from operat-ing activities were derived from Cash receipts from Customers amounted to USD 232,967,617 in which decreased by 3.18% or USD 7,648,410 com-pared to previous year and Receipt from Refund of Corporate Income tax amounted to USD 13,685 decreased by USD 82,449 or 85.76% compared to 2011.

Cash flow from operating activities were used to pay our supplier, Commissioners, Directors, Employees and Corporate Income tax amounting to USD 223,403,479. The Company’s cash flows from operating activities rose by 57.56% or USD 3,499,138 compared to year 2011.

ARUS KAS DARI AKTIvITAS oPERASI | cASH FLowS FRoM oPERATINg AcTIvITIES

Arus kas Perseroan yang digunakan untuk aktivitas investasi menurun 72,29% atau USD 5.726.815. Hal tersebut terutama didorong oleh penurunan yang signifikan pada perolehan Aset Tetap sebesar 74,05% atau USD 6.004.691. Disisi lain, terjadi penurunan pada penerimaan kas atas penjualan aset tetap sebe-sar USD 252.820 atau 87,95% dibandingkan dengan tahun sebelumnya.

Cash flows used in investing activities decreased by 72.29% or USD 5,726,815. This was primarily driven by a significant reduction in the acquisi-tion of fixed assets amounted to 74.05% or USD 6,004,691. On the other hand, a decline in cash receipts on sale of fixed assets by USD 252,820 or 87.95% compared to previous year.

ARUS KAS DARI AKTIvITAS INvESTASI | cASH FLowS FRoM INvESTMENT AcTIvITIES

Arus kas Perseroan yang digunakan untuk aktivitas pendanaan menurun sebesar 20,20% atau USD 10.501. Hal tersebut dikarenakan oleh terjadinya penurunan pada Pembayaran bunga dan provisi bank.

Cash flows used in financing activities decreased by 20.20% or USD 10,501. This is due to the de-crease in interest payments and bank provision.

ARUS KAS DARI AKTIvITAS PENDANAAN | cASH FLowS FRoM FINANcINg AcTIvITIES

Page 73: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 73

TRANSAKSI YANg MENgANDUNg BENTURAN KEPENTINgAN DAN TRAN-SAKSI DENgAN PIHAK YANg MEMILIKI HUBUNgAN ISTIMEwA/AFILIASI

Benturan kepentingan adalah keadaan ketika ada konflik antara kepentingan ekonomis Sat Nusa dan kepentingan ekonomis pribadi Direksi, Dewan Komisaris, dan Pemegang Saham. Selama 2012, tidak ada transaksi benturan kepentingan terjadi di Sat Nusa. Setiap transaksi telah dilakukan mengikuti peraturan, termasuk juga prinsip-prinsip GCG.

Conflict of interest is a state when there is a conflict between the economic interest of Sat Nusa and the personal economic interest of the Board of Direc-tors, Board of Commissioners, and Shareholders. During 2012, there was no transaction with conflict of interest happening in Sat Nusa. Every transac-tion has been performed following the regulations, including also the GCG principles.

coNFLIcT oF INTEREST AND RELATED PARTY (AFFILIATES) TRANSAcTIoNS

STRUKTUR MoDAL | cAPITAL STRUcTURE

STRUKTUR MODAL

2012(USD)

2011(USD)

CAPITAL STRUCTURe

Liabilitas 38,558,878 42% 32,638,984 38% 18% Liabilities

- Jangka Pendek 36,081,628 39% 30,515,990 36% 18% Current Liabilities -

- Jangka Panjang 2,477,250 3% 2,122,994 2% 17% Non Current Liabilities -

Ekuitas 53,676,737 58% 52,695,931 62% 2% Equity

tOtAL MODAL YANG DIINvEStASIKAN

92,235,615 100% 85,334,915 100% 8% tOtAL OF CAPItAL INvEStED

TABEL STRUKTUR MoDAL PERUSAHAAN PER 31 DESEMBER 2012TABLE cAPITAL STRUcTURE PER DEcEMBER 31, 2012

Kebijakan Perusahaan pada struktur modal adalah menjaga rasio hutang yang cocok (tidak melebihi) ra-sio hutang terhadap ekuitas 100%. Rasio Liabilitas/Ekuitas yang rendah di tahun 2011 sebesar 62% dan 72% di 2012 menunjukkan solvabilitas yang kuat dan relatif stabil.

The Company’s policy on capital structure is to maintain a debt ratio that matches (does not ex-ceed) debt to equity ratio of 100%. The Debt/Equity Ratio of 62% in 2011 and 72% in 2012 indicates strong and relatively stable solvency.

KEBIJAKAN MANAJEMEN ATAS STRUKTUR MoDALMANAgEMENT PoLIcY oN cAPITAL STRUcTURE

Pada akhir tahun 2012, Sat Nusa memiliki likuidi-tas yang sehat dan relatif stabil dengan ratio lancar sebesar 1,37x dengan nilai kas dan setara kas USD 8.072.410 dimana ratio lancar di tahun 2011 sebesar 1,24x. Pendanaan Perseroan pada tahun 2012 ber-sumber dari arus kas masuk dari aktivitas operasi sebesar USD 9.577.823.

At the end of 2012, Sat Nusa had a healthy and rela-tively stable liquidity with a current ratio of 1.37x with cash and cash equivalent value at USD 8,072,410 in which the current ratio in 2011 was 1.24x. The Com-pany’s financing in 2012 came from Cash inflow from operating activities of USD 9,577,823.

TINgKAT LIKUIDITAS | LIqUIDITY

TABEL RASIO LANCAR 2010 - 2012 tABLE CURRENt RAtIO 2010 - 2012

KETERANGAN 2010 2011 2012 DESCRIPTION

Ratio Lancar (x) 1.27 1.24 1.37 Current Ratio (x)

Page 74: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 74

Selama tahun 2012, tidak terdapat ikatan material atas investasi barang modal.

Selama tahun 2012, tidak ada program dan proses yang berkaitan dengan divestasi Perseroan.

Selama tahun 2012, Perseroan tidak melakukan proses dan aktivitas yang berkaitan dengan akui-sisi.

During the year 2012, there are no material commit-ments on capital investments.

During 2012, there was not any program and process related to the Company divestation.

During 2012, the Company did not perform anyprocess or activity related to acquisition.

MATERIAL coMMITMENTS RELATED To cAPITAL INvESTMENTIKATAN MATERIAL ATAS INvESTASI BARANg MoDAL

INFORMASI DAN FAKTA MATERIAL YANG TERJADI SETELAH TANGGAL LAPORAN AKUNTANMATeRIAL INFORMATION OR SUBSeQUeNT eveNT TO THe ACCOUNTANT’S RePORT DATe

Tidak terdapat kejadian penting atau fakta material yang terjadi setelah tanggal laporan akuntan

There were no significant events or material facts occurring after accountant’s report date

INFORMASI MATERIAL | MATERIAL INFORMATION

DIVESTASI

AKUISISI

DIVESTATION

ACqUISITION

Peraturan Bapepam No. IX.E.2 dan Anggaran Dasar Perseroan mengatur bahwa penyertaan dalam badan usaha, proyek, dan/atau kegiatan usaha tertentu, pembelian, penjualan, pengalihan, tukar menukar aset atau segmen usaha, sewa menyewa aset, pinjam meminjam dana, menjaminkan aset, dan/atau memberikan jaminan perusahaan dengan nilai transaksi 20% (dua puluh perseratus) sampai dengan 50% (lima puluh perseratus) dari ekuitas Perusahaan tidak diwajibkan untuk memperoleh persetujuan Rapat Umum Pemegang Saham, se-dangkan Transaksi Material dengan nilai transaksi lebih dari 50% (lima puluh perseratus) dari ekuitas Perusahaan diwajibkan untuk memperoleh per-setujuan Rapat Umum Pemegang Saham. Selama tahun buku 2012, tidak ada transaksi material yang dilakukan oleh Perseroan.

Bapepam Regulation No. IX.E.2 and Articles of As-sociation of the Company stipulates that investments in business entities, projects, and / or certain busi-ness activities, purchase, sale, transfer, exchange of assets or business segments, asset leasing, lending and borrowing of funds, assets, and / or corporate guarantees on turnover of 20% (twenty percent) to 50% (fifty percent) of the equity of the Company is not required to obtain the approval from the General Meeting of Shareholders, while the material transac-tion with a transaction value of more than 50% (fifty percent) of the equity of the Company is required to obtain the approval of the General Meeting of Share-holders. During fiscal year 2012, there was no such material transaction conducted.

REALIZATIoN oF USE oF FUNDS FRoM IPo PRocEEDSREALISASI PENggUNAAN DANA HASIL PENAwARAN UMUM

The Company has reported the use of proceeds from realization of the Public Offering in 2007 periodically to Bapepam-LK in accordance with Rule Number XK4 with supplementary decision from the Chair-man of Bapepam No.Kep 27/PM/2003 dated July 17, 2003 regarding the report of actual use of the funds from Public Offering and the Annual general Meet-ing of Shareholders (AGMS).

Perseroan telah melaporkan realisasi penggunaan dana hasil Penawaran Umum tahun 2007 secara periodik kepada Bapepam-LK sesuai dengan Pera-turan Nomor X.K.4 Lampiran Keputusan Ketua Ba-pepam Nomor Kep 27/PM/2003 tanggal 17 Juli 2003 tentang Laporan Realisasi Penggunaan Dana Hasil Penawaran Umum dan pada Rapat umum Pemeg-ang Saham (RUPS) Tahunan.

Page 75: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 75

dividend policykEBijakan dividEn

Para pemegang saham baru yang berasal dari Pena-waran Umum mempunyai hak yang sama dan sedera-jat dalam segala hal dengan pemegang saham lama Perseroan termasuk hak atas pembagian dividen sesuai dengan ketentuan anggaran dasar Perseroan dan peraturan perundang-undangan yang berlaku. Perseroan merencanakan untuk membayarkan divi-den tunai kepada seluruh pemegang saham sekurang kurangnya 1 (satu) kali minimal 10% (sepuluh pers-en) dari laba bersih setelah pajak dalam suatu tahun buku.

Besarnya pembayaran dividen yang akan di bagikan tergantung kepada tingkat keuntungan Perseraon pada tahun buku yang bersangkutan dengan tetap memperhatikan tingkat kesehatan dan rencana Pers-eroan di masa yang akan datang dan tanpa men-gurangi hak dari Rapat Umum Pemegang Saham Perseroan untuk menentukan lain sesuai dengan ke-tentuan Anggaran Dasar Perseraoan.

Namun, mengingat posisi keuangan Perusahaan, yang masih mengalami kerugian ditahun buku 2010 dan 2011, dengan demikian ditetapkan dalam agenda RUPS yang disetujui bahwa tidak ada dividen yang dibagikan kepada pemegang saham Perusahaan. Pe-rusahaan belum pernah membagikan dividen sejak IPO pada November 2007.

The new shareholders from initial public offering have equal rights and equal in all respects to the old shareholders of the Company including rights to dividends in accordance with the provisions of the Company’s articles of association and regula-tions in force. The Company plans to pay cash divi-dends to all shareholders of at least once at the minimum of 10% (ten percent) of net profit after tax in the year.

The amount of dividend payments will be distrib-uted depending on the level of profits of the Com-pany in the financial year concerned with regard to the health and plans of the Company in the future and without prejudice to the rights of the General Meeting of Shareholders to decide otherwise in accordance with the Articles of Association.

However, considering the financial position of the Company, which still incurred losses both in 2010 and 2011, it has been stipulated and approved in the agenda of GMS that no dividends will be dis-tributed to the shareholders of the Company. The Company has yet distributed dividends since IPO on November 2007.

Page 76: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 76

coRPoRATE TARgET/PRoJEcTIoN

SIgNIFIcANT cHANgES IN AccoUNTINg PoLIcY

cHANgES IN LAwS AND REgULATIoNS

TARgET/PRoYEKSI PERUSAHAAN

PERUBAHAN KEBIJAKAN AKUNTANSI YANg SIgNIFIKAN

PERUBAHAN PERATURAN PERUNDANg UNDANgAN

Pada awal tahun 2012, top manajemen menetapkan target penjualan untuk 2012 sebesar USD 226.568.133 dengan mempertimbangkan kondisi perekonomian global, namun Perseroan berhasil membukukan total penjualan yang melampaui target penjualan sebesar 5,65%. Perseroan tidak menetapkan perkiraan laba bersih pada awal tahun 2012.

Untuk target tahun 2013, dengan kenaikan UMK sebe-sar 54,23% ditambah dengan ketidakpastian ekonomi global, Perseroan memproyeksikan akan terjadi penu-runan pada penjualan sebesar 20%, sedangkan untuk posisi laba bersih, Perseroan belum bisa memberikan gambaran dikarenakan Perseroan masih melakukan negosiasi dengan pelanggan Perseroan untuk menai-kan harga jual. Jika Perseroan tidak berhasil dalam menaikan harga jual, maka Perseroan berpotensi membukukan rugi bersih ditahun 2013. Dalam hal mengenai struktur modal, Perseroan berencana un-tuk mempertahankan rasio liabilitas terhadap ekuitas dibawah 100%. Perseroan merencanakan untuk mem-bayarkan dividen tunai kepada seluruh pemegang sa-ham minimal 10% (sepuluh persen) dari laba bersih setelah pajak dalam setahun dengan terus memper-timbangkan keuangan Perseroan pada tahun 2013.

Sejak 1 Januari 2012, Perusahaan telah mengubah mata uang pelaporannya dalam Rupiah menjadi Dolar Amerika Serikat sesuai mata uang fungsionalnya se-hubungan dengan penerapan Pernyataan Standar Akuntansi Keuangan 10 (Revisi 2010), “Pengaruh Pe-rubahan Kurs Valuta Asing”. Sebagai hasilnya, Lapo-ran Posisi Keuangan (Neraca) Konsolidasi tanggal 31 Desember 2011 dan 1 Januari 2011 dan Laporan Laba Rugi Komprehensif Konsolidasi, Laporan Perubahan Ekuitas Konsolidasi dan Laporan Arus Kas Konsolidasi untuk tahun yang berakhir pada tanggal 31 Desember 2011, yang sebelumnya disajikan dalam Rupiah, telah diukur kembali ke dalam Dolar Amerika Serikat.

Selama tahun 2012 tidak terdapat perubahan peratu-ran perundang-undangan yang berpengaruh signifikan terhadap Perusahaan.

During the year 2012 there were no changes in laws and regulations that have a significant effect on the Company.

In early 2012, the top management set a sales target for 2012 of USD 226,568,133 taking into ac-count the global economic conditions, however, the Company recorded total sales exceeded the sales target by 5.65%. The Company did not set any net profit forecast in the beginning 2012.

For target in 2013, with the minimum wages in-creased by 54.23% coupled with global economic uncertainty, the Company is projecting a drop in sales of 20%, while for the net profit, the Company has not been able to provide projection due to the Company is still negotiating with the customers to raise its selling price. If the Company is unable to increase its selling price, it may lead the Com-pany to book a net loss in 2013. In terms of the capital structure, the Company plans to retain the liabilities-to-equity ratio below 100%. The Compa-ny plans to pay cash dividend to all shareholders at least 10% (ten percent) of the net profit after tax in the financial year taking into account the Company financial performance in 2013.

Effective from January 1, 2012, the Company has changed its reporting currency from the Indo-nesian Rupiah to United States Dollar to be in line with its functional currency in relation to the adoption of Statement of Financial Accounting Standards (SFAS) 10 (Revised 2010), “The Effects of Changes in Foreign Exchange Rates”. As the results, the Consolidated Statements of Financial Position (Balance Sheets) as of December 31, 2011 and January 1, 2011 and Consolidated Statements of Comprehensive Income, Consolidated State-ments of Changes in Equity and Consolidated Statements of Cash Flows for the year ended De-cember 31, 2011, previously presented in the Indo-nesian Rupiah, have been remeasured in United States Dollar.

Page 77: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 77

Sat Nusa has made significant progress since its inception. It has relentlessly pursued operational and financial excellence. It has laid a strong foundation over time – a foundation of superior facilities and structures, strong supply chain and procurement capabilities, innovative manufacturing processes, engi-neering and technical advancement and operational and manufacturing excellence.

These have differentiated Sat Nusa from its competitor, making Sat Nusa the partner of choice, enabling it to forge many enduring partnerships with world-class technology companies. And with its broad and solid foundation, Sat Nusa aspires to build new peaks of excellence, creating more value to its customers.

Perseroan telah membuat kemajuan yang signifikan sejak didirikan. Perseroan sen-antiasa mengejar keunggulan operasional dan keuangan. Perseroan telah meletakkan dasar yang kuat dari waktu ke waktu yang meliputi dasar fasilitas dan struktur yang unggul, rantai pasokan dan kemampuan pengadaan yang solid, proses manufaktur yang inovatif, kemajuan secara teknik dan teknis serta keunggulan operasional dan manufaktur.

Perseroan telah membuat perbedaan yang signifikan dari para pesaingnya yang mem-buat Perseroan menjadi mitra pilihan sehingga memungkinkan untuk menjalin kemi-traan yang kokoh dengan perusahaan teknologi kelas dunia. Dengan landasan yang kuat dan solid, Perseroan bercita-cita untuk mencapai puncak keunggulan yang baru agar dapat menciptakan nilai tambah bagi para pelanggannya.

Tinjauan Operasional

Operational review

Page 78: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 78

Page 79: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 79

plastic molding divisionfactoRy 10

in2012,satnusaacquired5unitofnewhaitianplasticmoldingmachineswithtotalinvestmentofrp2.1billionPada tahun 2012, Sat Nusa membeli 5 unit mesin pencetak plastik Haitian baru dengan total investasi sebesar Rp 2,1 miliar

Page 80: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 80

PERAKITAN DAN TES PAPAN PCB (PRINTED CIRCUIT BOARD)Perseroan menawarkan berbagai macam solusi perakitan dan pengujian papan PCB, termasuk perakitan papan sirkuit, perakitan subsistem, sirkuit dan pengujian fungsional, pengujian lingkungan dan stres dan pengujian keandalan komponen.

PERAKITAN DAN TEST FLEX SIRKUITPerseroan menyediakan berbagai solusi perakitan sirkuit flex dan pengujian kepada pelanggannya. Pers-eroan menggunakan strategi perkakas khusus dan prosedur otomatisasi canggih untuk meminimalkan penanganan sirkuit dan memastikan bahwa parameter pengolahan konsisten selama proses perakitan.

PRINTED CIRCUIT BOARD ASSEMBLY AND TESTWe offer a wide range of printed circuit board assembly and test solutions, including printed circuit board as-sembly, assembly of subsystems, circuitry and functionality testing of printed assemblies, environmental and stress testing and component reliability testing.

FLEX CIRCUIT ASSEMBLY AND TESTWe provide our customers with a wide range of flex circuit assembly and test solutions. We utilize specialized tooling strategies and advanced automation procedures to minimize circuit handing and ensure that consistent processing parameters are maintained throughout the assembly process.

Page 81: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 81

Perseroan menawarkan keahlian kepada pelang-gan dalam berbagai macam teknologi manufaktur tradisional dan canggih. Perseroan memiliki keahl-ian teknis yang dapat melakukan perakitan produk PCB standar maupun kompleks yang memerlukan keterampilan teknik dan peralatan yang canggih. Perseroan juga menyediakan pelanggan kami den-gan seperangkat teknologi manufaktur dan solusi yang meliputi:

We offer our customers expertise in a wide variety of traditional and advanced manufacturing technologies. Our technical expertise supports standard printed cir-cuit board assembly as well as complex products that require advanced engineering skills and equipment. We also provide our customers with a comprehensive set of manufacturing technologies and solutions which include:

Mounting point refers to number of component mounted into the surface of a Printed Circuit Board or known as PCB. In 2012, total mounting point in SMT division amounted to an average of 254,767,609 point per month or increased by 3.6% compared to an average 245,778,615 point per month in 2011.

Mounting Point mengacu pada jumlah komponen yang dipasang ke permukaan Printed Circuit Board atau dikenal dengan Papan PCB. Pada tahun 2012, total mounting point di divisi SMT sebesar rata-rata 254.767.609 point per bulan atau meningkat sebe-sar 3,6% dibandingkan dengan rata-rata 245.778.615 point per bulan pada tahun 2011.

• PIN THRU HOLE

• SURFACE MOUNT TECHNOLOGY

• FINE PITCH

• BALL GRID ARRAY

• FLIP CHIP

• IN-CIRCUIT TEST

• BOARD LEVEL FUNCTIONAL TEST

• STRESS TESTING

TeKNOLOGI MANUFAKTUR | MANUFACTURING TeCHNOLOGIeS

254,767,609 pointtahun year

2012tahun year

2011 point 245,778,615

260,000,000

tahun year 2008

tahun year 2009

tahun year 2010

tahun year 2011

tahun year 2012

230,000,000 330,000,000 332,000,000 330,300,000

RATA-RATA PER BULAN | MONTHLY AVERAGE

RATA-RATA PER BULAN | MONTHLY AVERAGE

MoUNTINg PoINT

MoUNTINg cAPAcITY

Pada tahun 2012, Perseroan memiliki 21 Jalur SMT, Perseroan dapat melakukan perakitan komponen dengan kecepatan mencapai 173 komponen per de-tik. (Asumsi : 22 hari kerja dan 24 jam kerja/hari).

In 2012, Sat Nusa has a total of 21 SMT lines, it ena-bles the Company to perform high speed component mounting reaching 173 components per second.(Assumption : 22 working days and 24 working hour/day)

Page 82: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 82

Sony Energy Device Corporation (SEND)Sony Energy Technology Singapore (SETS)

Sony EMCS (Malaysia) Sdn BhdKenwood Electronics-Technologies Malaysia, Sdn. Bhd

Panasonic AVC Networks SingaporePanasonic Industrial Devices Singapore

Singapore Epson Industrial Pte. LtdTOA E&I Europe GmBH Singapore BranchAllied Telesyn International (Asia) Pte. Ltd

Japan Servo Motors (S) Pte. LtdPT OSI Electronics

PT Sanyo Energy (Btm) CorpPT Nidec Seimitsu Batam

PT TEAC IndonesiaPT Yeakin Plastics Industry

APPS Connect Pte. LtdBit Wave Pte. Ltd

BBS Access Pte. LtdDoodle labs (SG) Pte. Ltd

Ektronics Pte. LtdGrantech Pte. Ltd

Shimano (S) Pte LtdVizmonet (S) Pte Ltd

Marketing asPects

pelan

gg

an

perseroa

n - o

ur custo

mers

ASPEK PEMASARAN

Page 83: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 83

Perseroan berkonsentrasi untuk melakukan upaya diversifikasi sektor industri dan basis pelanggannya. Top Management, didukung oleh manajemen ekse-kutif, bekerja untuk memperluas hubungan dengan pelanggan yang ada melalui penambahan lini produk dan jasa. Tim ini juga mengidentifikasi dan mencoba untuk mengembangkan hubungan dengan pelang-gan baru yang memenuhi profil Perseroan.

Perseroan akan terus berfokus pada pelanggan-nya dan memberikan layanan yang melampaui ek-spektasi pelanggan dengan eksekusi yang cepat, kelincahan yang tinggi dan ketanggapan Perseroan. Dengan memberikan kualitas layanan bernilai tam-bah, Perseroan terus memberikan kepuasan kepada pelanggannya. Bersama sama dalam mendapat-kan keunggulan operasional, Perseroan akan dapat membangun hubungan strategis yang kuat dengan pelanggan globalnya.

We have made concentrated efforts to diversify our industry sectors and customer base. Our Top Man-agement, supported by executive management, work to expand existing customer relationships through the addition of product lines and services. These individuals also identify and attempt to de-velop relationships with new customers who meet our profile.

We will remain highly customer-focused as we aim to exceed our customers’ expectations with our speedy execution, great agility and responsive-ness. By providing quality value-added services, We continue to achieve total customer satisfaction. Together with its relentless pursuit of operational excellence, We will be able to forge strong strategic relationships with its global customers.

From the marketing aspect, the Company actively penetrated market to various large-scale compa-nies in order to attract loyal customers. Our cus-tomers include many of the world’s leading technol-ogy companies. We have developed long standing relationships with our customers.

Dari aspek pemasaran, Perseroan secara aktif men-jajaki pasar ke berbagai perusahaan berskala besar untuk mendapatkan pelanggan setia. Pelanggan Perseroan meliputi banyak perusahaan teknolo-gi terkemuka di dunia. Perseroan telah menjalin hubungan yang lama dengan pelanggannya.

PErsEroan sEnantiasa mEngacu Pada tujuan tunggal untuk mEmBErikan so-lusi tErBaik kEPada PElanggan PErsEroan dEngan harga Paling komPEtitif

wE Bound By thE singular aim of dElivEring thE BEst solutions to our customErs at thE most comPEtitivE PricEs.

ASIA

UNITeD STATeS47%

27%

26% eUROPe

ASIA

AMERIKA SERIKAT

EROPA

PRODUK PERSEROAN DAPAT DIKATEGORIKAN MENJADI BEBERAPA KELOMPOK BERDASARKAN DISTRIBUSI PASAR AKHIRCOMPANY’S PRODUCTS CAN BE CATEGORIzED INTO SEVERAL GROUPS BY END MARKET DISTRIBUTION

DiSTRiBUSi PASAR AKhiREND MARKET DISTRIbUTION

Page 84: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 84

ProsPEk usahaBUSINESS PROSPECT

ElEctronic contract manufacturing rEvEnuE PENJUALAN KONTRAK MANUFAKTUR ELEKTRONIK

Ems industry lacks dirEction in 2013INDUSTRY EMS TIDAK MEMILIKI ARAHAN YANG JELAS DI TAHUN 2013

Mengikuti ekspansi yang terjadi pada tahun 2011, bis-nis kontrak elektronik manufaktur global diperkirakan akan menurun sedikit pada tahun 2012, ketidakpastian ekonomi yang berkelanjutan di Eropa dan Amerika Serikat mengkonstriksi pertumbuhan, menurut IHS iSuppli.

Total pendapatan kontrak manufaktur tahun ini diperkirakan menurun menjadi USD 357 miliar, men-galami penurunan kurang dari 1 persen dari USD 360 miliar pada tahun 2011. Kedua segmen industri elec-tronic manufacturing services (EMS) dan original design manufacturing (ODM) tidak diproyeksikan berkinerja bagus ditahun ini. Pada tahun 2011, EMS didorong oleh pertumbuhan pendapatan 9,6 persen dibandingkan dengan tahun 2010. Namun, pasar ODM sudah men-galami guncangan pada tahun 2011, dengan penu-runan 1,73 persen, menurut iSuppli IHS.

Follow a year of expansion in 2011, the global electronics contract manufacturing business is expected to decline slightly in 2012, as continuing economic uncertainty in Europe and the United States constricts growth, according to IHS iSup-pli.

Total contract manufacturing revenue this year is expected to decline to USD 357 billion, down by slightly less than 1 percent from USD 360 billion in 2011. Both the electronic manufacturing services (EMS) and original design manufacturing (ODM) segments of the industry are not projected to perform well for this year. In 2011, EMS boasted 9.6 percent growth in revenue compared to 2010. However, the ODM market already was strug-gling in 2011, with a 1.73 percent decline, accord-ing to IHS iSuppli.

2010

usd

187.

9

usd

155.

7

usd

153.

0

usd

149.

5

usd

206.

8

usd

207.

5

2011 2012

EMS REVENUE (PENJUALAN)

SOURCE : iHS iSUppli

ODM REVENUE (PENJUALAN)

Pendapatan di sektor EMS untuk tahun 2012 diproyeksikan datar di USD 207,5 miliar atau naik 0,3 persen dari USD 206,8 milliar ditahun 2011. Sektor ODM akan berada pada tren penurunan yang lebih buruk, menyusut 2,3 persen menjadi USD 149,5 miliar, turun dari USD 153,0 miliar, sep-erti yang ditunjukkan pada gambar terlampir.

Revenue in the EMS sector for 2012 will be practically flat at USD 207.5 billion, up by a negligible 0.3 percent from USD 206.8 billion in 2011. The ODM sector will be in even worse straits, shrinking 2.3 percent to USD 149.5 billion, down from USD 153.0 billion, as shown in the figure attached.

Meskipun kinerja yang lebih kuat dari yang diperkira-kan pada tahun 2011 dan proyeksi penjualan yang datar untuk 2012, prospek untuk pasar electronic manufac-turer services (EMS) tahun ini agak tidak menentu, den-gan tidak ada tren yang jelas mendefinisikan industri tahun ini.

Despite a stronger-than-expected performance in 2011 and a flat projection for 2012 revenue, the outlook for the electronics manufacturing ser-vices (EMS) market this year is somewhat un-certain, with no clear trends defining the industry this year.

Page 85: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 85

mEmahami PEngurangan Biaya original EQuiPmEnt manufacturEr (oEm) mElalui outsourcing dan nilai tamBah yang ditawarkan olEh PEnyEdia Ems

Manfaat dan pengurangan biaya outsourcing dapat dicapai dengan penghematan yang besar ketika peru-sahaan OEM mengoutsource proses manufaktur dan fungsi lain dari rantai suplai mereka kepada kontrak manufaktur atau, penyedia electronics manufacturing services (EMS) atau original design manufacturers (ODM) yang menawarkan berbagai layanan rantai pasokan.

• Para kontrak manufaktur dapat memberikan pengurangan pada biaya outsourcing kepada OEM karena kontrak manufaktur melayani beberapa pelanggan OEM sekaligus. Hal ini berlaku untuk sebagian be-sar kontrak manufaktur. Dengan melayani beberapa pelanggan OEM dan produk, kontrak manufaktur menurunkan biayanya dalam melakukan bisnis, dengan harapan dapat meningkatkan tingkat peman-faatan seluruh kapasitas fasilitasnya.

• Para kontrak manufaktur dapat memberikan pengurangan biaya outsourcing tambahan kepada OEM karena kontrak manufaktur menyediakan layanan pada geografi yang lebih murah.

• Kontrak manufaktur dapat memberikan pengurangan biaya outsourcing tambahan kepada OEM ka-rena kontrak manufaktur telah mengoptimalkan rantai pasokan logistiknya. Kontrak manufaktur yang memiliki hubungan dengan vendor lokal yang menyediakan bahan-bahan berkualitas dapat mencari vendor di wilayah tersebut dan mengurangi biaya untuk bahan masuk.

• Kontrak manufaktur dapat memberikan pengurangan biaya outsourcing tambahan kepada OEM ka-rena kontrak manufaktur terintegrasi secara vertikal. Integrasi vertikal mengacu pada kontrak manu-faktur mendedikasikan (memiliki) fasilitas stamping logam atau injeksi cetakan plastik sendiri untuk menyediakan kebutuhan produk pelanggan OEM. Hal ini memungkinkan kontrak manufaktur untuk mengelola aliran pasokan bahan lebih baik.

• Kontrak manufaktur dapat memberikan pengurangan biaya outsourcing tambahan kepada OEM ka-rena kontrak manufaktur telah mencapai pembelian dengan skala ekonomi yang besar. Seiring dengan perkembangan bisnis kontrak manufaktur dan pertumbuhan pendapatan dan perluasan basis pelang-gannya, kontrak manufaktur dapat mencapai ‘pembelian dengan skala ekonomi yang besar.’

Outsourcing cost reductions and benefits can be achieved with greater savings when OEM companies out-source manufacturing and other functions of their supply chain to contract manufacturers or, electronics man-ufacturing services (EMS) providers or original design manufacturers (ODM) offering a wider array of supply chain services.

• The contract manufacturer can pass on outsourcing cost reductions to the OEM because the contract manu-facturer serves multiple OEM customers. This is true for most contract manufacturers. By serving multiple OEM customer and product, the contract manufacturer lowers his cost of doing business while, hopefully, increasing his capacity utilization rates across his facilities.

• The contract manufacturer can pass along additional outsourcing cost reductions to the OEM because the contract manufacturer provides services in less expensive geographies.

• Contract manufacturer can pass along additional outsourcing cost reductions to the OEM because the con-tract manufacturer has optimized his logistics supply chain. Contract manufacturers with relations with local vendors providing quality materials are able to source from these vendors in the region and reduce costs for inbound materials

• Contract manufacturer can pass along additional outsourcing cost reductions to the OEM because the con-tract manufacturer is vertically integrated. Vertical integration refers to the contract manufacturer dedicat-ing (owning) its own sheet metal stamping or plastics mold injection facilities to provide for OEM customer product program needs. This allows the contract to also better-manage the flow of the materials supply.

• Contract manufacturer can pass along additional outsourcing cost reductions to the OEM because the con-tract manufacturer has achieved purchasing economies of scale. As the contract manufacturer’s business and revenue grows and his customer base expands, contract manufacturer achieve greater ‘purchasing economies of scale’.

UnDerSTanDing CoST reDUCTionS for original eqUipmenTmanUfaCTUrer (oem) THroUgH oUTSoUrCing anD THe valUe offereD by emS proviDerS

Page 86: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 86

Sat Nusa continues to develop Corporate Social Responsibility program and accompanied with improvement and enhancement of the processes and production facilities to meet the environmentally friendly operational standards

satnusaterusmengembangkanprogramCorporatesocialresponsibilitydandisertaidenganperbaikandanpeningkatanprosesdanfasilitasproduksiuntukmemenuhistandaroperasionalyangramahlingkungan

Memberikan kontribusi yang lebih besar terhadap Lingkungan

Greater Contribution to Environment

Page 87: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 87

Sat Nusa is committed to building a high growth business while ensuring a safe environment for employees and minimizing impact on the environment. We aim to understand and respond to the needs of shareholders, employees, customers, suppliers, the communities in which we work and the wider public.

sat nusa berkomitmen untuk membangun pertumbuhan bisnis yang tinggi danmemastikanlingkunganyangsehatdanamanbagikaryawansertameminimalkandampakterhadaplingkungan.Perseroanmengupayakanuntukmemahamidanmer-esponikebutuhandariparapemegangsaham,karyawan,pelanggan,pemasok,ko-munitasdimanaPerseroanberoperasidanmasyarakatluas.

Sat Nusa CSR Statement

KeselamatandanKesehatanKerjaSat Nusa tetap berkomitmen untuk mencapai dan mempertahankan standar yang berlaku dalam praktek kesehatan dan keselamatan. Perseroan bekerja secara positif untuk mewujudkan bu-daya yang sehat dalam Kesehatan, Keselamatan, dan Lingkungan dan melibatkan semua karyawan dalam menjaga lingkungan keselamatan kerja.

PengembangandanretensikaryawanSat Nusa bertujuan untuk merekrut bakat terbaik, bertindak sebagai pemberi kerja yang adil dan me-mastikan bahwa staf Perseroan terlindung dari dis-kriminasi dan pelecehan di tempat kerja. Perseroan berinvestasi dalam pelatihan dan pengembangan staf Perseroan untuk membangun keterampilan yang dibutuhkan dalam sebuah bisnis yang sukses.

KesadaranterhadaplingkungandanKomunitasSat Nusa mematuhi undang-undang lingkungan yang berlaku dan menerapkan praktek yang ramah lingkungan dalam kegiatan usahanya. Perseroan berusaha untuk mendaur ulang di semua bidang - dari perlengkapan kantor sampai dengan penggu-naan air. Perseroan berusaha untuk menjadi bagian dari masyarakat dan berkonsultasi dengan pen-duduk sekitar mengenai kemungkinan dampak dari operasional Perseroan, serta menginformasikan kepada masyarakat setempat mengenai lapangan kerja yang ada pada Perseroan.

occupationalhealthandsafetySat Nusa remains committed to achieving and maintaining applicable standards in health and safety practice. We work positively to create an open culture towards Health, Safety, and the Envi-ronment and to engage all employees in maintain-ing safety working environment.

EmployeedevelopmentandretentionSat Nusa aims to recruit the best talent, acting as equal opportunities employer at all times and en-suring that our staff remain safe from discrimina-tion and harassment in the workplace. We invest in the training and development of our staff to build the required skills to succeed as a business.

EnvironmentalandCommunityAwarenessSat Nusa complies with all relevant environmental laws and implements best environmental practice in all of its activities. We seek to recycle in all ar-eas – from office supplies to water consumption. We seek to be a valued member of the community and consult locally on the possible impact of our operations, as well as informing the community on the type of employment opportunities we bring to the local area.

Page 88: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 88

AsPEKKEsEhATAnHEALTH ASPECT

• Cooperate with PT Nusa Kekar Medical in provision of medical service for employee’s family (husband/wife with 3 children);

• Fogging program to eliminate mosquito;• Hold blood donation activities;• Contribute to Massive Circumcision activities.

• Bekerja sama dengan PT Nusa Kekar Medical untuk pelayanan medis bagi keluarga karyawan (suami / istri dengan 3 anak);

• Mengadakan program fogging untuk menghilangkan nyamuk;• Mengadakan kegiatan donor darah;• Memberi sumbangan untuk kegiatan sunatan massal.

Internally, the Integrated CSR Program seeks to cultivate a more responsible work culture in conducting the business, ultimately leading to sustainable business that will in turn obtain the desired economic benefits. Externally, the Integrated CSR Program is expected to construct and create sustainable properties by ensuring that all concerned parties constantly work towards achieving synergy in order to build a more prosperous and self-reliant society. To achieve these objectives, We have targeted the following aspects:

Secara internal, Program CSR Terpadu berusaha untuk menumbuhkan budaya kerja yang lebih bertang-gung jawab dalam melakukan bisnis, yang pada akhirnya mengarah kepada bisnis yang berkelanjutan yang akan mendatangkan manfaat ekonomi yang diinginkan. Secara eksternal, Program CSR Terpadu diharapkan dapat membangun dan menciptakan sifat berkelanjutan dengan memastikan bahwa semua pihak terus bekerja untuk mencapai sinergi dalam rangka membangun masyarakat yang lebih sejahtera dan mandiri. Untuk mencapai tujuan tersebut, Perseroan telah menargetkan aspek-aspek berikut:

CSR Strategy and PoliciesStrategi dan Kebijakan CSR

Page 89: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 89

AsPEKKETEnAgAKErJAAn

AsPEKPEngEmBAngAnmAsyArAKAT

AsPEKlingKUngAn

EMPLOYMENT ASPECT

COMMuNITY dEVELOPMENT ASPECT

ENVIRONMENTAL ASPECT

• Exempt employees from Jamsostek (Pension fund) and employee income tax for staff level and above;• Provide lunch meal with cheaper price (minimum 10 % lower than common price);• Facilitate employee’s recreation / outing activities;• Provide sport facility (gymnastic / fitness room) and facilitate sport tournament;• Provide dormitory for male and female employee;• Provide transportation facility for employees;• Provide car and housing facility for senior level and above.

• Provide food court in Company for the community with free rental, water and electricity cost; • Distribute sacrificial cows as part of Idul Adha celebration (every year);• Participated in the church charity bazaar (2011);• Funding and donation to Bengkulu disaster (2000), Mentawai Earthquake and Yogyakarta Volcano (2010);• Donation to Orphanage Foundation (2009, 2012).

• Efficiency on the use of supporting material;• Electricity efficiency program;• Power saving by using energy saver lamp (LED);• Reducing pollution and emissions through the use of electric forklifts and switching from gensets to PLN;• Water efficiency program;• Waste segregation and 3R Program (Reuse, Reduce and Recycle).

• Membebaskan karyawan dari pembayaran Jamsostek untuk program Jaminan Hari Tua dan pajak penghasilan karyawan untuk tingkat staf and keatas;

• Menyediakan makan siang dengan harga yang lebih murah (minimal 10% lebih rendah dari harga umum);

• Memfasilitasi kegiatan rekreasi / outing karyawan;• Menyediakan fasilitas olahraga (senam / ruang kebugaran) dan memfasilitasi turnamen olahraga;• Menyediakan asrama bagi karyawan pria dan wanita;• Menyediakan fasilitas antar jemput untuk karyawan ;• Menyediakan fasilitas mobil dan rumah dinas untuk level senior dan keatas.

• Menyediakan food court didalam perusahaan untuk masyarakat tanpa memungut biaya sewa, air, dan listrik;

• Penyerahan hewan kurban sebagai bagian dari perayaan Idul Adha (setiap tahun);• Berpartisipasi dalam bazaar amal gereja (2011);• Pendanaan dan sumbangan terhadap bencana Bengkulu (2000), Gempa Bumi Mentawai dan gunung

merapi Yogyakarta (2010);• Memberi donasi kepada Yayasan Panti Asuhan (2009, 2012).

• Penggunaan bahan penunjang yang lebih effisien;• Program penghematan listrik;• Menghemat daya dengan menggunakan lampu hemat energi (LED);• Mengurangi pencemaran emisi melalui penggunaan electric forklift serta perubahan penggunaan

genset ke PLN;• Program penghematan air;• Melakukan segregasi limbah dan Program 3R (Reuse, Reduce, dan Recycle).

Page 90: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 90

Perseroan bertujuan untuk menyediakan program Beasiswa bagi anak muda yang berbakat dan ber-prestasi dengan tujuan untuk memberikan bimbin-gan kepada mereka dalam menempuh jalan pen-didikan dan karir profesional yang tepat.

We aim to provide Scholarships program for talented and distinguished young people with the objective to provide them with guidance towards the right educa-tional and professional career path.

Memberi dukungan kepada masyarakat sekitar merupakan salah satu intisari dari keberadaan Perseroan. Bahkan alasan keberadaan Pers-eroan adalah untuk membuat perbedaan bagi ke-hidupan masyarakat sekitarnya. Perseroan akan terus memberikan sumbangan dalam berbagai bentuk kepada masyarakat di mana Perseroan beroperasi.

Supporting our communities is one of the core of what we do. In fact the very reason we exist is to make a difference to people’s lives. We will continue to give donation in many forms to the communities where we operate

Perseroan mengambil setiap langkah untuk me-nerapkan praktek-praktek lingkungan yang ino-vatif dan bertanggung jawab di perusahaan untuk mendukung kampanye Batam Go Green.

Perseroan menyadari bahwa operational Pers-eroan mungkin memiliki efek baik secara lang-sung maupun tidak langsung terhadap lingkun-gan lokal dan / atau regional di mana Perseraon beroperasi. Oleh karena itu Perseroan berusaha untuk mengurangi kerusakan terhadap lingkun-gan.

We’re taking every step we can to implement in-novative and responsible environmental practices across our company to support Batam Go Green Campaign.

We recognize that our work may have a direct or indirect effect on the local and/or regional environ-ments in which we operate. We therefore strive to reduce any harm to the environment.

Kebutuhan akan darah menjadi perhatian penting bagi masyarakat secara keseluruhan. Donor darah sangat penting untuk tidak hanya menyelamatkan kehidupan masyarakat tetapi juga untuk mencipta-kan lingkungan sosial yang lebih baik. Memberikan donor darah secara sukarela merupakan kontribusi sosial yang besar.

The need for blood is an important concern to the so-ciety as a whole. Blood donation is important for not only saving people’s lives but also for the pursuit of a better social and living environment, and voluntary blood donation is a great social contribution.

Program CSr 2013CSR PROGRAM FOR 2013

Page 91: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 91

Environmental management is intended to reduce the negative impacts of corporate activities on the envi-ronment and society and also to sustainably improve the performance of environmental management. As a manufacturing company, Sat Nusa is committed to implement 3R (Reduce, Reuse and Recycle) program as well as other initiatives to transform the business process within Sat Nusa to be more environmentally friendly. Improvement towards green standard is con-tinuously carried out by the Company.

Manajemen lingkungan dimaksudkan untuk men-gurangi dampak negatif dari kegiatan Perseroan pada lingkungan dan masyarakat serta menin-gkatkan kinerja pengelolaan lingkungan secara berkelanjutan. Sebagai perusahaan manufaktur, Sat Nusa berkomitmen untuk menerapkan pro-gram 3R (Reduce, Reuse dan Recycle) serta ber-inisiatif untuk mengubah proses bisnis Perseroan menjadi lebih ramah lingkungan. Perbaikan ter-hadap standar ramah lingkungan dilakukan oleh Perseroan secara terus menerus.

The environmental management activities of Sat Nusa are as follows :

Kegiatan pengelolaan lingkungan Sat Nusa seba-gai berikut:

EnvironmentalmeasurementAn environmental measurement, including measurement of air pollution, vehicle emissions and domestic waste water are routinely performed every 6 months. The measurements are made by certified third party and the results will be compared with the Standard for each parameter, which refers to:•Minister of Environmental Decree No.13/MENLH/3/1995 about control of Air Emission from Stationary Source•Minister of Environmental Decree No. 21/PERMENLH/12/2008 about control of Air Emission from Generator•Minister of Environmental Decree No.112/MNLH/7/2003 about Standard Quality of Domestic Waste Water

PengukuranlingkunganPengukuran lingkungan, meliputi pengukuran pencemaran udara, emisi kendaraan dan air limbah do-mestic rutin dilakukan 6 bulan sekali. Pengukuran dilakukan oleh pihak ketiga yang telah tersertifikasi dan hasilnya akan dibandingkan dengan Nilai Ambang Baku Mutu untuk masing-masing parameter, yaitu merujuk kepada :• Kep Men LH No.13 Tahun 1995 tentang Pengendalian Emisi Udara dari Sumber Tak Bergerak• Kep Men LH No. 21 Tahun 2008 tentang Pengendalian Emisi Udara Generator• Kep Men LH No. 112 Tahun 2003 tentang Baku Mutu Air Limbah Domestik

Kegi

atan

Man

ajem

en L

ingk

unga

n

Environmental Management Activities

Through regular assessment of our Environmental Management System, our efforts are directed towards continually minimizing any effects on the environment such as dust and noise emission as well as amount of waste produced.

melalui penilaian sistem manajemen lingkunganyangrutin,Perseroanterusmenerusberupayaun-tuk meminimalisasi dampak terhadap lingkunganseperti emisi udara dan kebisingan serta jumlahlimbahyangdihasilkan.

Page 92: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 92

workplacemeasurementWorkplace Measurement is done regularly once a year, covering the measurement of noise intensity, lighting and indoor air quality (dust levels, tin, lead, etc). Measuring workplace environment is aimed to ensure em-ployee health through healthy working environment.

This measurement is done by a certified third party and the results will be compared with the standard, which refer to:•Minister of Manpower Decree No. PER.13/MEN/X/2011 Threshold value of Chemical Content and Physical

Factor in the Workplace•Minister of Healthy No. KEP-1405/MENKES/SK/XI/2002 Occupational Environmental Health Requirements

Sat Nusa always ensures that the value of the measurement always meets the required Threshold Limit Value.

PengukuranlingkunganKerjaPengukuran Lingkungan Kerja dilakukan secara rutin setahun sekali, meliputi pengukuran kebisingan, intensitas pencahayaan dan kualitas udara dalam ruangan. Pengukuran lingkungan kerja ini bertujuan untuk menjamin kesehatan karyawan melalui lingkungan kerja yang sehat dan nyaman.

Pengukuran ini dilakukan oleh pihak ketiga yang telah tersertifikasi dan hasilnya dibandingkan dengan standar, yaitu merujuk kepada :• Kep Menaker No 13 Tahun 2011 tentang Nilai Ambang Batas Faktor Fisik dan Kimia di Tempat Kerja• Kep Menkes No 1405 Tahun 2002 tentang Persyaratan Kesehatan Lingkungan Kerja

Sat Nusa selalu memastikan bahwa nilai pengukuran lingkungan kerja ini selalu memenuhi Nilai Ambang Batas yang dipersyaratkan.

PengukuranAirminumSat Nusa juga melakukan test laboratorium rutin untuk instalasi air minum karyawan, meliputi parameter fisik, kimia dan mikrobi-ologi. Hal ini dilakukan untuk memastikan air minum karyawan sehat dan memenuhi baku mutu air minum yang dipersyaratkan oleh Pemerintah melalui Kep Men Kes No. 492 Tahun 2010 tentang Persyaratan Kualitas Air Minum

drinKingwATEr

worKPlACE

AirminUm

lingKUngAnKErJA

drinkingwatermeasurementSat Nusa also conducts routine laboratory test for drinking water, including physical pa-rameters, chemistry and microbiology. This is done to ensure that drinking water meets the quality standard required by the govern-ment through Health Minister Decree No. 492/MENKES/SK/IV/2010 on Drinking Water Qual-ity Requirements.

Page 93: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 93

Pengelolaanlimbahbahanberbahayadanberacun(B3)Sat Nusa melakukan pengelolaan terhadap limbah B3 yang dihasilkan perusahaan, meliputi tatacara pe-nyimpanan, pengumpulan, pengolahan dan dokumentasi limbah B3. Pengelolaan limbah B3 Sat Nusa mengacu pada standard peraturan yang dipersyaratkan, yaitu : • Peraturan Pemerintah No 18 Tahun 1999 Pengelolaan Limbah Bahan Berbahaya dan Beracun• Peraturan Menteri LH No. 03 Tahun 2008 Tata Cara Pemberian Simbol dan Label Bahan Berbahaya dan

Beracun• Keputusan Kepala Bapedal No: KEP-01/BAPEDAL/09/1995 Tata Cara Dan Persyaratan Teknis Penyim-

panan Dan Pengumpulan Limbah Bahan Berbahaya dan Beracun• Keputusan Kepala Bapedal No. KEP-02/Bapedal/09/1995 Dokumen Limbah B3• Keputusan Kepala Bapedal No. KEP-05/Bapedal/09/1996 Simbol dan Label Limbah Bahan Berbahaya

dan Beracun

Dalam pelaksanaan penyimpanan, Sat Nusa mempunyai 2 lokasi penyimpanan sementara limbah B3 yang telah mendapat ijin dari Badan Pengendalian Dampak Lingkungan (Bapedal) Kota Batam. Limbah B3 berupa sisa oli, sisa kemasan bahan kimia atau bahan terkontaminasi lainnya ditempatkan di Tempat Pe-nyimpanan Sementara (TPS) B3 maksimal selama 90 hari sebelum limbah tersebut diambil dan dikelola oleh pihak ketiga yang telah mempunyai ijin Pengelolaan Limbah B3 dengan pengawasan dan rekomen-dasi dari Bapedal Kota Batam.

managementofhazardousandtoxicwaste(B3)Sat Nusa carries out management of B3 waste produced by the company, including procedures for collection, storage, processing and documentation of B3 waste. Sat Nusa B3 waste management refers to the standard regulatory requirements, namely:• Government Regulation No. 18 Year 1999 Management of Hazardous and Toxic waste• Regulation of the Minister of Environment No. 03 of 2008 Procedures for Granting Symbols and Labels for

Hazardous and Toxic Substance• Decree of the Head Bapedal No: KEP-01/BAPEDAL/09/1995 Procedures and Technical Requirements for

Storage and Collection of Hazardous and Toxic• Decree of the Head Bapedal KEP-02/Bapedal/09/1995 Documention of B3 Waste• Decree of the Head Bapedal KEP-05/Bapedal/09/1996 Symbols and Labels for Hazardous and Toxic Sub-

stance

In the implementation of storage, Sat Nusa has 2 temporary storage locations for B3 waste which have obtained proper authorization from Batam Environmental Impact Management Agency (Bapedal) . B3 waste in the form of residual waste oil, waste packaging chemicals or other contaminated materials are placed in B3 Temporary Storage (TPS) maximum for 90 days before the waste is taken and managed by third parties that already have a B3 Waste Management permit with supervision and recommendation from Batam Bapedal.

hAzArdoUsAndToxiCwAsTEB3BAhAnBErBAhAyAdAnBErACUn

wA

sTE

Page 94: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 94

Sat Nusa sebagai badan usaha yang telah mempunyai sertifikasi Upaya Pengelolaan Lingkungan Hidup (UKL) dan Upaya Pemantauan Lingkun-gan Hidup (UPL), melalui surat keputusan Nomor 19/ UKL-UPL/Bape-dal/BTM/VII/2003, mengimplementasikan upaya pengelolaan dan pe-mantauan lingkungan hidup serta melakukan pelaporan rutin kegiatan pengelolaan dan pemantauan setiap 6 bulan sekali kepada Bapedal Kota Batam dan Kementrian Lingkungan Hidup. UKL/UPL ini diterapkan untuk mengawasi , mengurangi dan mengantisipasi kemungkinan dampak yang muncul bagi lingkungan dan masyarakat.

Sat Nusa turut serta dalam Program Penilaian Peringkat Kinerja Perusa-haan dalam Pengelolaan Lingkungan Hidup, yang disingkat PROPER yang merupakan salah satu upaya yang dilakukan oleh Kementerian Lingkun-gan Hidup (KLH) untuk mendorong penaatan perusahaan dalam pen-gelolaan lingkungan hidup. Dasar peraturannya adalah Keputusan Men-teri Negara Lingkungan Hidup Nomor 127 Tahun 2002 tentang Program Penilaian Peringkat Kinerja Perusahaan dalam Pengelolaan Lingkungan (PROPER). Dengan pelaksanaan PROPER, maka Sat Nusa akan diaudit oleh tim pengawas dari Kementrian Lingkungan Hidup untuk kegiatan pemantauan, pemeriksaan dan verifikasi teknis terhadap Pengendalian Pencemaran Air, Pengendalian Pencemaran Udara dan Pengelolaan Limbah Padat/Limbah Bahan Berbahaya dan Beracun (B3). Sejak tahun 2010, Sat Nusa telah mendapatkan penghargaan dari Kementrian Ling-kungan Hidup untuk PROPER dengan peringkat BIRU.

Sat Nusa participates in the Corporate Performance Rating Program in En-vironmental Management, abbreviated as PROPER, is an effort made by the Ministry of Environment (MoE) to improve company’s environmental manage-ment. Based on decree from Minister of Environment No. 127 of 2002 on Cor-porate Performance Rating Program in Environmental Management (PROP-ER). With the implementation of PROPER, Sat Nusa will be audited by a team of inspectors from the Ministry of Environment for the monitoring, inspection and technical verification of the Water Pollution Control, Air Pollution Con-trol and Solid / Hazardous and Toxic Waste (B3). Since 2010. Sat Nusa has received PROPER award from the Ministry of Environment with BLUE rating.

Sat Nusa as an entity that has obtained the certification of Environmental Management Effort (UKL) and En-vironmental Monitoring Effort (UPL), through decree No. 19 / UKL-UPL/Bapedal/BTM/VII/2003, implementing environmental management and monitoring effort as well as reporting management and monitoring routine activities every 6 months to Bapedal of Batam and Ministry of Environment. UKL/UPL is enforced to monitor, mitigate and anticipate the likelihood of impact that may occur to environment and society.

EnvironmentalmanagementEffort(UKl)EnvironmentalmonitoringEffort(UPl)UKL

UPAyAPEngElolAAnlingKUngAnhidUP

UPAyAPEmAnTAUAnlingKUngAnhidUP

UPL

PROPERProgrAmPEnilAiAnPEringKATKinErJAPErUsAhAAn

PERingkat BiRu BLuE Rating

CorPorATEPErformAnCErATingProgrAm

UNTUK USAHA DAN/ATAU KEGIATAN YANG TELAH MELAKSANAKAN UPAYA PENGENDALIAN PENCEMARAN DAN/ATAU KERUSAKAN LINGKUNGAN HIDUP DAN TELAH MENCAPAI HASIL YANG SESUAI DENGAN PERSYARATAN MINIMUM SEBAGAIMANA

DIATUR DALAM PERATURAN PERUNDANG-UNDANGAN YANG BERLAKU.

FOR THE BUSINESS AND/OR ACTIVITY THAT HAS UNDERTAKEN EFFORTS TO CONTROL POLLUTION AND/OR DAMAGE TO THE ENVIRONMENT AND HAS ACHIEVED GREAT RESULTS IN ACCORDANCE WITH THE MINIMUM REQUIREMENTS AS SET OUT IN

LEGISLATION AND REGULATIONS.

Page 95: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 95

Selama tahun 2012, Perseroan telah mengeluarkan biaya sebesar Rp 43.750.000 untuk kegia-tan yang berhubungan dengan pengukuran lingkungan. During 2012, the Company spent Rp 43,750,000 for activities associated with Environmental measurement.

Occupational Health, Safety and Environment Management System (OHSEMS) is an approach to create a safe, healthy and prosperous work environment, which is free from accidents, fires, explosions and environmental pollution caused by work assignments. As a company that manufactures and assembles electronics compo-nent into semi and/or finished goods through fully integrated suite of solution known as 4 in 1 integration, Sat Nusa’s operational activities are inextricably linked to aspects pertaining to Safety, Health and Environment. Sat Nusa consistently strives to create a safe and healthy working environment for its entire staff, vendors and third parties involved in its business undertakings. This commitment is made through a set of company policies on occupational safety and health.

Work safety and health of all employees becomes the main concern of a company. Every Sat Nusa’s employee has to follow policies and stipulations related to the work safety and health. Each employee must create and preserve cleanliness, safety, and comfort of physical work environment, as well as not to engage in such activi-ties that could disturb other employees’ works. To avoid lack of concentration from its employees, thus work environment should be free from all forms of pollution including noise, air or other pollutions.

In addressing various Safety, Health and Environment related issues within its operational scope, Sat Nusa at all times refers to rules and regulations set by the government, minister decree and other relevant institutions.

Sistem Manajemen Lingkungan, Keselamatan dan Kesehatan Kerja (SMLK3) merupakan suatu pendeka-tan untuk menciptakan lingkungan kerja yang aman, sehat dan sejahtera, yang bebas dari kecelakaan, kebakaran, ledakan, dan pencemaran lingkungan yang disebabkan oleh tugas kerja. Sebagai perusahaan yang memproduksi dan merakit komponen elektronik menjadi barang setengah dan/atau barang jadi mel-alui solusi layanan terpadu yang dikenal sebagai integrasi 4 in 1, kegiatan operasional Sat Nusa ini terkait erat dengan aspek yang berkaitan dengan Keselamatan, Kesehatan dan Lingkungan. Sat Nusa secara konsisten berupaya untuk menciptakan lingkungan kerja yang aman dan sehat bagi seluruh staf, vendor dan pihak ketiga yang terlibat dalam usaha bisnisnya. Komitmen ini dilakukan melalui serangkaian kebi-jakan perusahaan mengenai keselamatan dan kesehatan.

Keselamatan kerja dan kesehatan semua karyawan menjadi perhatian utama Perseroan. Setiap karyawan Perseroan wajib mengikuti kebijakan dan ketentuan yang berkaitan dengan keselamatan dan kesehatan kerja. Setiap karyawan harus memelihara dan menjaga kebersihan, keamanan, dan kenyamanan lingkun-gan kerja, serta tidak terlibat dalam kegiatan yang dapat mengganggu pekerjaan karyawan lainnya. Untuk menghindari berkurangnya konsentrasi karyawan, lingkungan kerja harus bebas dari segala bentuk po-lusi termasuk polusi suara, udara atau lainnya.

Dalam mengatasi berbagai masalah Keselamatan, Kesehatan dan Lingkungan kerja yang berterkaitan dengan lingkup operasional Perseroan, Sat Nusa senantiasa mengacu pada aturan dan peraturan yang ditetapkan oleh pemerintah, keputusan menteri dan instansi terkait lainnya.

Kesehatan dan Keselamatan Kerja (K3) serta Lingkungan

Occupational Health, Safety and Environment

sat nusa memiliki komitmen untuk menyediakanlingkungankerjayangamandansehatbagiseluruhpihakyangterlibatdalamkegiatanusahanya.Sat Nusa is committed to provide safe and healthy work environment for all parties involved in the Company’s business activities.

Page 96: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 96

Dalam setiap aktivitas operasionalnya, Sat Nusa senantiasa memperhatikan dan melaksanakan aspek yang berkaitan dengan K3 dan Lingkungan. Sepanjang tahun 2012, kegiatan K3 dan Lingkungan yang dilaksanakan meliputi:

• Pemenuhan dan penerapan peraturan Lingkungan, Keselamatan dan Kesehatan Kerja yang sesuai dengan proses bisnis perusahan

• Identifikasi bahaya, penilaian dan pengendalian resiko sebagai upaya pencegahan kecelakaan di setiap proses

• Penyediaan lingkungan kerja yang sehat dan aman untuk seluruh karyawan melalui inspeksi rutin dan monitoring lingkungan kerja

• Penyediaan Alat Perlindungan Diri (APD) beserta pengawasan pemakaiannya• Penyediaan dan pemeliharaan sarana emergency, yaitu APAR (Alat Pemadam Api Ringan), Hydrant

system, alarm kebakaran, perlengkapan P3K, lampu emergency dan pintu darurat• Pemasangan rambu berupa anjuran dan peringatan serta penyediaan informasi LK3 di area kerja• Pelaksanaan simulasi keadaan darurat kepada seluruh karyawan untuk meningkatkan kesadaran ter-

hadap kondisi kedaruratan• Peningkatan pengetahuan karyawan melalui pelaksanaan training bidang Lingkungan dan LK3 untuk

memastikan karyawan telah dibekali pengetahuan bekerja dengan aman• Pelaksanaan internal audit LK3 serta melakukan perbaikan temuan audit untuk memastikan keefekti-

fan pemenuhan kebijakan dan standar LK3• Peningkatan standar dan penerapan LK3 di perusahaan melalui perbaikan berkelanjutan

Sat Nusa lebih mengedepankan tindakan preventif dalam melaksanakan K3, melalui pencegahan ter-jadinya kecelakaan kerja dan membekali tenaga kerja dengan pengetahuan/konsep K3 sebelum memulai pekerjaan. Karyawan juga diwajibkan memakai peralatan safety sesuai dengan bidang tugasnya masing-masing.

In each of its operational activity, Sat Nusa always considers and implements aspects related to EOHS. In 2012, EOHS activities were:

• ComplyandapplyHSElegislationwhichapplicabletocompanybusinessprocess• Identifyhazardandriskassessmentfromouractivitiesandreducethemtothelowestpracticablelevelsas

a preventive actions of any accident• Providingahealthyenvironmentandasaferworkplaceforallemployeesthroughregularinspectionand

monitoring of the work environment• ProvidingPersonalProtectiveEquipment(PPE)alongwithusagemonitoring• Providingandmaintenanceofallemergencyequipment,i.e.fireextinguisher,Hydrantsystem,firealarms

system, first aid kits, emergency lighting and emergency exit• PlacementofadviceandwarningssignsaswellastheprovisionofHSEinformationintheworkarea• Conductsimulatedemergenciestoallemployeetoraisetheirawarenessintheemergencysituation• Improvementknowledgeofemployees throughHSE training toensureemployeesareequippedwith the

knowledge to carry out their work safely• Conductinternalaudits,andtakecorrectiveactionwhereappropriate,toensuretheeffectiveimplementa-

tion HSE policy and standard• ImprovingthestandardandimplementationofHSEthroughcontinuousimprovement Sat Nusa prioritizes preventive action in implementing OHS, through the prevention of work accident and pro-viding the knowledge/concept of OHS to the workers prior to initiating their job. Workers are also obliged to wear safety equipments in compliant with their own work sector.

Page 97: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 97

Selama tahun 2012, jumlah karyawan tetap yang berhenti atas permintaan sendiri sebanyak 156 orang atau rata rata 13 orang perbulan. Rata rata tingkat perpindahan karyawan selama tahun 2012 adalah 1.6% (rata-rata bulanan) dari rata-rata total karyawan tetap tahun 2012.

Sepanjang tahun 2012, telah terjadi sejumlah 35 kejadian yang berlangsung di pabrik Perseroan. Bentuk pertolongan pertama atas insiden kecelakaan tersebut adalah korban segera dibawa ke PT Nusa Kekar Medical untuk dilakukan tindakan Pertolongan Pertama Pada Kecelakaan (P3K). Adanya kecelakaan tersebut, tidak mengakibatkan terganggunya proses produksi sehingga tidak berdampak negatif pada keuangan Perseroan.

PEngUKUrAnTingKATKECElAKAAnKErJA ACCidEnTfrEqUEnCyrATE(Afr)Angka yg menunjukan jumlah korban kecelakaan per 1,000,000 jam kerja orang dengan rumus :

aFR = (jumlah korban kecelakaan dalam setahun /jumlah jam kerja orang dalam setahun) x 1,000,000

Figures show that the number of casualties per 1,000,000 man hours of work with the formula:

Afr = (number of casualties in a year / the number of man hour in a year) x 1,000,000

During the year 2012, the number of permanent employees who submitted resignation on their own accord were as many as 156 persons or an average of 13 persons per month. Average employee turnover rate for 2012 is 1.6% (monthly average) of the average total permanent employees in 2012.

Throughout the year 2012, there have been 35 cases that took place in the factory of the Company. First aid ac-tivities were immediately carried out for the victim of the accident by taking the victim to PT Nusa Kekar Medical to perform First Aid Medical Treatment (P3K). The occurance of the incidents, did not lead to disruption to the production process hence it did not negatively impact the financial of the Company.

Accident frequency rate (AFR) serves as health and safety performance indicators in Sat Nusa. In 2012, the AFR performance has improved by 5.92% from 3.71 in 2011 become 3.49 in 2012.

PengukuranTingkatKecelakaanKerja(Afr)berfungsisebagaiindikatorki-nerjakesehatandankeselamatanPerseroan.Padatahun2012,kinerjaAfrmengalamiperbaikansebesar5,92%dari3,71padatahun2011menjadi3,49padatahun2012.

EmPloyEETUrnoVErlEVElsAndACCidEnTrATEsTingKATPErPindAhAnKAryAwAndAnTingKATKECElAKAAn

afryear 2012

year 2012

year 2011

year 2011

3.49

35 4010.772.209 10.022.012 kecelakaan / c

asualties

kecelakaan / casualties

man hourman hour

3.71accident frequency rate

Page 98: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 98

Sat Nusa aktif melaksanakan Program Bina Lingkungan yang merupakan upaya pembinaan dengan men-yalurkan bantuan dana hibah kepada masyarakat wilayah sekitar pabrik Perseroan. Program Bina Ling-kungan diprioritaskan pada bantuan yang langsung dirasakan manfaatnya oleh masyarakat seperti ben-cana alam, pendidikan dan latihan, peningkatan kesehatan, prasarana dan sarana umum, sarana ibadah, pelestarian alam. Melalui program ini, diharapkan terjalin hubungan yang harmonis dengan masyarakat sekitar unit kerja Perseroan, sehingga Perseroan dapat mengoperasikan bisnisnya secara berkelanjutan, sedangkan kualitas sosial dan lingkungan masyarakat semakin meningkat.

Sat Nusa is actively performing the Environmental Development Program by providing grants to the community residing nearby the areas of factory. The Environmental Development Program is prioritized to grants most beneficial for the community such as natural disaster relief, education and training fund, health improvement, fund to build infrastructure and public faculties, religious facilities, and fund for nature preservation. Through this program, it is expected that there will be a harmonious relationship between the company and the com-munity residing around the company’s work units, so the company will be able to run its business sustainably while the community’s social and environmental quality is improved.

Sepanjang tahun 2012, bentuk kegiatan yang didanai melalui Program Bina Lingkungan meliputi: In 2012, the activities financed through the Environmental Development Program were:

soCiAlAndCommUniTydEVEloPmEnTPEngEmBAngAnsosiAldAnKEmAsyArAKATAn

NoPEnErimAsUmBAngAn

rECEiVingPArTyKETErAngAn

dEsCriPTionJUmlAh

AmoUnT

1 KodimBatamKodim Batam

renovasimusholaAlfirmanKodim0316/BatamRenovation of Al Firman mushola Kodim 0316/Batam

10,000,000

2 dewanPimpinanKelurahanKampungPelitaBoard of Pelita Kampung Administrative

PerbaikanlapanganvollydanturnamenvollyRepair of volly court and volly tournament

10,000,000

3 PKKKampungPelitaPKK Pelita Village

PaketsembakoanakyatimGroceries for orphans

5,000,000

4 dewanPimpinanKelurahanKampungPelitaBoard of Pelita Kampung Administrative

sunatanmassalMass circumcision

10,000,000

5 dewanPimpinanKelurahanKampungPelitaBoard of Pelita Kampung Administrative

PeringatanharikemerdekaanIndependence day

10,000,000

6 dewanPimpinanKelurahanPasarPelitaBoard of Pasar Pelita Administrative

PeringatanharikemerdekaanIndependence day

10,000,000

7 KodimBatamKodim Batam

PenyambutanharirayaidulfitriIdul Fitri celebration

10,000,000

8 masyarakatPelitaPelita community

longsorakibatpembangunangitawisataLandslides due Gita tourism development

60,000,000

9 PanitiareunisambuSambu Reunion Committee

reunisambu&BelakangPadangReunion of Sambu & Belakang Padang

7,500,000

10 masjidAlhidayah,Alfajar,rwPelitaPasarAl Hidayah Mosque, Al Fajr, RW Pelita Market

hewankurbandalamperayaanharirayahajiSacrificial animal for celebration of Hari Raya Haji

33,000,000

11 PantianatalgPiimpactCommunityGPI Impact Community Christmas Committee

iklandalambukuagendanatal2012Advertisement in agenda book for 2012 Christmas

20,000,000

12 BatamPosgroupBatam Pos Group

Acaraturnamenfutsaltingkatsdse-kotaBatamFutsal tournament for Elementary schools in Batam

20,000,000

13 satuanBrimobPoldaKepriBrimob Polda Kepri

KegiatanhUTBrimob2012Brimob Anniversary in 2012

8,000,000

14 BPBatamBP Batam

lombaAnimasise-KEPriAnimation Competition in KEPRI

2,000,000

15 PanitianatalKementerianKeuanganMinistry of Finance Christmas Committee

Perayaannatal2012Christmas Celebration

2,000,000

tOtaL 217,500,000

Page 99: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 99

ProtectionforEmployment,occupationalhealthandsafetyPerlindunganuntukPekerjaan,KesehatandanKeselamatanKerja

Manajemen Sat Nusa menghormati dan mengakui hak hak pribadi karyawan, tidak melakukan dis-kriminasi atas dasar apapun dan memberikan kesempatan yang sama kepada seluruh karyawan untuk berkembang dan memberikan yang terbaik bagi perusahaan.

Hak dan kewajiban karyawan dijamin oleh Perseroan yang dituangkan dalam Perjanjian Kerja Bersama (PKB).Perseroan selalu berupaya menjaga dan menciptakan iklim kerja yang kondusif bagi karyawan. Sat Nusa berkewajiban melaksanakan praktek Keselamatan dan Kesehatan Kerja (K3) di seluruh unit kerjanya dan menjamin hak karyawan untuk mendapatkan perlindungan atas keselamatan, kesehatan, pemeliharaan moral kerja, serta perlakuan yang sesuai dengan martabat, moral dan ketentuan yang ber-laku.

The management of Sat Nusa respects and acknowledges the personal rights of its employees, does not per-form any discrimination on any aspect and provides the same opportunity to each employee to develop and to give the best for the company.

The rights and obligations of the employees are guaranteed by the Company and stated in the Collective Labor Agreement (CLA). The Company is always trying to maintain and create conducive work climate for its employ-ees.

Sat Nusa is obliged to perform Occupational Health and Safety (OHS) in every work unit and guarantee the rights of its employees to receive protection on safety, health, work moral maintenance, and proper treatment in compliant with the prevailing values, morality and provisions.

Page 100: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 100

skemaperlindungankaryawanataskesehatan,kecelakaankerjasertaharituakaryawandiwujudkandenganJamsostekmelaluiprogram:

1. JaminanKecelakaanKerja(JKK) Jaminan Kecelakaan Kerja (JKK) memberikan kompensasi dan rehabilitasi bagi tenaga kerja yang mengalami kecelakaan pada saat mulai berangkat bekerja sampai tiba kembali dirumah atau men-derita penyakit akibat hubungan kerja.

2. JaminanKematian(JK) Jaminan Kematian diperuntukkan bagi ahli waris dari peserta program Jamsostek yang meninggal bukan karena kecelakaan kerja. Jaminan Kematian diperlukan sebagai upaya meringankan beban keluarga baik dalam bentuk biaya pemakaman maupun santunan berupa uang.

3. JaminanhariTua(JhT) Program Jaminan Hari Tua ditujukan sebagai pengganti terputusnya penghasilan tenaga kerja karena meninggal, cacat, atau hari tua dan diselenggarakan dengan sistem tabungan hari tua. Program Ja-minan Hari Tua memberikan kepastian penerimaan penghasilan yang dibayarkan pada saat tenaga kerja mencapai usia 55 tahun atau telah memenuhi persyaratan tertentu.

Selain dari pada itu, Perseroan juga bekerja sama dengan PT Nusa Kekar Medical dalam memberikan lay-anan kesehatan kepada seluruh karyawan perseroan. Ini merupakan Salah satu program Perseroan yang bertujuan untuk membantu tenaga kerja dan keluarganya dalam mengatasi masalah kesehatan. Mulai dari pencegahan, pelayanan di klinik kesehatan, perujukan rumah sakit dan pengobatan.

Employeeprotectionschemesforhealth,accidentandpensionthroughsocialsecurityprogram:

1. workAccidentinsurance(JKK) Work Accident Insurance (JKK) provides compensation and rehabilitation for workers injured from the time they depart to work until arriving back home or sickness due to working relationships.

2. deathinssurance(JK) Death Insurance is for the beneficiaries of the Social Security program participants whose death is not due to an accident. Death insurance is needed to ease the burden on families in the form of funeral expenses as well as compensation in the form of cash.

3. Pensionfund(JhT) Pension Fund Program acts as a substitute for a discontinued labor income due to death, disability, or retirement and organized through retirement saving system. Pension Fund program provides certainty in income and paid at the time of labor reaches the age of 55 or have met certain requirements.

Apart from that, Sat Nusa also engages PT Nusa Kekar Medical to provide health services to all the employees. This is part of our program that aims to help all the employees and their families in dealing with health prob-lems. Ranging from prevention, medication in clinics, referral hospitals and treatment.

Page 101: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 101

Page 102: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 102

Reduce•Reuse•RecycleThe “3R” concept is becoming ever more important in all phases of product lifecycles, from development and production to use and final disposal. Sat Nusa sets “promoting recycling and the effective use of limited resources” as a goal and has undertaken various initiatives to meet it.

Konsep “3R” ini menjadi semakin penting dalam semua fase dan siklus sebuah produk, dari pengembangan dan proses produksi sampai dengan penggunaan dan pembuangan akhir. Sat Nusa menjadikan “mempromosi-kan budaya daur ulang dan penggunaan sumber daya yang terbatas dengan efektif“sebagai gol dan telah melakukan berbagai inisiatif untuk mencapai tujuan tersebut.

Page 103: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 103

Reduce•Reuse•Recycle

Policies to implement the 3R (Reduce, Reuse, Recycle) program as well as other initiatives to transform the entire business process within Sat Nusa Group to be more environmentally friendly continued to be pursued intensively.

Reduce, Reuse and Recycle were created to establish a hierarchy of waste management practices for individu-als and businesses.

reduction is the first and most important step in the hierarchy. This step includes taking a proactive stance in purchasing and using only what is necessary. The idea is to be conscientious of one’s supply stream and waste management practices in order to minimize the use of raw materials.

reuse, the step following reduction, focuses on finding an alternative use for materials that would otherwise be considered waste and ultimately disposed of. Ideally the goal is to eliminate waste completely.

recycling, the final step in the traditional hierarchy emphasizes on properly separating and distributing those materials that cannot be reduced or reused, to the appropriate facilities so the items can be applied to the creation or production of new products and goods.

Kebijakan untuk melaksanakan program 3R (Reduce, Reuse, Recycle) serta kebijakan lain dalam melaku-kan perubahan pada seluruh proses bisnis Sat Nusa Group agar menjadi lebih ramah lingkungan terus diupayakan secara intensif.

Reduce, Reuse dan Recycle diciptakan untuk menetapkan hirarki praktik pengelolaan limbah baik pada tingkat individu maupun bisnis.

Pengurangan (reduce) adalah langkah pertama dan paling penting dalam hirarki. Langkah ini termasuk mengambil sikap proaktif dalam membeli dan menggunakan apa yang diperlukan saja. Gagasan tersebut bertujuan untuk menjadi lebih teliti dalam aliran pasokan dan praktik pengelolaan limbah untuk memini-malisasi penggunaan bahan baku.

Penggunaan ulang (reuse), adalah langkah berikut dari pengurangan, berfokus pada pencarian peng-gunaan alternatif bagi bahan yang akan dianggap sampah dan dibuang. Tujuan idealnya adalah untuk menghilangkan limbah sama sekali.

Daur ulang (recycle), adalah langkah terakhir dalam hirarki tradisional yang menekankan pada pemisa-han dan pendistribusian yang benar terhadap bahan-bahan yang tidak dapat dikurangi atau digunakan kembali, ke fasilitas yang sesuai sehingga bahan-bahan tersebut dapat digunakan untuk menciptakan atau memproduksi barang atau produk baru.

Page 104: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 104

ProdUCTrEsPonsiBiliTy

CUsTomEr’shEAlThAndsAfETy

ProdUCTinformATion

TAnggUngJAwABProdUK

KEsEhATAndAnKEsElAmATAnKonsUmEn

informAsiProdUK

Sat Nusa telah memiliki bagian Quality Assurance dan Pengelolaan Sistem Pengendalian Mutu untuk menangani pengendalian mutu produksi. Proses perakitan komponen sampai dengan perakitan produk jadi, dilakukan dengan selalu mengikuti Standard Operational Procedure sehingga tidak membahayakan kesehatan dan keselamatan konsumen dan karyawan.

Sat Nusa berupaya untuk menaati aturan kelayakan produk yang dijual, sehingga tidak pernah mengha-dapi adanya tuntutan pelanggaran peraturan atau kode etik penjualan produk. Selama 2012, tidak terdapat adanya pelanggaran peraturan perundangan-undangan maupun ketentuan lain yang terkait dengan kese-hatan dan keselamatan konsumen atas penggunaan produk elektronik yang dihasilkan. Dengan demikian, tidak terdapat dampak keuangan yang ditimbulkannya.

Produk yang dihasilkan Sat Nusa meliputi produk plastik, produk logam, produk elektronik setengah jadi dan produk jadi.

surface-mountTechnology(smT) – Teknologi cang-gih Perseroan dalam menyusun komponen-kom-ponen elektronik (seperti resistor, kapasitor, dioda, transistor, IC, dsb) secara langsung pada permukaan PCBs (Printed Circuit Boards), yang dilakukan oleh robot kits secara teratur, rapi, dan teliti. Teknologi ini meliputi Chip-Scale Packaging (CSP), Micro-Ball Grid Array (BGA), High Pin-Count QFN, Fine-Pitch De-vices, Odd-Shaped Component Attach, dan ESD Class 2A dan 3A Certified Production Lines.

Plastic injection – Kemampuan Perseroan untuk merancang produk berbasis 2D/3D CAD untuk kom-ponen plastik dan tooling baru, jasa prove-in kom-ponen baru dan seleksi material termoplastik, jasa high stroke count injection dan insert molding, serta layanan proses sekunder.

Precisionmetalstamping – Secara mandiri, Pers-eroan mampu melakukan fabrikasi peralatan mulai dari 30 hingga 50 mikron, pencetakan komponen dan tooling baru, prove-in komponen baru, die stamp metals hingga ketebalan 3 mm, serta precise stamping hingga tekanan progresif 300 ton.

Products produced by Sat Nusa include plastic products, metal products, semi-finished electronic products and finished products.

surface mount Technology (smT) – Company’s high technology in constructing electronic compo-nents (such as resistors, capasitors, diodes, tran-sistors, IC, etc.) on PCBs (Printed Circuit Boards) di-rectly, which is conducted by robot kits in organized, proper, and accurate manners. This technology includes Chip-Scale Packaging (CSP), Micro-Ball Grid Array (BGA), High Pin-Count QFN, Fine-Pitch Devices, Odd-Shaped Component Attach, and ESD Class 2A and 3A Certified Production Lines.

Plasticinjection – Company’s in-house 2D/3D CAD design capability for plastic parts and new tool-ing, new part prove-in and thermoplastic material selection services, high stroke count injection and insert molding services, and secondary process services.

Precisionmetalstamping – On its own, the Com-pany capable to carry out tool fabrication from 30 to 50 micron, stamped parts and new tooling, new part prove-in, die stamp metals up to 3 mm thick-ness, and 300 ton progressive presses for precise stamping.

Sat Nusa has formed the Department of Quality Assurance and Quality Control Management System to control the quality of the products. The stages in mounting the components until final assembly, are always carried out pursuant to the Standard Operational Procedure so it will not endanger the health and the safety of customers and workers.

Sat Nusa makes serious efforts to obey the regulation on product feasibility, so that it never faces any lawsuit for product sales regulation or code of conduct violation. In 2012, there was no violation to the laws and regula-tions or other stipulations related to customers’ health and safety on usege of electronic products produced. Therefore, there was no financial impact emerged.

Page 105: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 105

PrintedCircuitBoardAssembly (PCBA)danCom-pletesetAssembly – Kemampuan Perseroan untuk melakukan wave soldering multi layer boards, lead free processes, selective soldering, serta built to or-der dan configure to order pada ESD Class 2A dan 3A Certified Production Lines.

logistik – Perseroan menyediakan layanan logis-tik global dan solusi rantai suplai, yang mencakup freight forwarding dan manajemen pergudangan atau penyimpanan bahan baku atau pun barang jadi, yang ditawarkan Perseroan melalui berbagai pro-gram pengiriman tepat waktu dan fleksibel mela-lui jalur udara, laut, atau darat sesuai dengan per-mintaan para pelanggan.

Mengingat karakteristik industrinya, Sat Nusa tidak membentuk Pusat Pengaduan Pelanggan. Meski-pun demikian, setiap pelanggan terjamin hak dan perlindungannya melalui kontrak kerja.

Sat Nusa selalu mengutamakan prinsip keter-bukaan dan kejujuran dalam melakukan setiap transaksi dengan pelanggan. Perseroan berupaya memberikan tanggapan yang cepat apabila ada pen-gaduan dan ketidakpuasan dari pelanggan. Layanan pengaduan kepada Perseroan dapat disampaikan melalui telepon, surat, email atau tatap muka lang-sung ke bagian terkait.

Printed Circuit Board Assembly (PCBA) andComplete set Assembly – Company’s ability to perform wave soldering multi layer boards, lead free processes, selective soldering, and built to or-der and configure to order on ESD Class 2A and 3A Certified Production Lines.

logistics – The Company provides global logis-tics services and supply chain solutions, including freight forwarding and material and/or finished products warehousing or inventory management, which are offered with various just-in-time products delivery programs and flexibility via air, sea or land depending on customers’ requirements.

Considering its industrial characteristics, Sat Nusa does not establish any Customer Complaint Cent-er. However, customer’s rights and protection are guaranteed by the contract.

Sat Nusa always prioritizes openness and honesty in every transaction with its customer. Company tries to give fast respond upon any complaint and dissatisfaction from the customer. Complaint to the Company can be expressed by phone, mail, email or face to face meeting to the relevant division.

ACCommodATingCUsTomEr’sComPlAinTAndClAimPElAyAnAnPEngAdUAndAnKlAimPElAnggAn

Page 106: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 106

SHAREHOLDERS COMPOSITION

2012

abidin | Direktur Utama | President Director 1,177,500,000 (66.47%)Pt trimEgah sEcuritiEs tbk| Masyarakat | Public 390,928,000 (22.07%)masyarakat lainnya | Other Public * 140,460,000 (7.93%) Bidin yusuf | Direktur | Director 62,560,000 (3.53%)

1,771,448,000 (100%)

KOMPOSISI PEMEGANG SAHAM

* Pemegang saham masyarakat lainnya terdiri dari pemegang saham dengan kepemilikan < 5%.* Other Public shareholders consist of shareholders with ownership < 5%.

MASYARAKAT | PUBLIC

Per 31 Desember 2012, komposisi kepemilikan saham Perseroan adalah sebagai berikut: Shareholder Composition As per December 31st, 2012, the Company’s shareholder composition is as stated below:

Komposisi masyarakat berdasarkan kelompok | Public composition based on group

Komposisi masyarakat berdasarkan status kewarganegaraan | Public composition based on nationality

73.63%

97.46% 2.54%

0.01% 23.77%

100%

2.36% 0.19% 0.05%Makelar

broker

391,237,000

517,866,758 saham/share 13,521,242 saham/share

51,500 126,328,258

531,388,000 (saham / share)

12,521,242 1,000,000 250,000

dana PensiunPension fund

individu doMestikINDIVIDUAL - DOMESTIC

individu asingINDIVIDUAL - FOREIGN

institusi doMestikINSTITUTION - DOMESTIC

institusi asingINSTITUTION - FOREIGN

loKal | domestic asing | foreign

Page 107: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 107

99.96%

66.47%22.07%

3.53%7.93%

(entitas anak/subsidiary)

(individu/ individual)

(individu/ individual) (individu/ individual)

0.04%

Ptsn

abidin Pt triMegah securities tbk

bidin yusufPublic

PtsMe

kenny

Pada tanggal 21 Agustus 2007, melalui Surat Pengantar Pernyataan Pendaftaran No. 755/SK/SNP/VIII/07, Perseroan telah menawarkan sahamnya kepada masyarakat melalui pasar modal sejumlah 531.388.000 saham dengan nilai nominal Rp 150 per saham dengan harga penawaran Rp 580 per saham. Pada tang-gal 26 Oktober 2007, berdasarkan Surat Ketua Badan Pengawas Pasar Modal dan Lembaga Keuangan (Bapepam LK) No. S-5364/BL/2007, Perseroan telah memperoleh Surat Pemberitahuan Efektif Perny-ataan Penawaran. Selisih lebih jumlah yang diterima dari pengeluaran saham terhadap nilai nominalnya sebesar Rp 228.496.840.000 dicatat dalam akun Tambahan Modal Disetor setelah dikurangi biaya emisi saham sebesar Rp 11.267.261.167. Saham Perseroan dicatatkan di Bursa Efek Indonesia pada tanggal 8 November 2007 dengan kode transaksi perdagangan ”PTSN”. On August 21, 2007, through Registration Statement Letter No. 755/SK/SNP/ VIII/07, the Company conducted the initial public offering of its 531,388,000 shares at a par value of Rp 150 per share with an offering price of Rp 580 per share through the capital market. On October 26, 2007, based on Letter No. S-5364/BL/2007 from the Chairman of Capital Market Financial Institution Supervisory Board (Bapepam-LK), the Company’s Statement Registration became effective. The excess amount received from the stock issuance over its nominal value amounting to Rp 228,496,840,000 is recorded in the Additional Paid-in Capital account, after being deducted by the stock issuance cost of Rp 11,267,261,167. The Company was listed as “PTSN” on the Indonesia Stock Ex-change on 8 November 2007.

K R O N O L O G I S P E N C A TA TA N S A H A M

CHRONOLOGy OF STOCK LISTING

INfORMASI MENGENAI PEMEGANG SAHAM UTAMAINfORMATION ON MAJOR SHAREHOLDERS

Page 108: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 108

LAPORAN TATA KeLOLA PeRUSAHAAN

CORPORATe GOveRNANCe RePORT

Page 109: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 109

Peran aktif dan dukungan penuh dewan komisaris dan direksi sangat penting dalam memastikan penerapan prinsip tata kelola perusahaan yang baik, yang terdiri dari transparansi, akuntabilitas, pertanggung-jawaban, kemandirian, serta keadilan pada setiap aspek bisnis dan di seluruh jajaran Perusahaan.

active roles and full support from the board of commissioners and directors are important in ensuring the implementation of good corporate governance principles, which include transpar-ency, accountability, responsibility, independency as well as fairness in every aspect of business and within the company.

Sat Nusa menitikberatkan pelaksanaan Good Corporate Governance (GCG) sebagai cara bagaimana mengelola perusahaan dengan baik, profesional, mengadopsi standar internasional dan praktik terbaik, berorientasi pada profitabilitas, pertumbuhan, keberlanjutan bisnis dan kesejahteraan pemegang saham tanpa mengabai-kan pemangku kepentingan lainnya.

Sat Nusa sepenuhnya mengetengahkan bahwa pen-erapan Tata Kelola Perusahaan yang baik merupakan aset, bukan hanya sebuah kewajiban bagi Perusahaan dalam memenuhi peraturan dan ketentuan. Sat Nusa sangat yakin bahwa fondasi yang kuat dari tata kelola perusahaan berfungsi untuk melindungi kepentingan semua pemangku kepentingan, serta meneguhkan ke-percayaan mereka terhadap Perusahaan. Hal tersebut juga merupakan kunci dari pertumbuhan Perusahaan untuk meraih kesuksesan yang berkelanjutan.

Direksi dan Manajemen Perseroan telah mengem-bangkan kerangka tata kelola yang dibangun di atas rekomendasi dari Pedoman Tata Kelola Perusahaan (“Kode”), namun dalam pelaksanaannya tata kelola perusahaan bukan hanya sekedar kepatuhan terhadap peraturan dasar, tetapi Perseroan juga telah menganut semangat Kode, berlabuh pada prinsip-prinsip kunci dari transparansi perusahaan, akuntabilitas, tanggung jawab, Independensi dan keadilan.

Sat Nusa signifies the implementation of Good Corporate Governance (GCG) as a matter of how to manage the company properly, professionally, adopting best international standards and practic-es, self-oriented to profitability, growth, business sustainability and shareholders’ prosperity without abandoning other stakeholders’ interests.

Sat Nusa fully ascertains that implementation of Good Corporate Governance is an assets, not just a liability to the company in fulfilling rules and regulations. Sat Nusa firmly believes that a strong foundation of good corporate governance serves to protect the interest of all stakeholders, as well as strengthen their confidence in the company. It is also key to the growth of the Company to achieve sustained success.

Directors and Management of the Company have developed a framework of governance built upon the recommendations of the Code of Corporate Governance (“Code”). However, the implementa-tion of good corporate governance is not just a basic regulatory compliance, Company has em-braced the spirit of the Code, anchored on key prin-ciples of corporate transparency, accountability, responsibility, Independency and Fairness.

TUjUAN PENERAPAN GCG

GCG OBJECTIVES

Page 110: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 110

Mengingat pentingnya penerapan GCG, Dewan Komisaris dan Direksi Sat Nusa telah membuat GCG ba-gian dari kebijakan manajemen Perseroan melalui penerapan suatu sistem yang merupakan prinsip-prinsip keterbukaan informasi, akuntabilitas, pertanggungjawaban, Kemandirian, dan Keadilan.

TranSparanSiTransparansi adalah keterbukaan dalam proses pengambilan keputusan dan penyampaian informasi yang relevan tentang Sat Nusa kepada stakeholder. Perusahaan menjamin keakuratan informasi menge-nai kinerja operasional dan keuangan, manajemen dan kepemilikan saham Sat Nusa, atau informasi lain yang dianggap penting.

akUnTabiliTaSPrinsip akuntabilitas pada dasarnya adalah pelaksanaan tugas, tanggung jawab dan hak setiap entitas anak melalui pembagian wewenang yang jelas untuk mengurangi dampak dari masalah keagenan yang terjadi sebagai hasil dari konflik kepentingan antara manajemen, pemegang saham, dan stakeholders.

Sat Nusa menerapkan prinsip akuntabilitas melalui beberapa cara, seperti evaluasi presentasi kinerja operasional dan keuangan, laporan keuangan dalam RUPS tahunan, Public Ekspose, audit internal dan eksternal.

TanggUng jaWabPrinsip tanggung jawab merupakan kompatibilitas antara manajemen Perusahaan dan hukum yang ber-laku, bersama dengan prinsip korporasi yang baik. Untuk itu, Sat Nusa memastikan bahwa manajemen Perusahaan mematuhi aturan hukum dan perundang-undangan yang berlaku sebagai cerminan tang-gung jawab perusahaan sebagai warga korporasi yang baik.

Sat Nusa selalu akan berusaha untuk membangun kemitraan dengan semua stakeholder dengan men-gacu pada aturan hukum dan etika bisnis yang sehat.

kemanDirianPrinsip kemandirian adalah suatu keadaan dimana perusahaan dijalankan secara profesional tanpa ben-turan kepentingan dan tekanan dari pihak manapun yang tidak sesuai dengan peraturan dan etika peru-sahaan yang baik. Sat Nusa menginginkan untuk menghindari dominasi dari pihak manapun yang tidak sehat dan menghindari konflik kepentingan.

Dewan Komisaris dan Direksi Sat Nusa memiliki perspektif yang independen dalam setiap keputusan yang dibuat, namun saran dari konsultan independen, konsultan hukum, dan komite akan dijadikan se-bagai bahan pertimbangan.

keaDilanPrinsip keadilan berarti keadilan dan kesetaraan dalam memenuhi hak-hak stakeholder yang terjadi sebagai konsekuensi dari memiliki kesepakatan dan aturan hukum yang berlaku. Sat Nusa menjamin perlakuan yang adil dan sama bagi setiap pemangku kepentingan dalam menjalankan aktivitasnya dan akan selalu berusaha untuk membuat para pemangku kepentingan memahami sepenuhnya hak dan ke-wajibannya di bawah aturan hukum.

PrinsiP dasar gcggood corPorate governance PrinciPles

Page 111: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 111

Considering the importance of implementing GCG, Sat Nusa’s Board of Commissioners and Board of Direc-tors have made GCG a part of the Company’s management policy through the implementation of a system that represents principles of information transparency, accountability, responsibility, Independency, and Fairness.

TranSparenCyTransparency is the openness in the process of decision-making and forwarding relevant information about Sat Nusa to stakeholders. The Company guarantees the information accuracy regarding the operational and financial performances, management and share ownership in Sat Nusa, or any other information considered important.

aCCoUnTabiliTyThe principle of accountability is basically the execution of duties, responsibilities, and rights of every subsidi-ary through a clear division of authority to reduce the impacts of agency problem that occurs as the result of conflicting interests among the management, shareholders, and the stakeholders.

Sat Nusa implements the principle of accountability through several ways, such as operational and financial performance evaluation, financial report presentation in the annual GMS, Public Expose, internal and external audit.

reSponSibiliTyThe principle of responsibility represents the compatibility between company management and the laws in force, along with good corporation principles. For that matter, Sat Nusa ensures that the company manage-ment adheres to the rule of law and legislation in force as the reflection of company’s responsibility as a good corporate citizen.

Sat Nusa will always seek to establish partnership with every stakeholder by referring to the rule of law and healthy business ethics.

inDepenDenCeThe principle of independence is a state where a company is governed professionally without any conflict of interest and pressure from any party that does not comply with the regulation and good corporate ethics. Sat Nusa is aspired to avoid unhealthy domination by any party and have no conflict of interest.

The Board of Commissioners and The Board of Directors of Sat Nusa have independent perspectives in every decision made. However, taking suggestions from an independent consultant, legal consultant, and their com-mittees is also an option.

fairneSSThe principle of fairness means justice and equality in fulfilling the stakeholders’ rights that occur as the con-sequence of having an agreement and the rule of law in force. Sat Nusa guarantees just and equal treatment for every stakeholder in carrying out his activity and will always strive to make stakeholders fully comprehend their rights and responsibilities under the rule of law.

PrinsiP dasar gcggood corPorate governance PrinciPles

Page 112: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 112

Struktur GCG Sat Nusa terdiri dari Rapat Umum Pemegang Saham (RUPS), Dewan Komisaris dan Direksi. Selain itu, Sat Nusa juga membentuk organ pendukung yang meliputi komite di bawah Dewan Komisaris, Sekretaris Perusahaan dan Internal Au-dit.

raPat umum PEmEgang saham (ruPs)

Rapat Umum Pemegang Saham (RUPS) memiliki wewenang yang tidak diberikan kepada baik Direk-si maupun Dewan Komisaris. RUPS memiliki ke-wenangan untuk menetapkan dan memberhentikan anggota Dewan Komisaris dan Direksi, mengevalu-asi kinerja mereka, menyetujui Anggaran Dasar, memberikan persetujuan untuk anggaran tahu-nan, mengatur alokasi penggunaan laba, menunjuk akuntan publik dan memutuskan jumlah dan jenis kompensasi kepada Dewan Komisaris dan Direksi.

RUPS tahun 2012 telah memberitahu dan mengirim-kan undangan kepada para pemegang saham sesuai dengan peraturan. Sepanjang 2012, Sat Nusa telah mengadakan 1 (satu) kali Rapat Umum Pemegang Saham dan yang terdiri dari 5 (lima) agenda.

The GCG structure of Sat Nusa consists of General Meeting of Shareholders (GMS), Board of Commis-sioners and Board of Directors. In addition, Sat Nusa also forms a supporting organ which includes com-mittees under the Board of Commissioners, Corpo-rate Secretary and Internal Audit.

gEnEral mEEting of sharEhold-Ers (gms)

General Meeting of Shareholders (GMS) has the au-thority that is not given to both Board of Directors and Board of Commissioners. GMS has the author-ity to assign and dismiss members of the Board of Commissioners and Board of Directors, evaluate their performance, approve the Basic budget, give approval to the annual budget, set the profit usage allocation, appoint a public accountant and decide on the amount and kinds of compensations to the Board of Commissioners and Board of Directors.

The GMS in 2012 had informed and sent out invitations to shareholders according to regulation. Throughout 2012, Sat Nusa had had 1 (one) General Meetings of Shareholders and consist of 5 (lima) agendas.

StRUKtUR GCGGOOD CORPORATE GOVERNANCE STRUCTURE

RUPS LUAR BIASAEXTRAORDINARY GMSRapat Umum Pemegang Saham Luar Biasa dapat diadakan kapan saja dalam setahun jika diperlukan. Pada tahun 2012, tidak ada RUPS luar biasa yang diselenggarakan.

Extraordinary General Meeting of Shareholders can be held anytime during the year if neces-sary. In 2012, there were no extraordinary GMS being held.

Page 113: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 113

PENYEBARAN iNfORMASi TERKAiT DENGAN RAPAT UMUM PEMEGANG SAhAMINFORMATION DISSEMINATION RELATED TO THE GENERAL MEETINGS OF SHAREHOLDERS

PEmBEritahuan ruPsANNOUNCEMENT OF GMS

Panggilan kEPada PEmEgang saham untuk ruPs

INVITATION TO GENERAL MEETING OF SHAREHOLDERS

PEmBEritahuan hasil ruPsANNOUNCEMENT OF GMS’ RESULTS

25 May 2012

11 June 2012

28 June 2012

MEDiA | MEDiATANGGAL | DATEAKTiViTAS | ACTiViTY

INVE

STO

R D

AIL

YH

ALU

AN

KEP

RI

Page 114: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 114

1. agEnda PErtama:• Menerima dan menyetujui Laporan Tahunan Perseroan yang telah disampaikan oleh Direksi peri-

hal keadaan dan jalannya Perseroan untuk tahun buku yang berakhir pada tanggal 31-12-2011 sebagaimana termaktub dalam buku “Laporan Tahunan 2011”;

• Menyetujui dan mengesahkan Laporan Keuangan Perseroan yang memuat Laporan Posisi Keuangan Konsolidasi, Laporan Laba Rugi Komprehensif Konsolidasi, Laporan Perubahan Ekui-tas Konsolidasi dan Laporan Arus Kas Konsolidasi untuk tahun buku yang berakhir pada tang-gal 31-12-2011 beserta penjelasannya, yang telah diaudit oleh “Kantor Akuntan Publik Johan Malonda Mustika & Rekan” sebagaimana ternyata dalam laporan auditnya nomor 12151-B1B/JMM2.FH3, tanggal 05-03-2012, dengan pendapat wajar tanpa pengecualian;

• Memberikan pelunasan dan pembebasan tanggung jawab sepenuhnya (volledig acquit et decharge) kepada para anggota Direksi Perseroan atas tanggung jawab pengurusan dan pelak-sanaan kewenangan dan para anggota Dewan Komisaris Perseroan atas tanggung jawab penga-wasan yang telah mereka lakukan selama tahun buku yang berakhir pada tanggal 31-12-2011 sepanjang tindakan-tindakan tersebut tercermin dalam Laporan Tahunan dan Laporan Keuangan Perseroan.

2. agEnda kEdua: Menyetujui tidak ada dividen yang dibagikan kepada para pemegang saham Perseroan dan tidak ada dana yang dialokasikan sebagai dana cadangan untuk tahun buku yang berakhir pada tanggal 31-12-2011.

3. agEnda kEtiga:Memberikan kewenangan kepada Direksi Perseroan untuk menunjuk Kantor Akuntan Publik untuk mengaudit buku-buku Perseroan untuk tahun buku yang berakhir pada tanggal 31-12-2012 dan me-netapkan honorarium Kantor Akuntan Publik tersebut serta persyaratan lain penunjukkannya.

4. agEnda kEEmPat:• Mengangkat kembali tuan SOFJAN WANANDI, selaku Komisaris Utama Perseroan; • Mengangkat kembali tuan USMAN FAN selaku Komisaris Perseroan;• Mengangkat kembali tuan ANAS, SE selaku Komisaris Independen Perseroan;• Pengangkatan anggota Dewan Komisaris tersebut berlaku sejak penutupan Rapat Umum Pe-

megang Saham (RUPS) Tahunan ini sampai dengan ditutupnya RUPS Tahunan yang ke-lima yang diadakan setelah RUPS hari ini, yakni RUPS Tahunan untuk mengesahkan Laporan Keuangan Perseroan untuk tahun buku yang berakhir pada tanggal 31 Desember 2016, yang akan diadakan pada tahun 2017;

• Menyetujui penetapan jumlah honorarium Dewan Komisaris termasuk tunjangan pajak untuk ta-hun buku 2012 adalah sebesar Rp 2.350.000.000,- (dua miliar tiga ratus lima puluh juta Rupiah) dan memberikan kuasa dan wewenang kepada Rapat Dewan Komisaris untuk mengalokasikan pembagiannya kepada masing-masing anggota Dewan Komisaris Perseroan;

• Memberi kuasa kepada salah seorang anggota Direksi Perseroan dengan hak substitusi untuk menyatakan keputusan dalam acara ke-empat Rapat tersebut dalam suatu akta Notaris dan melaporkan kepada Menteri Hukum dan Hak Asasi Manusia Republik Indonesia serta mendaftarkannya pada Kantor Pendaftaran Perusahaan sesuai ketentuan yang berlaku.

5. agEnda kElima:• Mengangkat kembali tuan ABIDIN selaku Direktur Utama Perseroan;• Mengangkat kembali tuan BIDIN YUSUF selaku Direktur Perseroan;• Mengangkat kembali nyonya MEGAWATI selaku Direktur Keuangan (Tidak Terafiliasi) Perseroan; • Pengangkatan anggota Direksi tersebut berlaku sejak penutupan Rapat Umum Pemegang Sa-

ham (RUPS) Tahunan ini sampai dengan ditutupnya RUPS Tahunan yang ke-lima yang diadakan setelah RUPS hari ini, yakni RUPS Tahunan untuk mengesahkan Laporan Keuangan Perseroan untuk tahun buku yang berakhir pada tanggal 31 Desember 2016, yang akan diadakan pada tahun 2017;

• Memberi wewenang dan kuasa kepada Dewan Komisaris Perseroan untuk menentukan besarnya gaji, uang jasa dan tunjangan kepada masing-masing anggota Direksi Perseroan;

• Memberikan kuasa kepada salah seorang anggota Direksi Perseroan dengan hak substitusi un-tuk menyatakan keputusan dalam acara ke-lima Rapat tersebut dalam suatu akta Notaris dan melaporkan kepada Menteri Hukum dan Hak Asasi Manusia Republik Indonesia serta mendaft-arkannya pada Kantor Pendaftaran Perusahaan sesuai ketentuan yang berlaku.

SELURUH CATATAN RUPST TAHUN SEBELUMNYA TERSEBUT TELAH DIREALISASIKAN PADA TAHUN 2012.

Page 115: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 115

1. first agEnda: • Receive and approve the Company’s Annual Report which was submitted by the Board of Directors

concerning the condition and operation of the Company for the fiscal year ended 31-12-2010 as set forth in the book “Annual Report 2011”.

• Approve and ratify the Company’s Financial Statements containing Consolidated Balance Sheets, Consolidated Income Statement, Statement of Changes in Equity and Cash Flow Statements of the Company and its Subsidiaries for the fiscal year ended 31-12-2011 and their explanations, which have been audited by the “Certified Public Accountants Johan Malonda Mustika & Partners “as evidenced in its audit report number 12151-B1B/JMM2.FH3, date of 05-03-2012, with an un-qualified opinion.

• Provides settlement and release of full responsibility (volledig acquit et decharge) to the mem-bers of the Board of Directors for the responsible management and execution of the authority and the members of the Board of Commissioners for their oversight responsibilities they have done during the financial year ended 31-12-2011 along actions are reflected in the Annual Report and Financial Statements of the Company.

2. sEcond agEnda: Approve no dividends are distributed to the shareholders of the Company and no funds were allocated as a reserve fund for the fiscal year ended 31-12-2011.

3. third agEnda: Authorizes the Board of Directors of the Company to appoint a public accounting firm to audit the books of the Company for the fiscal year ended 31-12-2012 and determine the honorarium of the Public Accountants and other terms of appointment.

4. fourth agEnda: • Reappoint Mr. SOFJAN WANANDI as the President Commissioner of the Company;• Reappoint Mr. USMAN FAN as a Commissioner of the Company;• Reappoint Mr. ANAS,SE as Independent Commissioner;• Appointment of members of the Board of Commissioners is valid from the closing of this General

Meeting of Shareholders (AGM) until the closing of the fifth General Meeting of Shareholders (AGM) held after today AGM, namely the Annual General Meeting of Shareholders to approve the Financial Statements for the fiscal year ended 31 December 2016, to be held in 2017;

• To approve the honorarium of Board of Commissioners, including of tax allowances for year 2012 amounted to Rp 2,350,000,000 - (two billion three hundred and fifty million Rupiah) and provides the power and authority to the Board of Commissioners to allocate the distribution to each mem-ber of the Board of Commissioners;

• Authorize a member of the Board of Directors of the Company with the right of substitution to declare a decision in the fourth agenda of the meeting in a notarial deed and report to the Min-ister of Justice and Human Rights of the Republic of Indonesia and registered the Companies in Registration Office in accordance with the regulations.

5. fifth agEnda: • Reappoint Mr. ABIDIN as President Director of the Company;• Reappoint Mr. BIDIN YUSUF as Director of the Company;• Reappoint Ms. MEGAWATI as Finance Director (Non Affiliated) of the Company;• Appointment of members of the Board of Directors is valid from the closing of this General Meet-

ing of Shareholders (AGM) until the closing of the fifth General Meeting of Shareholders (AGM) held after today AGM, namely the Annual General Meeting of Shareholders to approve the Finan-cial Statements for the fiscal year ended 31 December 2016, to be held in 2017;

• Give authority and power to the Board of Commissioners to determine the salaries, fees and al-lowances to each member of the Board of Directors of the Company;

• Authorize a member of the Board of Directors of the Company with the right of substitution to declare a decision in the fifth agenda of the meeting in a notarial deed and report to the Minister of Justice and Human Rights of the Republic of Indonesia and registered the Companies in Reg-istration Office in accordance with the regulations.

THE ENTIRE RECORD OF THE PREVIOUS YEAR’S AGM HAD BEEN REALIzED IN 2012.

Page 116: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 116

DEwAN KOMISARIS BOARD OF COMMISSIONERS

APPOINTING THE BOARD OF COMMISSIONERS

The Board of Commissioners is collectively re-sponsible and accountable for their organizational function. In brief, the Board of Commissioners are responsible for supervising the Board of Directors, providing suggestions and inputs to the Board of Directors and ensuring that GCG principles are fully implemented by the Company.

Members of the Board of Commissioners do not take and/or receive personal benefits from the company besides the remuneration and other facilities as de-cided in the GMS. All members of the Board of Com-missioners have the adequate integrity and compe-tency to meet the company’s business requirements.

The appointment of the members of BOC of Sat Nusa is based on deed No.14 through Extraordinary Shareholders Meeting of the Company, dated August 7, 2007 and reappointed through Annual General Meeting of Shareholder dated 26 June 2012.

The member of the BOC is appointed and dismissed by the AGMS. The members of the board are appoint-ed from the candidates nominated by the sharehold-ers and the nomination is binding the members of the AGMS. The appointment of the BOC is conducted by taking into account the integrity, dedication and competence of each candidate.

SUSUNAN ANGGOTA DEwAN KOMISARISCOMPOSITION OF THe BOARD OF COMMISSIONeRS

Dewan Komisaris bertanggung jawab secara kolek-tif dan bertanggung jawab untuk fungsi organisasi mereka. Secara singkat, Dewan Komisaris bertang-gung jawab mengawasi Direksi, memberikan sa-ran dan masukan kepada Direksi dan memastikan bahwa prinsip-prinsip GCG sepenuhnya dilaksana-kan oleh Perseroan.

Anggota Dewan Komisaris tidak mengambil dan/atau menerima keuntungan pribadi dari Perseroan selain remunerasi dan fasilitas lain yang akan diputuskan dalam RUPS. Seluruh anggota Dewan Komisaris memiliki integritas dan kompetensi yang memadai untuk memenuhi kebutuhan bisnis Pers-eroan.

Pengangkatan Anggota Dewan Komisaris Perusa-haan, berdasarkan akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perseroan No.14 tang-gal 7 Agustus 2007 dan diangkat kembali pada Rapat Umum Pemegang Saham tanggal 26 Juni 2012.

Anggota Dewan Komisaris diangkat dan diberhenti-kan oleh Rapat Umum Pemegang Saham. Anggota Dewan Komisaris diangkat dari calon-calon yang diusulkan oleh para pemegang saham dan pencalo-nan tersebut mengikat bagi RUPS. Pengangkatan Dewan Komisaris dilakukan dengan mempertim-bangkan integritas, dedikasi, dan kompetensi mas-ing masing calon calon yang diusulkan.

Susunan anggota Dewan Komisaris berdasarkan Rapat Umum Pemegang Saham pada tanggal 26 Juni 2012 adalah sebagai berikut:

The following is the composition of the Board of Commissioners based on the General Meeting of Shareholders dated 26 June 2012:

USMAN FANKOMISARIS COMMISSIONERUMUR | AGE 42

SOFJAN WANANDIKOMISARIS UTAMA

PRESIDENT COMMISSIONERUMUR | AGE 71

ANAS, S.EKOMISARIS INDEPENDEN

INDEPENDENT COMMISSIONERUMUR | AGE 50

DEWAN KOMISARIS | BOARD OF COMMISSIONERS

PEmilihAndEwAnKomisAris

Page 117: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 117

tUGAS DAN tANGGUNG JAWAB DEWAN KOMISARIS

Sebagaimana tertuang dalam anggaran dasar Peseroan, tugas dari Dewan Komisaris Perseroan adalah melakukan pengawasan atas implementasi rencana bisnis, operasi, dan manajemen Perseroan yang dijalankan oleh Direksi, serta memberikan nasihat kepada Direksi. Sebagai kewenangan khusus, Dewan Komisaris juga dapat melaksanakan tugas-tugas tertentu Direksi, apabila Direktur yang bersangkutan berhalangan atau dalam keadaan tertentu. Sementara itu, tanggung jawab Dewan Komisaris Perseroan antara lain:

• melakukan pengawasan terhadap langkah-langkah penanganan Perseroan oleh Direksi berkaitan dengan aspek-aspek perencanaan dan pengembangan, operasi dan penyusunan anggaran, kepatu-han terhadap anggaran dasar Perseroan dan peraturan perundang-undangan, serta pelaksanaan resolusi-resolusi RUPS;

• memberikan nasihat dan pendapat dalam RUPS sehubungan dengan aspek-aspek pelaporan keuangan tahunan, perencanaan bisnis, penunjukkan kantor akuntan publik sebagai auditor ekster-nal perusahaan, dan isu-isu penting Perseroan lainnya;

• menelaah rencana kerja dan penyusunan anggaran Perseroan, agar aktivitas-aktivitas utama yang dijalankan Perseroan selaras satu dengan lainnya;

• dalam menghadapi persoalan, segera meminta Direksi untuk mengumumkan kepada para pemeg-ang saham dengan menyertakan rekomendasi langkah-langkah perbaikan; serta

• membuat dan menyampaikan risalah rapat Dewan Komisaris, laporan mengenai kepemilikan sa-ham dan/ atau keluarga atas saham perusahaan dan saham di perusahaan lainnya, serta laporan tentang tugas pengawasan yang telah dilakukan.

DUtIES AND RESPONSIBILItIES OF tHE BOARD OF COMMISSIONERS

According to Company’s article of association, the roles of Board of Commissioners are to monitor the imple-mentation of business plans, operations, and Company’s management that performed by Directors, and also to give advices to Directors. As the special authority, Board of Commissioners also carry out certain roles of Directors when related Director(s) is (are) not available or in certain conditions. Accordingly, Board of Commissioners’ responsibilities are as follows:

• Supervising the Company’s management steps performed by Directors in relation with the aspects of planning and development, operations and budgeting, compliance of Company’s article of association, laws, and regulations, as well as implementation of GMS resolutions;

• Giving advices and opinions in GMS related to the aspects of annual financial reporting, business planning, appointing an accounting firm as an auditor, and other important matters, business planning, appoint-ment of a public accounting firm as corporate external auditor, and other Company’s important matters;

• Conducting reviews on the Company’s work plan and budget in keeping abreast of Company’s main activi-ties;

• In signs of trouble, immediately request Directors to notify shareholders by providing some recommenda-tions on improvement steps; and

• Composing and delivering Board of Commissioners’ meeting minutes, Company’s and other company’s shares ownerships and/or family ownership, and supervisory reports.

Page 118: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 118

Remuneration is payment to Commissioners for their contribution in corporate management and control. The procedures and mechanisms for determining the amount of remuneration of the commissioners under the Articles of the Company Law No. 105 after adjustment for chapter 18 verse 12 where the salary or honorarium and other allowances of members of the Board of Commissioners set by the GMS. In line of the resolution of Annual Meeting of Shareholders dated 26 June 2012 in Batam, the remuneration for Board of Commissioners amounted to Rp 2,350,000,000.

In 2012, the Board of Commissioners held meetings every 3 (three) months. The Commissioners’ attend-ance in the meetings was 85%.

Remunerasi adalah pembayaran kepada Komisa-ris atas kontribusi mereka dalam pengelolaan dan pengontrolan Perusahaan. Adapun prosedur dan mekanisme penetapan besarnya remunerasi ang-gota dewan komisaris berdasarkan pada Anggaran Dasar No.105 setelah penyesuaian UUPT pasal 18 ayat 12 dimana gaji atau honorarium dan tun-jangan lain dari anggota Dewan Komisaris ditetap-kan oleh RUPS. Sejalan dari keputusan Rapat Pe-megang Saham Tahunan tanggal 26 Juni 2012 di Batam, remunerasi bagi Dewan Komisaris sebesar Rp 2.350.000.000, -

Pada tahun 2012, Dewan Komisaris mengada-kan pertemuan setiap 3 (tiga) bulan. Kehadiran Komisaris dalam pertemuan tersebut adalah 85%.

Sat Nusa telah mematuhi peraturan perundangan yang berlaku terkait dengan independensi Dewan Komisaris:• Dewan Komisaris Sat Nusa telah memenuhi

persyaratan Bapepam pada jumlah, kompo-sisi, kriteria dan independensi anggota De-wan Komisaris, dengan total 3 Komisaris di Sat Nusa, dimana 1, mewakili lebih dari 30% , adalah Komisaris Independen. Komisaris In-dependen telah memenuhi kriteria independ-ensi, sebagaimana diatur oleh Bapepam- LK.

• Komisaris Independen tidak memiliki hubun-gan afiliasi dengan Perseroan, Anggota Dewan Komisaris, Anggota Direksi atau Pemegang Saham Utama Perseroan.

Sat Nusa has complied with prevailing laws and regulations related to the independency of the Board of Commissioners:• The Board of Commissioners of Sat Nusa has

complied with Bapepam’s requirements on the number, composition, criteria and independence of the members of the Board of Commissioners, with a total of 3 Commissioners at Sat Nusa, of which 1, representing more than 30%, is Inde-pendent Commissioners. Independent Commis-sioner has fulfilled criteria of independency, as regulated by Bapepam-LK.

• Independent Commissioner has no affiliation with the Company, the Board of Commissioners, Board of Directors or Major Shareholders of the Company.

KOMISARIS INDEPENDENINDePeNDeNT COMMISSIONeR

REMUNERASI KOMISARISCOMMISSIONeRS ReMUNeRATION

Page 119: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 119

Susunan anggota Direksi berdasarkan Rapat Umum Pemegang Saham pada tanggal 26 Juni 2012 adalah sebagai berikut:

The following is the composition of the Board of directors based on the general meeting of Shareholders dated 26 June 2012:

SUSUNAN ANGGOTA DIReKSI | COMPOSITION OF THe BOARD OF DIReCTORS

BiDiN YUSUfDIREKTUR OPERASIONAL OPERATIONAL DIRECTORUMUR | AGE 54

ABiDiNDIREKTUR UTAMA

PRESIDENT DIRECTORUMUR | AGE 50

MEGAwATiDIREKTUR KEUANGAN (TIDAK TERAFILIASI)

FINANCE DIRECTOR (NON AFFILIATED)UMUR | AGE 35

DIREKSIBOARD OF DIRECTORS

Direksi mengelola dan menjalankan Perusahaan sesuai dengan tujuan dan sasaran Perusahaan. Para Direksi juga melakukan tugas, tanggung jawab, dan lainnya berdasarkan Anggaran Dasar, regulasi yang berlaku, dan/atau Rapat Umum Pemegang Saham, termasuk prinsip-prinsip GCG

The BOD manage and run the company in accord-ance with the objectives and goals of the company. The BOD also conduct their tasks, responsibilities, and other based on the Articles of the Association, prevailing regulations, and/or the General Meet-ing of Shareholders, including the principles of GCG

Page 120: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 120

ROLES• developing and delivering Company’s strategic plan in the most effective and efficient manner; and • achieving the overall day-to-day performance as well as business and organization management of the

Company in accordance with set targets, under delegated authority from the Board of Commissioners.

RESPONSIBILItIES • implementing Board of Commissioners’ policies and strategies; • developing and presenting the annual strategic business plans to Board of Commissioners for approval; • reporting regularly to Board of Commissioners concerning the implementation progress of the annual

strategic business plans; • managing, motivating, developing, and leading Management Team members; • managing resources in effective and efficient manners in achieving Company’s objectives;• chairing Management Team’s meetings; • taking leadership roles in establishing or developing Company’s culture and values; • ensuring that there is a fit between Company’s strategy and culture, between Company’s processes and

structure; • ensuring that Company’s internal audit processes and procedures are appropriately conducted; • developing and implementing risk management plans; and • ensuring that Company’s succession plan is implemented well.

tUGAS• mengembangkan dan menjalankan rencana strategis Perseroan melalui cara-cara yang efektif dan

efisien; dan • mencapai keseluruhan kinerja operasional sehari-hari, serta manajemen bisnis dan organisasi

Perseroan secara menyeluruh sesuai dengan target yang diharapkan melalui otoritas yang didel-egasikan oleh Dewan Komisaris

tANGGUNG JAWAB• mengimplementasikan kebijakan-kebijakan dan strategi-strategi Dewan Komisaris; • mengembangkan dan menyampaikan rencana-rencana strategis bisnis tahunan kepada Dewan

Komisaris untuk mendapatkan persetujuan; • melaporkan perkembangan pelaksanaan rencana-rencana strategis bisnis tahunan kepada Dewan

Komisaris secara rutin; • mengurus, memotivasi, mengembangkan, dan memimpin anggota tim manajemen; • mengurus sumber daya yang dimiliki secara efektif dan efisien dalam rangka mencapai tujuan-tu-

juan Perseroan; • memimpin rapat-rapat tim manajemen; • mengambil peran kepemimpinan dalam menciptakan dan mengembangkan budaya dan nilai-nilai

Perseroan; • memastikan adanya kesesuaian antara strategi dan budaya Perseroan, antara proses dan struktur

Perseroan; • memastikan dilaksanakannya prosedur dan proses audit internal Perseroan yang tepat; • mengembangkan dan mengimplementasikan rencana-rencana manajemen risiko; serta • memastikan rencana ketersediaan kandidat-kandidat yang tepat untuk menduduki berbagai posisi

kunci Perseroan dijalankan dengan baik.

DUTIeS AND ReSPONSIBILITIeS OF PReSIDeNT DIReCTORTUgAS DAN TANggUNg JAwAB PRESIDEN DIREKTUR

Page 121: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 121

DUTIeS AND ReSPONSIBILITIeS OF OPeRATIONAL DIReCTORTUGAS DAN TANGGUNG JAwAB DIREKTUR OPERASIONAL

ROLES• conducting planning, directing, and coordinating the development, selection, implementation, and utiliza-

tion of the Company’s operations; and• working with all levels of staffs to identify and address the Company’s individual, departmental, and or-

ganization wide needs.

RESPONSIBILItIES• monitoring production volume activity and quality of products, planning and shipment delivery to ensure

Company’s production flow is efficient;• ensuring that Company’s product manufacturing and operations management are in compliance with

regulations and standard procedures, as well as monitoring, identifying, and correcting deficiencies;• working closely to Company’s Assistant General Managers (GMS) and Finance Director (Non Affiliated)

in identifying needs, writing grants and obtaining grant funds, and also implementing grant deliverable;• in collaboration with Company’s Management Team, overseeing the development of the center’s annual

budget, monthly expenditures, and performance against budget;• developing, recommending, and preparing specifications for Company’s capital expenditures, projects, and

proposals as requested by AGM;• evaluating Company’s operations structure, conducting team planning, and developing training and edu-

cation for continual improvement of the efficiency and effectiveness of the group, as well as providing individuals with professional and personal growth with an emphasis on opportunities (where possible) of individuals;

• managing Company’s special projects as assigned by the President Director; and• expanding networking and bring in more projects to the Company.

tUGAS• melakukan perencanaan, pengarahan, dan pengkoordinasian terkait pengembangan, pemilihan, im-

plementasi, dan pemanfaatan operasi-operasi Perseroan; dan• bekerjasamadengansemualevelkaryawandalammengidentifikasikandanmenentukankebutu-

han-kebutuhan pada tingkat individu, departemen, dan organisasi Perseroan secara luas.

tANGGUNG JAWAB• mengawasibobotaktivitasproduksidankualitasproduk-produkyangdihasilkan,perencanaandan

pengiriman melalui transportasi laut untuk memastikan arus produksi Perseroan berlangsung efisien;

• memastikanbahwamanufakturprodukdanmanajemenoperasiPerseroanmemenuhiperaturanperundangan-undangan dan prosedur standar yang ditentukan, sekaligus mengawasi dan mengi-dentifikasi penyimpangan yang terjadi dan memperbaiki kekurangan-kekurangan yang ada;

• bekerjasamadenganAsistenGeneralManagerdanDirekturKeuangan(TidakTerafiliasi)Perseroandalam mengidentifikasikan kebutuhan-kebutuhan, mengajukan permohonan dan memperoleh dana yang dibutuhkan, serta mengimplementasikan penggunaan yang sesuai;

• bersama-samadenganTimManajemenPerseroanmengawasiperkembanganfokusanggarandanatahunan, pengeluaran dana bulanan, dan keseimbangan kinerja yang dicapai dengan dana yang dikeluarkan;

• mengembangkan,merekomendasikan,danmenyiapkanspesifikasi-spesifikasipengeluaran-penge-luaran modal, proyek-proyek, dan proposal-proposal Perseroan yang diajukan oleh Asisten General Manager;

• mengevaluasistrukturoperasi-operasiPerseroan,melakukanperencanaantim,mengembangkanpelatihan dan pendidikan bagi peningkatan efektivitas dan efisiensi tim secara kontinu sekaligus memfasilitasi pertumbuhan profesional dan pribadi individu dengan penekanan pada kesempatan-kesempatan (bila dimungkinkan) yang dimiliki oleh masing-masing individu;

• menanganiproyek-proyekkhususPerseroanyangditugaskanolehDirekturUtama;serta• memperluasjejaringdanmenambahproyek-proyekPerseroan.

Page 122: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 122

TUgAs• mengawasiunitkeuangandanmerupakanpembicarautamasehubungandengankeuanganPers-

eroan; dan• melaporsecaralangsungkepadaDirekturUtamadanmembantuDirekturOperasionalsecaralang-

sung pada seluruh persoalan strategis dan taktis Perseroan sehubungan dengan manajemen alokasi dana, analisis biaya dan keuntungan, prediksi kebutuhan-kebutuhan, dan pengamanan pendanaan baru Perseroan.

TAnggUngJAwAB• berpartisipasidalampengembanganbisnisbaruPerseroan,khususnyamembantuDirekturUtama

dan Direktur Operasional dalam mengidentifikasi kesempatan-kesempatan pendanaan baru, mem-buat rancangan alokasi dana terkait program-program yang prospektif, dan menentukan efektivitas biaya pemenuhan layanan yang prospektif;

• memastikanadanyakontrol-kontrolyangmemadai,dokumen-dokumenpembuktiandisetujuidanter-sedia, sehingga seluruh aktivitas pembelian Perseroan dapat melalui proses-proses audit independen dan pemerintah;

• menyajikanalokasidanaoperasionalkepadaDirekturOperasional,sertabekerjasamadenganDirek-tur Operasional dalam memastikan keberhasilan program-program Perseroan yang dijalankan, mela-lui dukungan analisis biaya dan kepatuhan terhadap seluruh kebutuhan/permintaan dalam kontrak dan program-program yang dijalankan;

• mengawasipelaksanaanmanajemendankoordinasiseluruhaktivitaspelaporankeuanganbagiPers-eroan, termasuk pendapatan-pengeluaran, laporan posisi keuangan, serta aktivitas penggajian bagi para karyawan.

• mengawasiaktivitasperbankanPerseroan;• memastikanaruskasmemadaiuntukmencukupikebutuhan-kebutuhanPerseroan;• mengawasipembuatanlaporan-laporanbulanan,termasuklaporan-laporankeuangandanproyeksi-

proyeksi arus kas untuk digunakan oleh manajemen eksekutif, termasuk Komite Audit dan Direksi;• membantudalamprosesdesain,implementasi,dankalkulasiwaktuterkaitinsentifupah,komisi,dan

gaji bagi para karyawan Perseroan; dan• mengawasikemampuanmembayarhutangdantingkatkolektibilitaspiutangPerseroan.

TUGAS DAN TANGGUNG JAWAB DIReKTUR KeUANGN (TIDAK TeRAFILIASI)

ROLES• supervisingthefinanceunitandistheCompany’schieffinancialspokesperson;and• reportingdirectlytoPresidentDirectoranddirectlyassistingOperationalDirectoronallstrategicandtacti-

cal Company’s matters in relation with budget management, cost benefit analysis, forecasting needs, and the securing of new funding.

RESPONSIBILItIES• participatingindevelopingnewbusiness,specificallyassistingPresidentDirectorandOperationalDirector

in identifying Company’s new funding opportunities, drafting the prospective programmatic budgets, and determining cost effectiveness of the prospective services delivery;

• ensuringadequatecontrolsare installed,substantiatingdocumentation isapprovedandavailable,suchthat all Company’s purchases may pass independent and governmental audits;

• providingOperationalDirectorwithanoperatingbudget,andworkingwithOperationalDirectortoensureCompany’s programmatic success through cost analysis support and compliance with all contractual and programmatic requirements;

• overseeingthemanagementandcoordinationofallfiscalreportingactivitiesfortheCompany,includingrevenues-expenses, balance sheet reports, and payroll activities for staffs and participants;

• monitorCompany’sbankingactivities;• ensuringanadequatecashflowtomeetCompany’sneeds;• overseeingtheproductionofmonthlyreports,includingfinancialstatementsandcashflowprojectionsfor

the use of Executive Management, as well as the Audit Committee and Directors;• assistinginthedesign,implementation,andtimelycalculationsofwageincentives,commissions,andsala-

ries for Company’s staffs; and• overseeingCompany’sAccountsPayableandAccountsReceivableturnover;

DUTIeS AND ReSPONSIBILITIeS OF FINANCe DIReCTOR (NON AFFILIATeD)

Page 123: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 123

BOD MEEtING AND AttENDANCE BOD has a regular meeting at least once a month. BOD also may arrange meetings as requested by:

a) President director b) One of the director c) One of the commissionerd) Shareholder who collectively represent at least 1/10 (one tenth) of the company’s paid up capital

In 2012, Directors held meetings every week. The Directors’ attendance in the meetings was 95%

RAPAt DIREKSI DAN tINGKAt KEHADIRAN

Direksi memiliki pertemuan rutin minimal sebulan sekali. Direksi juga dapat mengatur pertemuan sesuai permintaan:a) Direktur Utamab) Salah satu direksic) Salah satu komisarisd) Pemegang Saham yang secara kolektif mewakili paling sedikit 1/10 (sepersepuluh) modal yang disetor Perusahaan

Pada tahun 2012, Direksi mengadakan pertemuan setiap minggu. Kehadiran Direksi dalam perte-muan tersebut adalah 95%

indEks jaBatan titlE indEX - Direktur Utama President Director : 100.00% - Komisaris Utama President Commissioner : 35.45%- Direktur Operasional Operational Director : 44.15%- Direktur Keuangan (tidak terafiliasi) Finance Director (non affiliated) : 17.50%- Komisaris Commissioner : 7.65%- Komisaris Independen Independent Commissioners : 7.66%

PELAtIHAN DIREKSI | BOARD OF DIRECtORS tRAINING

JUDUL PELAtIHAN | TRAINING TITLE tEMPAt | LOCATION

• Corporate Treasury Summit | Corporate Treasury Summit Jakarta• CFO Summit | CFO Summit Jakarta

The salary composition for President Director, Presi-dent Commissioner, Operational Director, Finance Di-rector (Non Affiliated) and members of the Board of Commissioners are as follow:

Komposisi gaji Direktur Utama, Komisaris Utama, Direktur Operasional, Direktur Keuangan (Tidak Terafiliasi) dan anggota Dewan Komisaris adalah sebagai berikut:

KEBIJAKAN REMUNERASI BAGI DIREKSI DAN DEWAN KOMISARISRemuneration Policy for Board of Directors and Board of Commissioners

Dalam upaya meningkatkan kompetensi dan men-dukung penyelesaian tugas, pada tahun 2012, Di-reksi Sat Nusa mendapatkan berbagai pelatihan baik internal maupun eksternal seperti yang dis-ebutkan dalam tabel di bawah:

In the effort of improving its competence and support the tasks delivery, in 2012, Sat Nusa Board of Direc-tors were involved in variety of training sessions both internal and external as mentioned in the table below:

Page 124: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 124

LAPORAN KOMITECommittee Report

PELAKSANAAN TUGAS KOMITE AUDIT DAN TANG-GUNG JAWAB PADA TAHUN 2012Selama 2012, Komite Audit telah melakukan kegia-tan:• Melakukan analisa terhadap jumlah hari per-

sediaan bahan baku, barang dalam proses dan barang jadi PT Sat Nusapersada Tbk.

• Memeriksa Laporan Triwulan• Menyampaikan Laporan Komite Audit kepada

Dewan Komisaris PT Sat Nusapersada Tbk. • Melakukan analisa terhadap jumlah hari piutang

dan hutang tertahan, dan• Menyusun Laporan Komite Audit untuk periode

kerja Tahun 2012.

Pada tahun 2012, Komite Audit mengadakan perte-muan setiap 3 (tiga) bulan. Kehadiran Komite Audit dalam pertemuan tersebut adalah 90%.

IMPLEMENTATION OF THE AUDIT COMMITTEE’S TASKS AND RESPONSIBILITIES IN 2012During 2012, the Audit Committee has carried out the following activities: • Analyzing raw materials, WIP and finished

goods turnover days of PT Sat Nusapersada Tbk.

• Examine Quarterly Report• Delivering the Audit Committee Report to the

Board of Commissioners of PT Sat Nusaper-sada Tbk.

• Analyzing retained accounts receivable and payable turnover days , and

• Develop Audit Committee Report for fiscal year 2012.

In 2012, Audit committee held meetings every 3 (three) months. The Audit Committee’s attendance in the meeting was 90%.

ANAS, SE.KETUA KOMITE AUDIT

CHIEF OF AUDIT COMMITTEEUMUR | AGE 50

GLENN MARTINUS MARJONO, S.E., M.M.CPAANGGOTAMEMBERUMUR | AGE 33

NETTY, S.EANGGOTAMEMBER

UMUR | AGE 28

SUSUNAN KOMItE AUDIt | COMPOSItION OF AUDIt COMMIttEE

Berikut ini adalah komposisi Komite Audit per 31 Desember 2012

Following is composition of the audit Committees as per 31 December 2012

Page 125: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 125

KOMITE AUDIT

Komite Audit adalah Komite yang dibentuk oleh Dewan Komisaris dalam rangka membantu dan mem-perkuat fungsi Dewan Komisaris dalam melaksanakan fungsi pengawasan atas proses pelaporan keuangan, audit, pengendalian internal dan pelaksanaan Tata Kelola Perusahaan yang dilakukan oleh Direksi saat mengelola Perusahaan.

Sesuai dengan Piagam Komite Audit Sat Nusa, Komite Audit memiliki tugas dan tanggung jawab untuk:• melakukan penelaahan atas informasi keuangan yang akan dikeluarkan Emiten atau Perusahaan

Publik kepada publik dan/atau pihak otoritas antara lain laporan keuangan, proyeksi, dan laporan lainnya terkait dengan informasi keuangan Emiten atau Perusahaan Publik;

• melakukan penelaahan atas ketaatan terhadap peraturan perundang-undangan yang berhubungan dengan kegiatan Emiten atau Perusahaan Publik;

• memberikan pendapat independen dalam hal terjadi perbedaan pendapat antara manajemen dan Akuntan atas jasa yang diberikannya;

• memberikan rekomendasi kepada Dewan Komisaris mengenai penunjukan Akuntan yang didasar-kan pada independensi, ruang lingkup penugasan, dan fee;

• melakukan penelaahan atas pelaksanaan pemeriksaan oleh auditor internal dan mengawasi pelak-sanaan tindak lanjut Direksi atas temuan auditor internal;

• melakukan penelaahan terhadap aktivitas pelaksanaan manajemen risiko yang dilakukan oleh Di-reksi, jika Emiten atau Perusahaan Publik tidak memiliki fungsi pemantau risiko di bawah Dewan Komisaris;

• menelaah pengaduan yang berkaitan dengan proses akuntansi dan pelaporan keuangan Emiten atau Perusahaan Publik;

• menelaah dan memberikan saran kepada Dewan Komisaris terkait dengan adanya potensi benturan kepentingan Emiten atau Perusahaan Publik; dan

• menjaga kerahasiaan dokumen, data dan informasi Emiten atau Perusahaan Publik.

AUDIt COMMIttEE

The Audit Committee is a Committee established by the Board of Commissioners in order to assist and to strengthen the functions of the Board of Commissioners in discharging its supervisory functions over finan-cial reporting process, audit, internal controls and implementation of Corporate Governance conducted by the Board of Directors while managing the Company.

In accordance with the Audit Committee Charter of Sat Nusa, the Audit Committee has the duty and responsibil-ity to: • reviewing the financial information to be released by publicly listed companies to the public and/or au-

thorities such as financial reports, projections, and other statements relating to financial information of publicly listed companies;

• conduct review on laws and regulations compliance related to the activities of the public listed company;• provide independent opinion in the event of disagreements between management and the accountant for

services rendered;• provide recommendations to the Board of Commissioners on the appointment of public accountant based

on independency, the scope of the assignment, and the fee;• reviewing the implementation of the inspection by the internal auditor and oversee the implementation of

the follow-up by the Board of Directors on the findings of the internal auditor;• conducting a review of the implementation of risk management activities undertaken by the Board of Di-

rectors, if the Public Company does not have a risk monitoring function under the Board of Commissioners;• examine complaints relating to the accounting and financial reporting for publicly listed companies;• review and provide advice to the Board relating to the potential conflict of interest in publicly listed com-

panies, and• maintaining confidentiality of documents, data and information for publicly listed companies.

Page 126: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 126

Corporate Secretary has the mission to create a good company image consistently and continuously through effective communication program to stakeholders

Sekretaris Perusahaan memiliki misi untuk membangun citra perusahaan yang baik secara konsisten dan terus menerus melalui program komunikasi yang efektif kepada stakeholder

Sekretaris Perusahaan memiliki peran penting dalam memastikan transparansi di Perusahaan. Dalam struktur organisasi, Sekretaris Perusahaan bertanggung jawab langsung kepada Direktur Utama, dan bertanggung jawab untuk melakukan komunikasi dengan masyarakat serta pihak internal serta pen-anganan data tentang Perusahaan.

Kegiatan yang dilakukan oleh Sekretaris Perusahaan pada tahun 2012, meliputi:• Mengelola Sekretariat Direksi untuk membantu Direksi dalam melaksanakan tugas dan tanggung

jawab.• Memberikan pelayanan sehubungan dengan permintaan dari pemegang saham dan masyarakat

umum untuk informasi yang berkaitan dengan kondisi Sat Nusapersada, termasuk Laporan Tahu-nan, informasi yang berhubungan dengan Rapat Umum Tahunan Pemegang Saham Perseroan.

• Pemantauan / mengikuti perkembangan di Pasar Modal, meliputi peraturan pasar modal yang dike-luarkan sepanjang tahun 2012, serta memberikan masukan kepada Dewan Komisaris, Direksi dan unit kerja terkait pengaruh dari peraturan tersebut.

• Menyampaikan laporan berkala dan laporan tambahan lainnya kepada Bapepam-LK dan Bursa Efek, termasuk laporan tentang rencana dan hasil kegiatan korporasi seperti Rapat Umum Pemegang Saham Tahunan dan

• Menghadiri semua Rapat Dewan Komisaris dan Rapat Direksi, serta mempersiapkan risalah dari kedua Rapat.

The activities undertaken by the Corporate Secretary in 2012, included:• Manage the Secretariat of Directors in the support of the directors in conducting their tasks and respon-

sibilities.• Providing service with respect to requests by shareholders and the general public for information related

to the conditions of Sat Nusapersada, including Annual Report, information related to the Company’s An-nual General Meeting of Shareholders.

• Monitoring/updating developments in the Capital Market, encompassing market regulations issued throughout 2012, as well as providing input to the Board of Commissioners, Board of Directors and related work units affected by the said regulation.

• Submitting regular reports and other supplementary reports to Bapepam-LK and Stock Exchange, in-cluding report on plans and results of corporate activities such as Annual General Meeting of Sharehold-ers, and

• Attending all Board of Commissioners Meetings and Board of Directors Meetings, as well as preparing minutes of both Meetings.

The Corporate Secretary has an important role in ensuring transparency at the Company. Within the organiza-tion structure, the Corporate Secretary reports directly to the President Director, and is responsible for com-munications with the public and with internal parties as well as for the handling of data about the Company.

SEKRETARIS PERUSAHAANCORPORATE SECRETARy

Page 127: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 127

Internal Audit is carried out to provide assurance and consultation that is independent and objective, in order to increase value and improve the operations through systematic approach, by evaluating and improving the effectiveness of risk management, control and governance processes.

The Company develops internal control system to assure the security of its assets and resources. This depart-ment is responsible for effectiveness of internal control system.

Corporate Guideline and Basic Policy on GCG recommends that the Company has internal supervisory function. The Company sees Internal Audit is one of internal control and supervisory functions to support the operations, finance, and management to make it more effective and efficient.

sTrUCTUrEAndsTATUs

• The Internal Audit is a unit that carries out Internal Audit task in the company, led by a Head of Department;•Head of Internal Audit Unit is appointed and dismissed by the President Director with the approval of the

Board of Commissioners, represented by the President Commissioner;•Director may dismiss the head of the Internal Audit Unit, after approval by the Board of Commissioners, if the

Head of Internal Audit Unit does not meet the requirements as Internal Audit Unit Auditor as set forth in this rule and failing or incompetent in carrying out their duties;• In carrying out its duties, Internal Audit Unit cooperates with the Audit Committee - in the form of briefings

and reviews.

Internal Audit adalah suatu kegiatan pemberian keyakinan (assurance) dan konsultasi yang bersifat in-dependen dan obyektif, dengan tujuan untuk meningkatkan nilai dan memperbaiki operasional melalui pendekatan yang sistematis, dengan cara mengevaluasi dan meningkatkan efektivitas manajemen risiko, pengendalian dan proses tata kelola perusahaan.

Perusahaan mengembangkan sistem pengendalian internal untuk menjamin keamanan aset dan sum-ber dayanya. Departemen ini bertanggung jawab atas efektivitas sistem pengendalian internal.

Pedoman Korporat dan Kebijakan Dasar GCG merekomendasikan bahwa Perusahaan memiliki fungsi pengawasan internal. Perusahaan memandang Internal Audit sebagai salah satu pengendalian internal dan fungsi pengawasan untuk mendukung operasi, keuangan, dan manajemen agar lebih efektif dan efisien.

STrUkTUr Dan keDUDUkan

•Unit Internal Audit adalah Bagian yang melakukan tugas di bidang Internal Audit perusahaan, dipimpin oleh seorang Kepala Bagian;

•Kepala Unit Internal Audit diangkat dan diberhentikan oleh Direktur Utama atas persetujuan Dewan Komisaris yang diwakili oleh Komisaris Utama;

•Direktur Utama dapat memberhentikan Kepala Unit Internal Audit, setelah mendapat persetujuan De-wan Komisaris, jika Kepala Unit Internal Audit tidak memenuhi persyaratan sebagai Auditor Unit Inter-nal Audit sebagaimana diatur dalam peraturan ini dan atau gagal atau tidak cakap menjalankan tugas;

•Dalam menjalankan tugasnya Unit Internal Audit bekerja sama dengan Komite Audit - dalam bentuk Pengarahan dan Review.

AUDIT INTERNALINTERNAL AUDIT

Page 128: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 128

dUTiEsAndrEsPonsiBiliTiEsofThEinTErnAlAUdiTUniT

• Develop and implement the Internal Audit Annual Work Plan (RKIAT);• Test and evaluate the implementation of the Internal Control and Risk Management System in accordance

with company policy;• Inspection and assessment of the efficiency and effectiveness in Finance, Accounting, Production, Pur-

chasing, Human Resources, Marketing and other activities;• Suggest improvements and objective information about the activities examined at all levels of manage-

ment;• Creating the Audit Report and submit the report to the President Director and the Board of Commissioners

and other Directors as assigned by the President Director;• Monitor, analyze and report on the follow-up improvements that have been suggested;• Put together a program to evaluate the quality of the internal audit activity’s doing, and• Conduct special inspections if necessary.

Throughout 2012, audit was performed on a number of audit objects as follows;• Operational Divisions of the Company, which included an inspection on the compliance with the investment

made by the Division and the implementation of its operating process;• Operational Division, which covered evaluation on current projects in that year which had a relatively large

monetary value and risks.• Special assessment on the process and realization of Company’s big investments.

TUgaS Dan TanggUng jaWab UniT aUDiT inTernal

• Menyusun dan melaksanakan Rencana Kerja Internal Audit Tahunan (RKIAT);• Menguji dan mengevaluasi pelaksanaan Pengendalian Intern dan Sistem Manajemen Risiko sesuai

dengan kebijakan perusahaan;• Melakukan pemeriksaan dan penilaian atas efisiensi dan efektivitas di bidang Keuangan, Akuntansi,

Produksi, Pembelian, Sumber Daya Manusia, Pemasaran dan kegiatan lainnya;• Memberikan saran perbaikan dan informasi yang obyektif tentang kegiatan yang diperiksa pada se-

mua tingkat manajemen;• Membuat Laporan Hasil Audit dan menyampaikan laporan tersebut kepada Direktur Utama dan De-

wan Komisaris serta Direktur lainnya seperti yang ditugasi oleh Direktur Utama;• Memantau, menganalisis dan melaporkan pelaksanaan tindak lanjut perbaikan yang telah disaran-

kan;• Menyusun program untuk mengevaluasi mutu kegiatan Internal Audit yang dilakukannya; dan• Melakukan pemeriksaan khusus apabila diperlukan.

Sepanjang 2012, audit dilakukan pada sejumlah obyek audit sebagai berikut;• Operasional Divisi Perusahaan, yang termasuk inspeksi pada kepatuhan terhadap investasi yang

dilakukan oleh Divisi dan pelaksanaan proses operasinya;• Operasional Divisi, yang mencakup evaluasi pada proyek-proyek di tahun itu yang memiliki nilai

moneter dan risiko yang relatif besar;• Penilaian khusus pada proses dan realisasi investasi besar Perusahaan.

Page 129: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 129

SISTEM PENgENDALIAN INTERNALINTeRNAL CONTROL SySTeM

Pengendalian Keuangan dan Operasional Financial and Operational ControlSistem Pengendalian Internal merupakan suatu me-kanisme proses pengawasan yang ditetapkan oleh manajemen Perseroan secara berkelanjutan dan pelaksanaannya dilakukan oleh Dewan Komisaris, Di-reksi serta seluruh pejabat dan pegawai Perseroan, dirancang untuk dapat memberikan keyakinan yang memadai guna menjaga dan mengamankan harta kekayaan Perseroan, menjamin tersedianya laporan yang akurat, meningkatkan kepatuhan terhadap ke-tentuan yang berlaku, mengurangi dampak kerugian keuangan, penyimpangan termasuk kecurangan dan meningkatkan efektivitas organisasi serta meningkat-kan efisiensi biaya.

Beberapa tujuan Sistem Pengendalian Internal :• Memastikan kepatuhan terhadap peraturan dan

perundang-undangan yang berlaku, yakni untuk menjamin bahwa semua kegiatan usaha Perseroan telah dilaksanakan sesuai ketentuan dan peraturan perundang-undangan yang berlaku;

• Memastikan tersedianya informasi keuangan dan manajemen yang benar, lengkap dan tepat waktu;

• Menganalisa efektivitas dari kegiatan usaha Pers-eroan untuk meningkatkan efisiensi dalam meng-gunakan asset dan sumber daya lainnya dalam rangka melindungi Perseroan dari risiko kerugian;

• Mengurangi dampak kerugian, penyimpangan ter-masuk kecurangan atau fraud.

Sistem pengendalian harus melibatkan seluruh pegawai dan pejabat Perseroan, termasuk Dewan Komisaris dan Direksi. Oleh karena itu, kegiatan pen-gendalian akan berjalan efektif apabila direncanakan dan diterapkan guna mengendalikan risiko yang telah diidentifikasi.

KepatuhanKepatuhan terhadap undang-undang dan peraturan dikelola oleh bagian Legal sedangkan kepatuhan ter-hadap peraturan kesehatan, keselamatan dan lingkun-gan dibawah bagian Management Representative (MR). Divisi ini berupaya untuk memastikan bahwa kebija-kan, keputusan Perseroan dan seluruh aktivitas bisnis dilakukan sesuai dengan ketentuan hukum dan pera-turan yang berlaku, baik internal maupun eksternal. Beberapa aktivitas kepatuhan yang dilakukan selama tahun 2012 antara lain adalah: • Mendukung aktivitas bisnis dengan menyediakan

legal advice melalui penyampaian kajian hukum atas rencana tindakan dan permasalahan yang ter-jadi terkait kesesuaian dengan hukum atau keten-tuan yang berlaku;

• Melakukan evaluasi kajian risiko dan legal atas ke-bijakan dan rencana kerja sama yang akan dilaku-kan oleh Perusahaan dengan pelanggan maupun pemasok.

• Melakukan evaluasi terhadap implementasi kepatu-han terhadap peraturan yang berkaitan dengan kes-ehatan, keselamatan dan lingkungan kerja.

Internal Control System is a process control mech-anism established by the Company’s management and its implementation on an ongoing basis by the Board of Commissioners, Board of Directors and all officers and employees of the Company, is designed to provide reasonable assurance to safeguard and secure the assets of the Company, ensure the availability of accurate reports , in-creasing compliance with applicable regulations, reducing the impact of financial losses, irregulari-ties including fraud and increase organizational effectiveness and improve cost efficiency.

Some of Internal Control Systems objectives:• Ensuring compliance with laws and regula-

tions in force, namely to ensure that all of the Company’s business activities have been im-plemented in accordance with the laws and regulations in force;

• Ensuring the availability of financial and man-agement information is accurate, complete and timely;

• Analyzing the effectiveness of the Company’s business activities to improve the efficiency in using assets and resources in order to protect the Company from the risk of loss;

• Reduce the impact of loss, fraud or irregulari-ties including fraud.

Control system must involve all employees and officers of the Company, including the Board of Commissioners and Board of Directors. There-fore, control activities will be effective if planned and implemented in order to control the identified risks.

ComplianceCompliance with prevailing laws and regulations is managed by Legal Division while adherence to health, safety and environment regulation is under Management Representative (MR). The division seeks to ensure that the policies, decisions and all business activities of the Company in accordance with the provisions of applicable laws and regu-lations, both internal and external. Some compli-ance activities undertaken during 2012 include:

• Support business activities by providing legal advice through the delivery of legal opinion and action plans for problems occurred related to compliance with applicable laws or regula-tions;

• To evaluate the risk and legal assessment on policy and business cooperation plan that will be made by the Company with the customers and suppliers.

• To evaluate the implementation of regulatory compliance relating to health, safety and work-ing environment.

Page 130: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 130

evaluasi atas efektivitas Pengendalian Internal

evaluation of the effectiveness of Internal Control

Sat Nusa senantiasa melakukan pemantauan secara terus menerus terhadap efektivitas keseluruhan pelak-sanaan pengendalian internal. Pemantauan terhadap risiko utama Perseroan harus diprioritaskan dan ber-fungsi sebagai bagian dari kegiatan Perseroan sehari-hari termasuk evaluasi secara berkala, baik oleh sat-uan-satuan kerja operasional maupun Divisi Internal Audit.

Sat Nusa juga memantau dan mengevaluasi kecukupan sistem pengendalian internal secara terus menerus berkaitan dengan adanya perubahan kondisi internal dan eksternal serta harus meningkatkan kapasitas sis-tem pengendalian internal tersebut agar efektivitasnya dapat ditingkatkan.

Sat Nusa conducts continuous monitoring of the effectiveness of the implementation of overall in-ternal control. Monitoring of the main risks of the Company should be prioritized and serves as part of the Company’s day-to-day activities include regular evaluation, either by operational units and Internal Audit Division.

Sat Nusa also monitors and evaluates the ad-equacy of the internal control system continuously related to the change in the internal and external conditions, as well as increasing the capacity of the internal control system so that its effective-ness can be improved.

With existing limitations, internal control over fi-nancial reporting may not prevent or detect the occurrence of human error. In addition, projec-tions evaluation of the effectiveness in the future may contain risk that controls may become inad-equate because of changes in conditions, or be-cause of the level of compliance with the policies or procedures may deteriorate.

The Company’s management has assessed the effectiveness of internal control over financial report as of December 31, 2012. In conducting the assessment, management of the Company uses the criteria established by internal control. Based on this assessment, management concluded that as of December 31, 2012, our internal control over financial reporting was effective.

Dengan keterbatasan yang ada, pengendalian internal atas pelaporan keuangan kemungkinan tidak dapat mencegah atau mendeteksi terjadinya kesalahan ma-nusia. Di samping itu, proyeksi atas evaluasi efektivi-tas pada masa mendatang mengandung risiko bahwa pengendalian mungkin menjadi tidak memadai karena perubahan kondisi, atau karena tingkat kepatuhan ter-hadap kebijakan atau prosedur mungkin menurun.

Manajemen Perusahaan telah melakukan penila-ian efektivitas pengendalian internal atas pelaporan keuangan Perusahaan pada tanggal 31 Desember 2012. Dalam melakukan penilaian, Manajemen Peru-sahaan menggunakan kriteria yang telah ditetapkan oleh kontrol internal. Berdasarkan penilaian ini, mana-jemen menyimpulkan bahwa hingga 31 Desember 2012, pengendalian internal atas pelaporan keuangan Perusahaan telah efektif.

Sat Nusa juga memantau dan mengevaluasi kecuku-pan sistem pengendalian internal secara terus me-nerus berkaitan dengan adanya perubahan kondisi internal dan eksternal serta harus meningkatkan ka-pasitas sistem pengendalian internal tersebut agar efektivitasnya dapat ditingkatkan.Sat Nusa also monitors and evaluates the adequacy of the internal con-trol system continuously related to changes in the internal and external conditions as well as increasing the capacity of the internal control system so that its effectiveness can be improved.

Page 131: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 131

Manajemen Risiko

Risk Management

Page 132: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 132

1. PERSEROAN BEROPERASI PADA INDUSTRI YANG SANGAT KOMPETITIF

Perseroan bersaing dengan banyak penyedia jasa manufaktur elektronik. Beberapa pesaing Perseroan memiliki sumber daya yang lebih besar dan memiliki jaringan operasi internasional yang lebih terdiversi-fikasi dari pada Perseroan. Pesaing Perseroan meli-puti perusahaan independen berskala besar seperti Celestica Inc, Flextronics International Ltd, Hon Hai Precision Industry Co, Ltd, Jabil Circuit, Inc dan San-mina-SCI Corporation, serta perusahaan EMS yang lebih kecil yang memiliki fokus spesifik pada daerah, produk, jasa atau industri tertentu.

Perseroan mengalami persaingan yang ketat dan se-makin kompetitif seiring dengan banyak perusahaan yang memasuki pasar dimana Perseroan beroperasi, kompetitor yang ada memperluas kapasitas dan ter-jadi konsolidasi pada industri tersebut. Terdapatnya kelebihan kapasitas produksi pada kompetitor Pers-eroan menciptakan persaingan harga yang intens dan memberikan tekanan kompetitif pada industri EMS secara keseluruhan. Untuk bersaing secara efektif, Perseroan harus terus memberikan layanan manu-faktur berteknologi tinggi, mempertahankan standar kualitas yang tinggi, merespon secara fleksibel dan cepat terhadap perubahan desain dan jadwal pelang-gan dan menghasilkan produk dengan kualitas yang dapat diandalkan dengan harga bersaing.

2. BISNIS PERSEROAN MUNGKIN TERKENA DAMPAK BENCANA ALAM

Beberapa vendor Perseroan, termasuk pabrik pel-anggan Perseroan, yang berada di daerah yang mung-kin terkena dampak oleh badai angin, gempa bumi, kekurangan air, tsunami, banjir, topan, kebakaran, kondisi cuaca ekstrim dan bencana alam atau buatan manusia lainnya.

Fungsi manajemen risiko merupakan tanggung jawab seluruh jajaran manajemen pada setiap unit bisnis; dengan tugas mengidentifikasi dan mengelola risiko sesuai dengan wewenang yang melekat pada masing-masing unit terkait.

KerangkarisikodanlangkahmitigasiBerikut ini adalah beberapa risiko utama yang berpo-tensi mengakibatkan dampak yang kurang mengun-tungkan bagi kegiatan operasional bisnis:

Risk management is the accountability of man-agement personnel at all business level; to iden-tify and manage risks in accordance with their area of responsibility.

riskframeworkandmitigationstepsThe Company has identified the following key risks that may negatively impact its business:

1. WE OPERATE IN A HIGHLY COMPETITIVE INDUSTRY

We compete against many providers of electron-ics manufacturing services. Certain of our com-petitors have substantially greater resources and more geographically diversified international operations than we do. Our competitors include large independent manufacturers such as Ce-lestica Inc., Flextronics International Ltd., Hon Hai Precision Industry Co., Ltd., Jabil Circuit, Inc. and Sanmina-SCI Corporation, as well as smaller EMS companies that often have a regional, product, service or industry-specific focus.

We experience intense competition, which can in-tensify further as more companies enter the mar-kets in which we operate, as existing competitors expand capacity and as the industry consolidates. The availability of excess manufacturing capacity at many of our competitors creates intense pricing and competitive pressure on the EMS industry as a whole. To compete effectively, we must continue to provide technologically advanced manufactur-ing services, maintain strict quality standards, re-spond flexibly and rapidly to customers design and schedule changes and deliver products globally on a reliable basis at competitive prices.

2. OUR BUSINESS MAY BE IMPACTED BY NATURAL DISASTERS

Some of our vendors, including our customers’ factories, are located in areas which may be im-pacted by hurricanes, earthquakes, water short-ages, tsunamis, floods, typhoons, fires, extreme weather conditions and other natural or manmade disasters.

Page 133: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 133

3. PERSEROAN TEREKSPOS PADA PERUBAHAN KONDISI EKONOMI, YANG DAPAT MEMILIKI DAMPAK MATERIAL YANG NEGATIF

TERHADAP BISNIS, HASIL OPERASI DAN KONDISI KEUANGAN PERSEROAN

Bisnis Perseroan memiliki siklus dan pernah men-galami kemerosotan ekonomi dan industri. Jika kondisi ekonomi dan permintaan produk pelanggan Perseroan memburuk, Perseroan mungkin akan mengalami dampak material yang negatif terhadap bisnis, hasil operasi dan kondisi keuangan Perseroan. Akibatnya, pesanan pelanggan dapat menurun dan berdampak negatif pada hasil keuangan Perseroan. Perseroan se-dang menjajaki segmen berbagai bisnis dan diversifi-kasi portofolio pelanggan Perseroan untuk menguran-gi ketergantungan Perseroan pada pelanggan tertentu.

4. PERSEROAN TEREKSPOS PADA RISIKO MENINGKATNYA UPAH MINIMUM KOTA DI BATAM

Setiap tahun gubernur setempat akan mengada-kan forum diskusi dengan serikat buruh dan asosiasi pengusaha (Apindo) untuk membahas kenaikan upah minimum kota. Akan ada risiko di mana serikat buruh di Batam akan mengancam untuk mengadakan aksi unjuk rasa atau pemogokan sebagai bentuk penolakan mereka terhadap gaji minimum kota yang ditetapkan oleh Gubernur Kepulauan Riau. Pemogokan dapat ber-dampak signifikan terhadap kegiatan produksi Pers-eroan sehari-hari dan Perseroan mungkin harus me-nanggung kerugian sebagai akibat yang ditimbulkan dari pemogokan kerja. Perseroan telah bekerja erat dengan pejabat pemerintah dan pejabat terkait serta memiliki diskusi diplomatik dengan serikat buruh un-tuk menjaga Batam sebagai tempat yang aman bagi zona industri.

3. WE ARE EXPOSED TO GENERAL ECONOMIC CONDITIONS, WHICH COULD HAVE A

MATERIAL ADVERSE IMPACT ON OUR BUSINESS, OPERATING RESULTS AND FINANCIAL CONDITION

Our business is cyclical and has experienced eco-nomic and industry downturns. If the economic conditions and demand for our customers’ prod-ucts deteriorate, we may experience a material adverse impact on our business, operating results and financial condition. As a result, customer or-ders may be lower and our financial results may be adversely affected. We are exploring various business segments and diversify our customer portfolio to reduce our dependency on certain customers.

4. WE ARE EXPOSED TO THE RISK OF INCREASING IN MINIMUM WAGES IN BATAM

Each and every year the local governors will hold a discussion forum with labor unions and business people association (Apindo) to address the annual increment of minimum wages. There will be risk where Labor unions in Batam will threaten to hold rallies or strikes as a form of their rejection of the announced workers’ minimum salary set by Riau Islands Governor. The strike may impose signifi-cant impact on our overall company daily produc-tion activities and we may have to incur losses in conjunction with the labor strike. We have been working closely with government officials and re-lated officials as well as have a diplomatic discus-sion with labor unions in order to maintain Batam as safe haven for industrial zone.

Pada tahun 2011 terdapat beberapa bencana besar yang timbul dan berdampak signifikan terhadap ran-tai pasokan industri EMS seperti gempa bumi, Tsu-nami Jepang, dan ledakan pembangkit listrik nuklir di Fukushima serta bencana banjir di Thailand yang menyebabkan kekurangan bahan baku, penundaan proyek, ditutupnya sementara pabrik pelanggan yang berakhir pada penurunan yang signifikan pada pen-jualan Perseroan. Perseroan secara intensif berkoor-dinasi dengan vendor dan pelanggan untuk mencari sumber bahan baku yang langka dan mencari ven-dor baru yang memenuhi syarat. Perseroan me-mantau dengan cermat perkembangan situasi untuk mengambil tindakan yang diperlukan dan tindakan pencegahan sesuai dengan situasi terbaru.

In 2011 there were several major disasters that posed significant impact on the supply chain of EMS industry namely Japan earthquake, Tsunami and Explosion at Fukushima nuclear plant as well as flooding catastrophe in Thailand that caused raw material shortage, project delay, our custom-ers plant temporarily shut down which end up in significant decline on our sales. We intensively co-ordinate with our vendors and customers to source for scarce raw material and qualify new vendors. We closely monitored the development of the situ-ation in order to take necessary actions and pre-caution in accordance with the latest situation.

Page 134: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 134

PERKARA PENTING YANG DIHADAPI SAT NUSA

Evaluasi Efektifitas Sistem Manajemen Risiko

SANKSI ADMINISTRATIf

Material Litigation Involving Sat Nusa

Evaluation of Effectiveness of Risk Management System

Administrative sanctions

Permasalahan hukum adalah permasalahan hukum perdata dan pidana yang dihadapi Sat Nusa terutama terkait dengan proses bisnis selama periode tahun laporan dan telah diajukan melalui proses hukum. Se-lama tahun 2012, tidak ada anggota Direksi dan Dewan Komisaris Sat Nusa yang sedang menjabat memiliki permasalahan hukum, baik perdata maupun pidana.

Risiko Inheren meliputi strategi bisnis, karakteristik bisnis, kompleksitas produk dan aktivitas Perseroan, industri dimana Perseroan melakukan kegiatan us-aha, serta kondisi makro ekonomi. Sedangkan Kuali-tas Penerapan Manajemen Risiko meliputi tata kelola risiko, kerangka manajemen risiko, proses manajemen risiko, kecukupan sumber daya manusia, dan kecuku-pan sistem informasi manajemen, serta kecukupan sistem pengendalian risiko.

Manajemen senantiasa melakukan tinjauan atas efek-tivitas dan konsistensi kegiatan manajemen risiko ser-ta dibuat rekomendasi untuk tindak lanjut ke depan. Evaluasi efektifitas sistem manajemen risiko terus di-lakukan guna untuk meminimalisasi risiko-risiko yang dihadapi oleh Perseroan dalam menjalankan usahanya.

Selama tahun 2012 tidak ada sanksi administratif yang dikenakan oleh otoritas pasar modal atau otoritas lain-nya kepada Perusahaan, anggota Dewan Komisaris maupun anggota Direksi Sat Nusa.

Legal problem includes criminal and civil cases that involve Sat Nusa particularly the ones relat-ed to business process and have been processed during any fiscal year. During 2012, there was no member of the Board of Directors and the Board of Commissioners involved both in any criminal or civil legal case.

Inherent risks include business strategy, busi-ness characteristics, complexity of the products and Company’s activities, the industry in which the Company operates, as well as macroeconomic conditions. While Quality Risk Management in-cludes risk governance, risk management frame-work, risk management processes, the adequacy of human resources, and the adequacy of infor-mation systems management, as well as the ad-equacy of the risk management system.

Management continues to conduct a review of the effectiveness and consistency of risk manage-ment activities and made recommendations to be followed-up in the future. Evaluation of the effec-tiveness of risk management systems is meant to minimize the ongoing risks faced by the Company in operating its business.

During 2012 there were no administrative sanc-tions imposed by the capital market authority or other authority to the Company, the Board of Commissioners and the Board of Directors of Sat Nusa.

Page 135: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 135

AKSES TERHADAP INfORMASIAccess to Information

informATiondissEminATion

Transparency requires the company be timely in disclosing adequate information on corporate performance. The disclosure is important to enable stakeholders to effectively monitor the management and the company performance.

Implementation of this principle includes several aspects: • Disclosure of financial statements which report all material financial information and accounting principles

& polices of the independent auditor.• Timely disclosure of other material information to the public.• Accessibility of information by using the website, mailing lists, conference calls, analyst meetings, plants

visits, brochures, the company profile, and mass media.

Sat Nusa seeks to provide information access to stakeholders through development of strong and reliable information technology. Sat Nusa realizes that information distribution to stakeholders is an important part of implementing the transparency principle. Information distribution is conducted through website: www. satnusa.com

In addition, information related to Sat Nusa can also be accessed through Corporate Secretary Division with the address:

Head Office of PT Sat Nusapersada TbkJl. Pelita VI No.99 Batam 29432 – Indonesia

Telp : +62 778 425 888Fax : +62 778 426 988

PEnyEBaran informasi

Transparansi mengharuskan perusahaan tepat waktu dalam pengungkapan informasi yang memadai tentang kinerja perusahaan. Pengungkapan tersebut penting agar memungkinkan para stakeholder un-tuk secara efektif memonitor manajemen dan kinerja perusahaan.

Penerapan prinsip ini meliputi beberapa aspek:• Pengungkapan laporan keuangan yang melaporkan semua informasi material keuangan dan prinsip

akuntansi & kebijakan auditor independen.• Tepat waktu dalam pengungkapan informasi material lainnya kepada publik.• Aksesibilitas informasi dengan menggunakan situs web, milis, panggilan konferensi, pertemuan ana-

lis, kunjungan pabrik, brosur, profil perusahaan, dan media massa.

Sat Nusa berusaha untuk menyediakan akses informasi kepada stakeholder melalui pengembangan teknologi informasi yang kuat dan dapat diandalkan. Sat Nusa menyadari bahwa penyebaran informasi kepada stakeholder adalah bagian penting dari penerapan prinsip transparansi. Distribusi informasi di-lakukan melalui website: www.satnusa.com

Selain itu, informasi yang terkait dengan Sat Nusa juga dapat diakses melalui Divisi Sekretaris Perusa-haan dengan alamat:

Kantor Pusat PT Sat Nusapersada TbkJl. Pelita VI No.99 Batam 29432 - Indonesia

Telp: +62 778 425 888Faks: +62 778 426 988

Page 136: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 136

SISTEM PELAPORAN PELANGGARAN

WHISTLEBLOWING SYSTEM

Enter to report

The company always treats the interests of stake-holders based on the principles of fairness and equality. The company also realized that the lack of standards mechanism in handling the reporting of violations of stakeholders can result in lowering the reputation and public confidence in the Com-pany. The provisions of the Code and Procedure for violation reporting is one of the form of increasing stakeholder protection and the protection of the reputation of the Company. Related to the above issue, in the framework of the implementation of guidelines and procedures, the Company sees the needs to have reporting violation mechanisms as described below.

Perseroan senantiasa memperhatikan kepentingan stakeholder berdasarkan asas kewajaran dan keseta-raan. Perseroan juga menyadari bahwa tidak adanya mekanisme standar dalam penanganan Pelaporan Pelanggaran oleh stakeholder dapat berakibat men-urunkan reputasi dan kepercayaan masyarakat pada Perseroan. Ketentuan-ketentuan dalam Pedoman dan Prosedur Pelaporan Pelanggaran ini merupa-kan salah satu bentuk peningkatan perlindungan terhadap stakeholder dan perlindungan terhadap nama baik Perseroan. Berkaitan dengan hal terse-but di atas, dalam rangka pelaksanaan pedoman dan prosedur, Perseroan menganggap perlu adanya mekanisme Pelaporan Pelanggaran sebagaimana di-uraikan di bawah ini.

Tujuan Sistem Pelaporan Pelanggaran (WBS) sendiri adalah: 1. Menciptakan iklim yang kondusif dan mendorong

pelaporan terhadap hal-hal yang dapat menim-bulkan kerugian finansial maupun non-finansial, termasuk hal-hal yang dapat merusak citra or-ganisasi;

2. Mempermudah manajemen untuk menangani secara efektif laporan-laporan pelanggaran dan sekaligus melindungi kerahasiaan identitas pe-lapor serta tetap menjaga informasi ini dalam ar-sip khusus yang dijamin keamanannya;

3. Membangun suatu kebijakan dan infra struktur untuk melindungi pelapor dari balasan pihak-pihak internal maupun eksternal;

4. Mengurangi potensi kerugian yang terjadi karena pelanggaran melalui deteksi dini;

5. Meningkatkan reputasi Perseroan.

Objectives for Whistle Blowing System (WBS) itself are as follow:1. Creating a climate that is conducive and encour-

aging the reporting of things that can lead to fi-nancial and non-financial loss, including things that can damage the image of the organization;

2. Simplify management to deal effectively with re-ports of violations and simultaneously protect the confidentiality of the identity of the reporter and maintain this information in a special file with guaranteed security;

3. Establish reporting policy and infrastructure to protect reporter from retaliation by internal and/or external parties;

4. Reducing potential losses due to violations through early detection;

5. Improving the company’s reputation.

tujuan oBjEctivE

Page 137: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 137

Acts that can be reported (offense) is an act which in the view of the reporter in good faith is the act as follows: • corruption;• cheating;• dishonesty;• Act in violation of the Collective Labor Agree-

ment;• Transgression of the law (including theft, the use

of violence against employees or leaders, extor-tion, drug use, abuse, other crimes);

• Violations of tax regulations, or other regulations (environmental, mark-up, under invoice, em-ployment, etc..);

• Corporate Code of Conduct violations or viola-tions of the norms of decency in general;

• Actions that endanger health and safety, or jeop-ardize the security of the company;

• Actions that may cause financial loss or non-financial detriment to the interests of the com-pany or enterprise;• Violations of standard operating procedures

(SOP) of the company, especially in relation to the procurement of goods and services, the pro-vision of benefits and remuneration;• The Company may increase or reduce the list of

acts that can be reported.

Perbuatan yang dapat dilaporkan (pelanggaran) ada-lah perbuatan yang dalam pandangan pelapor den-gan iktikad baik adalah perbuatan sebagai berikut: •Korupsi;•Kecurangan; •Ketidakjujuran; •Perbuatan yang melanggar Perjanjian Kerja Ber-

sama;•Perbuatan melanggar hukum (termasuk pencu-

rian, penggunaan kekerasan terhadap karyawan atau pimpinan, pemerasan, penggunaan narkoba, pelecehan, perbuatan kriminal lainnya);

•Pelanggaran ketentuan perpajakan, atau pera-turan perundang-undangan lainnya (lingkungan hidup, mark-up, under invoice, ketenagakerjaan, dll.);

•Pelanggaran Pedoman Etika Perusahaan atau pelanggaran norma-norma kesopanan pada um-umnya;

•Perbuatan yang membahayakan keselamatan dan kesehatan kerja, atau membahayakan keamanan Perseroan;

•Perbuatan yang dapat menimbulkan kerugian fi-nansial atau non-finansial terhadap Perseroan atau merugikan kepentingan Perseroan;

•Pelanggaran prosedur operasi standar (SOP) Pers-eroan, terutama terkait dengan proses pengadaan barang dan jasa, pemberian manfaat serta remu-nerasi;

•Perseroan dapat menambah atau mengurangi daf-tar perbuatan yang dapat dilaporkan.

PErBuatan yang daPat dilaPorkan acts that can BE rEPortEd

Perseroan menerima setiap Pelaporan Pelanggaran yang di ajukan oleh : • Karyawan;• Pemasok;• Pelanggan;• Investor;• Bank ;• dan semua pemangku kepentingan lainnya baik

dari pihak internal maupun pihak eksternal.

The Company receives any Reporting Violations filed by:• Employee;• Supplier;• Customer;• Investor;• Bank ;• and all other stakeholders from both internal

and external parties.

PEnErimaan PElaPoran accEPtancE of rEPorting

• Menyampaikan surat resmi yang ditujukan kepa-da Perseroan melalui Dewan Komisaris, dengan cara diantar langsung, dikirim melalui facsimile, atau melalui pos ke Perseroan;

• Melalui e-mail: [email protected];• Kotak Saran yang tersedia;• Disampaikan ke alamat resmi:

• Official letter addressed to the Company through the Board of Commissioners, by direct delivery, sent by facsimile, or by mail to the Company;

• Through e-mail: [email protected];• Available suggestion boxes;• Presented to the official address:

PTsATnUsAPErsAdATbkJl. Pelita VI No.99 Batam 29432- Indonesia

Telp : + 62 778 425 888Fax : +62 778 426 988

cara mEnyamPaikan PElaPoran PElanggaran kE PErusahaan

how to suBmit violations rEPorting to thE comPany

Page 138: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 138

Perseroan berkomitmen untuk melindungi pelapor pelanggaran yang beriktikad baik dan Perseroan akan patuh terhadap segala peraturan perundangan yang terkait serta best practices yang berlaku dalam penyelenggaraan Sistem Pelaporan Pelanggaran (Whistleblowing System).

Seorang pelapor pelanggaran akan mendapatkan perlindungan dari perusahaan terhadap perlakuan yang merugikan seperti:• Pemecatan yang tidak adil; • Penurunan jabatan atau pangkat; • Pelecehan atau diskriminasi dalam segala ben-

tuknya; • Catatan yang merugikan dalam file data pribadin-

ya

The Company is committed to protect the well in-tentioned of violations reporter and the Company will adhere to all relevant legislation and best prac-tices prevailing in Whistle Blowing System.

A violations reporter will get protection from the company against harmful treatments such as:• Unfair dismissal; • Demotion • Harassment or discrimination of any kind;• Notes that harm the personal data file

kEBijakan PErlindungan PElaPor rEPorting ProtEction Policy

Berkas ditutupThe case is closed

Berkas ditutupThe case is closed

PelaporanReporting

usulan penindakan sesuai peraturanProposed appropriate regulatory

action

administratif(sekretariat dekom) Administrative (Board of commissioners Secretariat)

komite audit, komite gcg, dan pihak lain yang diperlukan oleh tim Evaluasi Pengaduan

Audit Committee, Corporate Governance Committee, and others are required byComplaint Evaluation Team

internal audit/satuan kerja lain Internal Audit / Other Unit

Perlu diinvestigasi?Need to be

investigated?

hasilinvestigasiResults of

Investigation

tidak dapat dibuktikan

dapat dibuktikan

tidak perlu diinvestigasiNo need to be investigated

Can not be proven

Can be proven

Need to be investigatedPerlu diinvestigasi

ProsEdur PEnanganan PElaPoran PElanggaranwhistlE Blowing systEm ProcEdurE

Selama tahun 2012, Perseroan menerima satu kasus pelaporan mengenai pemalsuan Ijazah dan setelah ditelusuri ternyata benar karyawan tersebut meng-gunakan ijazah orang lain. Setelah dikonfirmasi kebe-narannya akhirnya karyawan yang memalsukan Ijazah tersebut mengundurkan diri pada tanggal 09 Agustus 2012 atas persetujuan atasannya.

During 2012, the Company received a report on Certifi-cates forgery case and after the investigation, it was proved that the employee was using the certificate of others. Once the truth had been confirmed, the employee who falsified Certificates resigned on August 9, 2012 with the approval of her superiors.

Page 139: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 139

Kode etik adalah dasar perilaku dan tindakan yang diterapkan kepada seluruh karyawan dan harus dilaksanakan sehubungan dengan nilai-nilai pe-rusahaan untuk menegakkan integritas. Sat Nusa memiliki kode etik yang berisi pedoman perilaku se-hari-hari untuk diterapkan kepada seluruh karyawan termasuk Direksi dan Dewan Komisaris.

Sejalan dengan usaha penerapan Good Corporate Governance (GCG) termasuk di dalamnya pem-berantasan korupsi, kolusi, dan nepotisme (KKN), serta penegakan Kode Etik Perusahaan, Sat Nusa bertekad untuk menciptakan kegiatan operasional Perusahaan yang terbebas dari praktik-praktik KKN serta menjunjung tinggi kode etik Perusahaan, di-mana Perusahaan berusaha untuk meningkatkan peran serta secara aktif dari seluruh unsur Peru-sahaan, dan para pemangku kepentingan lainnya melalui suatu mekanisme penanganan yang adil dan transparan, salah satunya melalui Sistem Pelaporan Pelanggaran atau Whistle Blowing System (WBS).

Keberadaan Kode Etik dimaksudkan untuk mengatur individu dalam perusahaan bersikap, berperilaku, berinteraksi dan melakukan proses kerja dengan pihak-pihak di dalam dan di luar perusahaan dalam membangun budaya kerja dan budaya perusahaan. Setiap individu di perusahaan wajib mematuhi Kode Etik ketika melaksanakan pekerjaannya. Kode Etik mengatur hubungan antara Perseroan sebagai suatu entitas dengan pelanggan, pemegang saham, indi-vidu dalam perusahaan, pemasok, kreditur, komu-nitas (publik), pemerintah, auditor, media massa, pesaing, serta menjelaskan bagaimana Perseroan (sebagai suatu entitas) beretika, bersikap dan bertin-dak dalam upaya menyeimbangkan kepentingan pe-rusahaan dengan seluruh Stakeholder.

sebagai salah satu Perusahaan perakitan elektronik terkemuka di indone-sia maka penegakkan nilai-nilai Perusahaan menjadi sangat penting bagi pengembangan dan kelangsungannya. untuk itu sat nusa menerapkan standar pedoman dan prosedur kode etik.As one of the leading electronics assembly company in Indonesia, the enforcement of the Company’s values be-come very important for the development and sustainability. For that Sat Nusa implements standard guidelines and procedures for code of conduct.

Code of Conduct is the basis of the behavior and ac-tions that apply to all employees and must be im-plemented in connection with the company’s values to uphold integrity. Sat Nusa has a code of conduct that provides guidelines for everyday behavior to be applied to all employees including Board of Directors and Board of Commisioners.

In line with the effort of implementing Good Corpo-rate Governance (GCG) practices, which include the eradication of practices of corruption, collusion and nepotism (KKN) as well as the enforcement of the Code of Conduct of the Company, Sat Nusa is com-mitted to create an environment of operational ac-tivities that are free from practices of KKN, and to uphold the Code of Conduct, in which the Company seeks to increase the active participation from all elements of the Company and other stakeholders through a fair and transparent handling mechanism, including through a Whistle Blowing System (WBS).

Code of Conduct regulates the company staff’s be-havior and attitude in interacting and performing working process with internal and external parties to develop working culture and company’s culture.Each individual in the company is obliged to comply with the Code of Conduct in doing their jobs. Code of Conducts regulates the relationship between the company as an entity and customers, sharehold-ers, individuals in the company, suppliers, creditors, community (public), government, auditor, mass me-dia, competitors; and explain how the company (as an entity) comply with ethics, act and perform in at-tempt to balance the interests of the company and all stakeholders.

kode etik

code of conduct

kEBEradaan kodE Etik thE EXistEncE of codE of conduct

CONTINUOUSIMPROVEMENT

Page 140: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 140

Sosialisasi penerapan Kode Etik senantiasa dilaku-kan pihak manajemen kepada seluruh karyawan Sat Nusa maupun stakeholders antara lain melalui:•Menyosialisasikan Kode Etik kepada seluruh jaja-

ran manajemen puncak dan melakukan penyega-ran secara berkala bagi seluruh pejabat puncak dalam Perseroan;

•Menyosialisasikan Kode Etik dalam program ori-entasi individu baru dalam Perseroan dan pe-nyegaran secara berkala bagi seluruh karyawan dalam Perusahaan.

Berikut adalah upaya penerapan Kode Etik di Sat Nusa: •Mengaitkan penerapan Kode Etik sebagai bagian

tidak terpisahkan dari praktek kerja dan penilaian karya seluruh individu dalam Perusahaan;

•Mengembangkan Kode Etik yang sudah ada dan menjabarkannya menjadi berbagai kebijakan dan peraturan Perusahaan;

•Melengkapi peraturan Perusahaan dengan sanksi atas pelanggaran dan membangun sistem untuk memantau penerapan Kode Etik.

The socialization of the Code of Conduct imple-mentation will be done by the management to all employees of Sat Nusa and stakeholders through:• Socializing Code of Conduct to all top manage-

ment levels and holding regular refreshing activities for all top management authorities in the company;• Socializing the Code of Conduct in new employee

orientation program of the company and hold-ing regular refreshing activities for all company employees.

Below are the efforts to implement Code of Conduct in Sat Nusa:•Relate the implementation of Code of Conduct as

inseparable part to work practices and assess-ment of all individual work in the company;•Develop existing Code of Conduct and elaborate it

to several policies and regulations of the com-pany;• Complete the company regulation with the sanc-

tion toward the violation and build system to monitor the application of Code of Conduct.

sosialisasi dan PEnEgakan kodE Etik

SoCializaTion anD enforCemenT of CoDeS of ConDUCT

Kode Etik ini dibagi menjadi beberapa bagian:•Prinsip prinsip umum;•Perilaku profesional;•Penggunaan properti, informasi dan sumber daya

perusahaan;•Perilaku pribadi;•Kepatuhan terhadap hukum dan peraturan;•Kesempatan kerja yang sama;•Kewajiban dalam melaporkan pelanggaran;•Aktivitas politik.

The Policy is broken into the following sections:•General principles;•Professional conduct;•Use of company property, information and

resources;•Personal conduct;•Compliance with laws and regulations;•Equal employment opportunity;•Obligation to report breaches;•Political activities.

isi kodE Etik thE contEnt of codE of conduct

sasaran kodE Etik

Tujuan Kebijakan Kode Etik adalah:• Sebagai pedoman dalam merumuskan kebijakan,

prosedur dan praktek yang ada dalam manaje-men Perusahaan;

• Sebagai pedoman dasar untuk perilaku dan tin-dakan karyawan dalam menjalankan tugas dan pengambilan keputusan;

• Memberikan wawasan kepada karyawan menge-nai kesopanan karyawan dalam hubungan antara satu sama lain, hubungan dengan perusahaan, hubungan dengan pelanggan, hubungan den-gan pesaing, hubungan dengan pemerintah atau hubungan dengan stakeholder lainnya.

codE of Ethics oBjEctivEs

The purposes of the Code of Ethics Policies are: • As a guideline in formulating policies, procedures

and practices that exist in the Company’s man-agement;

• As a basic guideline for manners and actions of employees in performing their duties and decision making;

• Provide insight to employees regarding the pro-priety of employees in relationships among each other, the relationship with the company, rela-tionships with customers, relationships with com-petitors, relations with the authorities or relation-ships with other stakeholders.

Page 141: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 141

PErnyataan Budaya PErusahaan THe STaTemenT of CorporaTe CUlTUre

Sat Nusa memiliki komitmen tinggi untuk mem-bangun budaya kerja yang berlaku di perusahaan sehingga diharapkan dapat mewujudkan lingkungan kerja yang kondusif untuk mencapai visi dan misi perusahaan. Pernyataan mengenai Budaya Peru-sahaan tercantum di dalam Tata Nilai Perusahaan, yang terdiri dari Integritas, Disiplin, Ramah Lingkun-gan, Nilai Tambah, dan Keamanan. Sistem nilai yang dikembangkan dalam perusahaan, diharapkan dapat mengubah sikap dan perilaku Sumber Daya Manusia (SDM) sehingga memunculkan motivasi yang tinggi, kepuasan kerja meningkat, sikap dan tindakan tera-rah, pergaulan yang lebih akrab, disiplin meningkat, tumbuhnya kemauan untuk terus belajar serta me-miliki tanggung jawab untuk memberikan yang ter-baik bagi Perseroan.

Budaya Perusahaan merupakan nilai-nilai dan filosofi bahwa semua anggota di Perusahaan telah sepakat untuk menerimanya sebagai dasar dan pedoman bagi Perusahaan untuk mencapai tujuan-nya.

Sat Nusa is highly commited to build the work cul-ture applicable in the company in order to be able to create conducive working environment to realize the vision and mission of the company. The statement of the corporate culture is written in the Company Values, involving Integrity, Discipline, Eco Friendly, Added Value, and Safety. The values developed in the company are expected to alter the attitude and behavior of the human resources of the company to bring out the strong motivation, increase the work satisfaction, direct attitude and behavior, create friendly relations, increase discipline, grow the pas-sion to keep studying, and have responsibility to give the best to the company.

The corporate culture represents the values and phi-losophies that all the members in the Company have agreed to accept as the foundation and the guidance for the Company to achieve its goals.

Page 142: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 142

SURAT PERNYATAAN ANGGOTA DEWAN KOMISARIS DAN DIREKSI

TENTANG TANGGUNGJAWAB ATAS LAPORAN TAHUNAN 2012

PT SAT NUSAPERSADA TbkBOARD OF COMMISSIONERS AND BOARD OF DIRECTORS’ STATEMENT ABOUT

RESPONSIBILITy FOR PT SAT NUSAPERSADA Tbk ANNUAL REPORT 2012

Kami yang bertanda tangan di bawah ini menyata-kan bahwa semua informasi dalam laporan tahunan PT Sat Nusapersada Tbk tahun 2012 telah dimuat secara lengkap dan bertanggung jawab penuh atas kebenaran isi laporan tahunan perusahaan.

Demikian pernyataan ini dibuat dengan sebenarnya.

We the undersigned hereby declare that all information in the 2012 annual report of PT Sat Nusapersada Tbk has been exhaustive and solely responsible for the accuracy of the content of the company’s annual report.

This statement is made in truth.

sofjanwanandiKomisaris Utama | President Commissioner

UsmanfanKomisaris | Commissioner

Anas,s.EKomisaris IndependenIndependent Commissioner

AbidinDirektur UtamaPresident Director

Bidinyusuf Direktur Operasional Operational Director

megawatiDirektur Keuangan (Tidak Terafiliasi)Finance Director (Non Affiliated)

DIRECTORS OF THE COMPANYCOMMISSIONERS OF THE COMPANYdEwAnKomisArisPErsEroAn dirEKsiPErsEroAn

Page 143: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 143

BEnTUKdAnisilAPorAnTAhUnAn halaman

a.KetentuanUmum

1) Laporan Tahunan wajib memuat:

a. ikhtisar data keuangan penting; 09

b. laporan Dewan Komisaris; 16-19

c. laporan Direksi; 20-23

d. profil perusahaan; 24-49

e. analisis dan pembahasan manajemen; 58-85

f. tata kelola perusahaan; 108-141

g. tanggung jawab sosial perusahaan; 86-105

h. laporan keuangan tahunan yang telah diaudit; dan v

i. surat pernyataan tanggung jawab Dewan Komisaris dan Direksi atas kebenaran isi laporan tahunan. 142

2) Laporan Tahunan wajib disajikan dalam bahasa Indonesia. Dalam hal Laporan Tahunan juga dibuat selain dalam bahasa Indonesia, baik dalam dokumen yang sama maupun terpisah, maka Laporan Tahunan dimaksud harus memuat informasi yang sama. Dalam hal terdapat perbedaan penafsiran akibat penerjemahan bahasa, maka yang digunakan sebagai acuan adalah Laporan Tahunan dalam bahasa Indonesia.

V

3) Laporan Tahunan wajib dibuat sedemikian rupa sehingga mudah dibaca. Gambar, grafik, tabel, dan diagram disajikan dengan mencantumkan judul dan/atau keterangan yang jelas.

V

4) Laporan Tahunan wajib dicetak pada kertas berwarna terang yang berkualitas baik, berukuran A4, dijilid, dan dimungkinkan untuk direproduksi dengan fotokopi. V

b.ikhtisardataKeuanganPenting

1) Ikhtisar data keuangan penting disajikan dalam bentuk perbandingan selama 3 (tiga) tahun buku atau sejak memulai usahanya.Jika perusahaan tersebut menjalan kan kegiatan usahanya selama kurang dari 3 (tiga) tahun, yang memuat paling kurang:

9

a. pendapatan; v

b. laba bruto; v

c. laba (rugi); v

d. jumlah laba (rugi) yang dapat diatribusikan kepada pemilik entitas induk dan kepentingan non pengendali; v

e. total laba (rugi) komprehensif; v

f. jumlah laba (rugi) komprehensif yang dapat diatribusikan kepada pemilik entitas induk dan kepentingan non pengendali; v

g. laba (rugi) per saham; v

h. jumlah aset; v

i. jumlah liabilitas; v

j. jumlah ekuitas; v

k. rasio laba (rugi) terhadap jumlah aset; v

l. rasio laba (rugi) terhadap ekuitas; v

m. rasio laba (rugi) terhadap pendapatan; v

n. rasio lancar; v

o. rasio liabilitas terhadap ekuitas; v

p. rasio liabilitas terhadap jumlah aset; dan v

q. informasi dan rasio keuangan lainnya yang relevan dengan perusahaan dan jenis industrinya. v

2) Laporan Tahunan wajib memuat informasi mengenai saham yang diterbitkan untuk setiap masa triwulan dalam 2 (dua) tahun buku terakhir (jika ada), paling kurang meliputi:

10-11

a. jumlah saham yang beredar; v

b. kapitalisasi pasar; v

c. harga saham tertinggi, terendah, dan penutupan; dan v

d. volume perdagangan. v

3) Dalam hal terjadi aksi korporasi, seperti pemecahan saham (stock split), penggabungan saham (reverse stock), dividen saham, saham bonus, dan penurunan nilai nominal saham, maka informasi harga saham sebagaimana dimaksud dalam angka 2), wajib ditambahkan penjelasan antara lain mengenai:

n/a

a. tanggal pelaksanaan aksi korporasi; -

b. rasio stock split, reverse stock, dividen saham, saham bonus, dan penurunan nilai saham; -

c. jumlah saham beredar sebelum dan sesudah aksi korporasi; dan -

d. harga saham sebelum dan sesudah aksi korporasi. -

4) Dalam hal perdagangan saham perusahaan dihentikan sementara (suspension) dalam tahun buku, maka Laporan Tahunan wajib memuat penjelasan mengenai alasan penghentian sementara tersebut.

n/a

5) Dalam hal penghentian sementara sebagaimana dimaksud dalam angka 4) masih berlangsung hingga tanggal penerbitan laporan tahunan, maka Emiten atau Perusahaan Publik wajib menjelaskan pula tindakan-tindakan yang dilakukan perusahaan untuk menyelesaikan masalah tersebut.

n/a

c.laporandewanKomisaris 16-19

Laporan Dewan Komisaris paling kurang memuat hal-hal sebagai berikut:

1) penilaian terhadap kinerja Direksi mengenai pengelolaan perusahaan; v

2) pandangan atas prospek usaha perusahaan yang disusun oleh Direksi; dan v

3) perubahan komposisi anggota Dewan Komisaris dan alasan perubahannya (jika ada). n/a

Referensi Peraturan OJK (d/h Bapepam LK)-No. X.K.6OJK (d/h Bapepam -LK) No.X.K.6 Cross Reference

Page 144: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 144

BEnTUKdAnisilAPorAnTAhUnAn halaman

d.laporandireksi 20-23

Laporan Direksi paling kurang memuat hal-hal sebagai berikut:

1) kinerja perusahaan, yang mencakup antara lain kebijakan strategis, perbandingan antara hasil yang dicapai dengan yang ditargetkan, dan kendala-kendala yang dihadapi perusahaan;

v

2) gambaran tentang prospek usaha; v

3) penerapan tata kelola perusahaan; dan v

4) perubahan komposisi anggota Direksi dan alasan perubahannya (jika ada). n/a

e.ProfilPerusahaan

Profil perusahaan paling kurang memuat hal-hal sebagai berikut:

1) nama, alamat, nomor telepon, nomor faksimile, alamat surat eletronik (e-mail), dan laman (website) perusahaan dan/atau kantor cabang atau kantor perwakilan, yang memungkinkan masyarakat dapat memperoleh informasi mengenai perusahaan;

25

2) riwayat singkat perusahaan; 25

3) kegiatan usaha perusahaan menurut Anggaran Dasar terakhir, serta jenis produk dan/atau jasa yang dihasilkan; 26-27

4) struktur organisasi perusahaan dalam bentuk bagan, paling kurang sampai dengan struktur satu tingkat di bawah Direksi, disertai dengan nama dan jabatan; 34

5) visi dan misi perusahaan; 30

6) profil Dewan Komisaris, meliputi: 36-37

a. nama; v

b. riwayat jabatan, pengalaman kerja yang dimiliki, dan dasar hukum penunjukkan pertama kali pada Emiten atau Perusahaan Publik, sebagaimana dicantumkan dalam berita acara keputusan RUPS;

v

c. riwayat pendidikan; v

d. penjelasan singkat mengenai jenis pelatihan dalam rangka meningkatkan kompetensi Dewan Komisaris yang telah diikuti dalam tahun buku (jika ada); dan -

e. pengungkapan hubungan afiliasi dengan anggota Direksi dan anggota Dewan Komisaris lainnya, serta pemegang saham (jika ada); v

7) profil Direksi, meliputi: 38-40

a. nama dan uraian singkat tentang tugas dan fungsi yang dilaksanakan; v

b. riwayat jabatan, pengalaman kerja yang dimiliki, dan dasar hukum penunjukkan pertama kali pada Emiten atau Perusahaan Publik, sebagaimana dicantumkan dalam berita acara keputusan RUPS;

v

c. riwayat pendidikan; v

d. penjelasan singkat mengenai jenis pelatihan dalam rangka meningkatkan kompetensi Direksi yang telah diikuti dalam tahun buku (jika ada); dan v

e. pengungkapan hubungan afiliasi dengan anggota Direksi lainnya dan pemegang saham (jika ada); v

8) dalam hal terdapat perubahan susunan Dewan Komisaris dan/atau Direksi yang terjadi setelah tahun buku berakhir sampai dengan batas waktu penyampaian Laporan Tahunan sebagaimana dimaksud dalam angka 1 huruf a, maka susunan yang dicantumkan dalam Laporan Tahunan adalah susunan Dewan Komisaris dan/ atau Direksi yang terakhir dan sebelumnya;

n/a

9) jumlah karyawan dan deskripsi pengembangan kompetensinya dalam tahun buku misalnya, aspek pendidikan dan pelatihan karyawan yang telah dilakukan; 52-57

10) uraian tentang nama pemegang saham dan persentase kepemilikannya pada akhir tahun buku yang terdiri dari: 106-107

a. pemegang saham yang memiliki 5% (lima perseratus) atau lebih saham Emiten atau Perusahaan Publik; v

b. Komisaris dan Direktur yang memiliki saham Emiten atau Perusahaan Publik; dan v

c. kelompok pemegang saham masyarakat, yaitu kelompok pemegang saham yang masing-masing memiliki kurang dari 5% (lima perseratus) saham Emiten atau Perusahaan Publik;

v

11) informasi mengenai pemegang saham utama dan pengendali Emiten atau Perusahaan Publik, baik langsung maupun tidak langsung, sampai kepada pemilik individu, yang disajikan dalam bentuk skema atau diagram;

107

12) nama entitas anak, perusahaan asosiasi, perusahaan ventura bersama dimana Emiten atau Perusahaan Publik memiliki pengendalian bersama entitas, beserta persentase kepemilikan saham, bidang usaha, dan status operasi perusahaan tersebut (jika ada). Untuk entitas anak, agar ditambahkan informasi mengenai alamat;

44-49

13) kronologis pencatatan saham dan perubahan jumlah saham dari awal pencatatan hingga akhir tahun buku serta nama Bursa Efek dimana saham perusahaan dicatatkan (jika ada);

107

14) kronologis pencatatan Efek lainnya dan peringkat Efek (jika ada); n/a

15) nama dan alamat perusahaan pemeringkat Efek (jika ada); n/a

16) nama dan alamat lembaga dan/atau profesi penunjang pasar modal. Terhadap profesi penunjang pasar modal yang memberikan jasa secara berkala kepada Emiten atau Perusahaan Publik, wajib diungkapkan informasi mengenai jasa yang diberikan, fee, dan periode penugasan yang telah dilakukan; dan

50-51

17) penghargaan dan sertifikasi yang diterima perusahaan baik yang berskala nasional maupun internasional dalam tahun buku terakhir (jika ada). 14-15

f.AnalisisdanPembahasanmanajemenlaporanTahunanwajibmemuaturaianyangmembahasdanmenganalisislaporankeuangandaninformasipentinglainnya dengan penekanan pada perubahan material yang terjadi dalam tahun buku, yaitu paling kurang mencakup:

58-85

1) tinjauan operasi per segmen operasi sesuai dengan jenis industri Emiten atau Perusahaan Publik, antara lain mengenai: 77-81

a. produksi, yang meliputi proses, kapasitas, dan perkembangannya; v

b. pendapatan; dan v

c. profitabilitas; v

Referensi Peraturan OJK (d/h Bapepam LK)-No. X.K.6OJK (d/h Bapepam -LK) No.X.K.6 Cross Reference

Page 145: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 145

BEnTUKdAnisilAPorAnTAhUnAn halaman

2) analisis kinerja keuangan komprehensif yang mencakup perbandingan kinerja keuangan dalam 2 (dua) tahun buku terakhir, penjelasan tentang penyebab adanya perubahan dan dampak perubahan tersebut, antara lain mengenai:

58-72

a. aset lancar, aset tidak lancar, dan total aset; 67-69

b. liabilitas jangka pendek, liabilitas jangka panjang, dan total liabilitas; 70

c. ekuitas; 71

d. pendapatan, beban, laba (rugi), pendapatan komprehensif lain, dan total laba (rugi) komprehensif; serta 60-66

e. arus kas; 72

3) kemampuan membayar utang dengan menyajikan perhitungan rasio yang relevan; 71

4) tingkat kolektibilitas piutang perusahaan dengan menyajikan perhitungan rasio yang relevan; 71

5) struktur permodalan dan kebijakan manajemen atas struktur permodalan tersebut; 73

6) bahasan mengenai ikatan yang material untuk investasi barang modal dengan penjelasan tentang tujuan dari ikatan tersebut, sumber dana yang diharapkan untuk memenuhi ikatan tersebut, mata uang yang menjadi denominasi, dan langkah-langkah yang direncanakan perusahaan untuk melindungi risiko dari posisi mata uang asing yang terkait;

74

7) informasi dan fakta material yang terjadi setelah tanggal laporan akuntan; 74

8) prospek usaha dari perusahaan dikaitkan dengan kondisi industri, ekonomi secara umum dan pasar internasional serta dapat disertai data pendukung kuantitatif dari sumber data yang layak dipercaya;

84-85

9) perbandingan antara target/proyeksi pada awal tahun buku dengan hasil yang dicapai (realisasi), mengenai pendapatan, laba, struktur permodalan, atau lainnya yang dianggap penting bagi perusahaan;

76

10) target/proyeksi yang ingin dicapai perusahaan paling lama untuk satu tahun mendatang, mengenai pendapatan, laba (rugi), struktur modal, kebijakan dividen, atau lainnya yang dianggap penting bagi perusahaan;

76

11) aspek pemasaran atas produk dan jasa perusahaan, antara lain: strategi pemasaran dan pangsa pasar; 82-83

12) kebijakan dividen dan tanggal serta jumlah dividen per saham (kas dan/atau non kas) dan jumlah dividen per tahun yang diumumkan atau dibayar selama 2 (dua) tahun buku terakhir;

75

13) realisasi penggunaan dana hasil penawaran umum: 74

a. dalam hal selama tahun buku, Emiten memiliki kewajiban menyampaikan laporan realisasi penggunaan dana, maka wajib diungkapkan realisasi penggunaan dana hasil penawaran umum secara kumulatif sampai dengan akhir tahun buku; dan

v

b. dalam hal terdapat perubahan penggunaan dana sebagaimana diatur dalam Peraturan Nomor X.K.4, maka Emiten wajib menjelaskan perubahan tersebut; v

14) informasi material, antara lain mengenai investasi, ekspansi, divestasi, penggabungan/peleburan usaha, akuisisi, restrukturisasi utang/modal, transaksi afiliasi, dan transaksi yang mengandung benturan kepentingan, yang terjadi pada tahun buku (jika ada), yang antara lain memuat:

74

a. tanggal, nilai, dan obyek transaksi; -

b. nama pihak yang bertransaksi; -

c. sifat hubungan afiliasi (jika ada); -

d. penjelasan mengenai kewajaran transaksi; dan -

e. pemenuhan ketentuan terkait; -

15) perubahan peraturan perundang-undangan yang berpengaruh signifikan terhadap perusahaan dan dampaknya terhadap laporan keuangan (jika ada); dan 76

16) perubahan kebijakan akuntansi, alasan dan dampaknya terhadap laporan keuangan (jika ada). 76

g.TataKelolaPerusahaan(Corporategovernance)

Tata kelola perusahaan memuat uraian singkat, yang paling kurang meliputi hal-hal sebagai berikut:

1) Dewan Komisaris, mencakup antara lain: 116-118

a. uraian pelaksanaan tugas Dewan Komisaris; v

b. pengungkapan prosedur, dasar penetapan, dan besarnya remunerasi anggota Dewan Komisaris; dan v

c. pengungkapan kebijakan perusahaan dan pelaksanaannya, tentang frekuensi rapat Dewan Komisaris, termasuk rapat gabungan dengan Direksi, dan tingkat kehadiran anggota Dewan Komisaris dalam rapat tersebut;

v

2) Direksi, mencakup antara lain: 119

a. ruang lingkup pekerjaan dan tanggung jawab masing-masing anggota Direksi; 120-122

b. pengungkapan prosedur, dasar penetapan, dan besarnya remunerasi anggota Direksi, serta hubungan antara remunerasi dengan kinerja perusahaan; 123

c. pengungkapan kebijakan perusahaan dan pelaksanaannya, tentang frekuensi rapat Direksi, termasuk rapat gabungan dengan Dewan 123

Komisaris, dan tingkat kehadiran anggota Direksi dalam rapat tersebut;

d. keputusan RUPS tahun sebelumnya dan realisasinya pada tahun buku, serta alasan dalam hal terdapat keputusan yang belum direalisasikan; dan 114-115

e. pengungkapan kebijakan perusahaan tentang penilaian terhadap kinerja anggota Direksi (jika ada); -

3) Komite Audit, mencakup antara lain: 42-43, 124-125

a. nama; v

b. riwayat jabatan, pengalaman kerja, dan dasar hukum penunjukkan; v

c. riwayat pendidikan; v

d. periode jabatan anggota Komite Audit; v

e. pengungkapan independensi Komite Audit; v

f. pengungkapan kebijakan perusahaan dan pelaksanaannya, tentang frekuensi rapat Komite Audit dan tingkat kehadiran anggota Komite Audit dalam rapat tersebut;

v

g. uraian singkat pelaksanaan kegiatan Komite Audit pada tahun buku sesuai dengan yang dicantumkan dalam piagam (charter) Komite Audit; v

Page 146: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 146

BEnTUKdAnisilAPorAnTAhUnAn halaman

4) komite lain yang dimiliki Emiten atau Perusahaan Publik dalam rangka mendukung fungsi dan tugas Direksi dan/atau Dewan Komisaris, seperti komite nominasi dan remunerasi, yang mencakup antara lain:

n/a

a. nama; -

b. riwayat jabatan, pengalaman kerja yang dimiliki, dan dasar hukum penunjukkan; -

c. riwayat pendidikan; -

d. periode jabatan anggota komite; -

e. pengungkapan kebijakan perusahaan mengenai independensi komite; -

f. uraian tugas dan tanggung jawab; -

g. pengungkapan kebijakan perusahaan dan pelaksanaannya, tentang frekuensi rapat komite dan tingkat kehadiran anggota komite dalam rapat tersebut; dan -

h. uraian singkat pelaksanaan kegiatan komite pada tahun buku; -

5) uraian tugas dan fungsi sekretaris perusahaan; 42, 126

a. nama; v

b. riwayat jabatan, pengalaman kerja yang dimiliki, dan dasar hukum penunjukkan; v

c. riwayat pendidikan; v

d. periode jabatan sekretaris perusahaan; v

e. uraian singkat pelaksanaan tugas sekretaris perusahaan pada tahun buku; v

6) uraian mengenai unit audit internal meliputi: 41, 127-128

a. nama; v

b. riwayat jabatan, pengalaman kerja yang dimiliki, dan dasar hukum penunjukkan; v

c. kualifikasi atau sertifikasi sebagai profesi audit internal (jika ada); v

d. struktur dan kedudukan unit audit internal; v

e. tugas dan tanggung jawab unit audit internal sesuai dengan yang dicantumkan dalam piagam (charter) unit audit internal; dan v

f. uraian singkat pelaksanaan tugas unit audit internal pada tahun buku; v

7) uraian mengenai sistem pengendalian interen (internal control) yang diterapkan oleh perusahaan, paling kurang mengenai: 129-130

a. pengendalian keuangan dan operasional, serta kepatuhan terhadap peraturan perundang-undangan lainnya; dan v

b. reviu atas efektivitas sistem pengendalian interen; v

8) sistem manajemen risiko yang diterapkan oleh perusahaan, paling kurang mengenai: 131-134

a. gambaran umum mengenai sistem manajemen risiko perusahaan; v

b. jenis risiko dan cara pengelolaannya; dan v

c. reviu atas efektivitas sistem manajemen risiko perusahaan; v

9) perkara penting yang dihadapi oleh Emiten atau Perusahaan Publik, entitas anak, anggota Dewan Komisaris dan Direksi yang sedang menjabat, antara lain meliputi:

134

a. pokok perkara/gugatan; -

b. status penyelesaian perkara/gugatan; dan -

c. pengaruhnya terhadap kondisi perusahaan. -

10) informasi tentang sanksi administratif yang dikenakan kepada Emiten atau Perusahaan Publik, anggota Dewan Komisaris dan Direksi, oleh otoritas pasar modal dan otoritas lainnya pada tahun buku terakhir (jika ada);

134

11) informasi mengenai kode etik dan budaya perusahaan (jika ada) meliputi: 139-141

a. pokok-pokok kode etik; v

b. pokok-pokok budaya perusahaan (corporate culture); v

c. bentuk sosialisasi kode etik dan upaya penegakannya; dan v

d. pengungkapan bahwa kode etik berlaku bagi Dewan Komisaris, Direksi, dan karyawan perusahaan; v

12) uraian mengenai program kepemilikan saham oleh karyawan dan/atau manajemen yang dilaksanakan Emiten atau Perusahaan Publik, antara lain jumlah, jangka waktu, persyaratan karyawan dan/atau manajemen yang berhak, serta harga exercise (jika ada); dan

-

13) uraian mengenai sistem pelaporan pelanggaran (whistleblowing system) di Emiten atau Perusahaan Publik yang dapat merugikan perusahaan maupun pemangku kepentingan (jika ada), antara lain meliputi:

136-138

a. cara penyampaian laporan pelanggaran; v

b. perlindungan bagi pelapor; v

c. penanganan pengaduan; v

d. pihak yang mengelola pengaduan; dan v

e. hasil dari penanganan pengaduan. v

h.TanggungJawabsosialPerusahaan(Corporatesocialresponsibility) 86-105

1) Bahasan mengenai tanggung jawab sosial perusahaan meliputi kebijakan, jenis program, dan biaya yang dikeluarkan, antara lain terkait aspek: v

a. lingkungan hidup, seperti penggunaan material dan energi yang ramah lingkungan dan dapat didaur ulang, sistem pengolahan limbah perusahaan, sertifikasi di bidang lingkungan yang dimiliki, dan lain-lain;

v

b. praktik ketenagakerjaan, kesehatan, dan keselamatan kerja, seperti kesetaraan gender dan kesempatan kerja, sarana dan keselamatan kerja, tingkat perpindahan (turnover) karyawan, tingkat kecelakaan kerja, pelatihan, dan lain-lain;

v

c. pengembangan sosial dan kemasyarakatan, seperti penggunaan tenaga kerja lokal, pemberdayaan masyarakat sekitar perusahaan, perbaikan sarana dan prasarana sosial, bentuk donasi lainnya, dan lain-lain; dan

v

d. tanggung jawab produk, seperti kesehatan dan keselamatan konsumen, informasi produk, sarana, jumlah dan penanggulangan atas pengaduan konsumen, dan lain-lain.

v

Page 147: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 147

BEnTUKdAnisilAPorAnTAhUnAn halaman

2) Emiten atau Perusahaan Publik dapat mengungkapkan informasi sebagaimana dimaksud dalam angka 1) pada Laporan Tahunan atau laporan tersendiri yang disampaikan bersamaan dengan Laporan Tahunan kepada Bapepam dan LK, seperti laporan keberlanjutan (sustainability report) atau laporan tanggung jawab sosial perusahaan (corporate social responsibility report).

v

i.laporanKeuanganTahunanyangTelahdiaudit

Laporan Keuangan Tahunan yang dimuat dalam Laporan Tahunan wajib disusun sesuai dengan Standar Akuntansi Keuangan di Indonesia yang telah diaudit oleh Akuntan. Laporan keuangan dimaksud wajib memuat pernyataan mengenai pertanggungjawaban atas Laporan Keuangan sebagaimana diatur pada Peraturan Nomor VIII.G.11 atau Peraturan Nomor X.E.1.

v

j.TandaTangandewanKomisarisdandireksi

1) Laporan Tahunan wajib ditandatangani oleh seluruh anggota Dewan Komisaris dan Direksi yang sedang menjabat. v

2) Tanda tangan sebagaimana dimaksud dalam angka 1) dibubuhkan pada lembaran tersendiri dalam Laporan Tahunan dimana dalam lembaran dimaksud wajib mencantumkan pernyataan bahwa anggota Dewan Komisaris dan Direksi bertanggung jawab penuh atas kebenaran isi laporan tahunan, sesuai dengan Formulir Nomor X.K.6-1 Lampiran Peraturan ini.

v

3) Dalam hal terdapat anggota Dewan Komisaris atau Direksi yang tidak menandatangani laporan tahunan, maka yang bersangkutan wajib menyebutkan alasannya secara tertulis dalam surat tersendiri yang dilekatkan pada laporan tahunan.

n/a

4) Dalam hal terdapat anggota Dewan Komisaris atau Direksi yang tidak menandatangani Laporan Tahunan dan tidak memberi alasan secara tertulis, maka anggota Dewan Komisaris atau Direksi yang menandatangani Laporan Tahunan wajib menyatakan secara tertulis dalam surat tersendiri yang dilekatkan pada laporan tahunan.

n/a

Referensi Peraturan OJK (d/h Bapepam LK)-No. X.K.6OJK (d/h Bapepam -LK) No.X.K.6 Cross Reference

Page 148: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk

DAN ENTITAS ANAK /AND SUBSIDIARY

LAPORAN KEUANGAN KONSOLIDASI

UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL

31 DESEMBER 2012 DAN 2011

DAN LAPORAN AUDITOR INDEPENDEN

CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

AND INDEPENDENT AUDITOR’S REPORT

Page 149: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY DAFTAR ISI TABLE OF CONTENTS

Halaman P a g e

SURAT PERNYATAAN DIREKSI BOARD OF DIRECTORS’ STATEMENT LAPORAN AUDITOR INDEPENDEN i INDEPENDENT AUDITOR’S REPORT LAPORAN POSISI KEUANGAN (NERACA) KONSOLIDASI PER 31 DESEMBER 2012 DAN 2011 DAN 1 JANUARI 2011 iii CONSOLIDATED STATEMENTS OF FINANCIAL POSITION (BALANCE SHEETS) AS OF DECEMBER 31, 2012 AND 2011 AND JANUARY 1, 2011 LAPORAN LABA RUGI KOMPREHENSIF KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 v CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011 LAPORAN PERUBAHAN EKUITAS KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 vii CONSOLIDATED STATEMENTS OF CHANGES IN EQUITY FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011 LAPORAN ARUS KAS KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 viii CONSOLIDATED STATEMENTS OF CASH FLOWS FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011 CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI 1 NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

Page 150: annual report 2012 laporan tahunan 1
Page 151: annual report 2012 laporan tahunan 1
Page 152: annual report 2012 laporan tahunan 1

i

KANTOR AKUNTAN PUBLIK

JOHAN MALONDA MUSTIKA & REKAN C e r t i f i e d P u b l i c A c c o u n t a n t s

J l . P l u i t R a y a 2 0 0 B l o k V N o . 1 - 5 J a k a r t a – 1 4 4 5 0 I n d o n e s i a Te l . : (62 -21 ) 661 -7155 Fax . : (62 -21 ) 663 -0455 E -m a i l : j m j k t@ j o h a nm a l o n d a . c om www . j o h a nm a l o n d a . c om W i t h O f f i c e s i n Su r ab ay a , Medan a n d Ba l i

www.bakertillyinternational.com

L i c en se No . : 951 /KM .1 /2010

LAPORAN AUDITOR INDEPENDEN Laporan No. 13162-B1B/JMM3.PA1 Pemegang Saham, Komisaris dan Direksi PT SAT NUSAPERSADA Tbk Kami telah mengaudit Laporan Posisi Keuangan (Neraca) Konsolidasi PT Sat Nusapersada Tbk dan Entitas Anak tanggal 31 Desember 2012 dan 2011 dan 1 Januari 2011, Laporan Laba Rugi Komprehensif Konsolidasi, Laporan Perubahan Ekuitas Konsolidasi serta Laporan Arus Kas Konsolidasi untuk tahun yang berakhir pada tanggal 31 Desember 2012 dan 2011. Laporan Keuangan Konsolidasi adalah tanggung jawab manajemen Perusahaan. Tanggung jawab kami terletak pada pernyataan pendapat atas Laporan Keuangan Konsolidasi berdasarkan audit kami. Kami melaksanakan audit berdasarkan standar auditing yang ditetapkan Institut Akuntan Publik Indonesia. Standar tersebut mengharuskan kami merencanakan dan melaksanakan audit agar kami memperoleh keyakinan memadai bahwa Laporan Keuangan Konsolidasi bebas dari salah saji material. Suatu audit meliputi pemeriksaan, atas dasar pengujian, bukti-bukti yang mendukung jumlah-jumlah dan pengungkapan dalam Laporan Keuangan Konsolidasi. Audit juga meliputi penilaian atas prinsip akuntansi yang digunakan dan estimasi signifikan yang dibuat oleh manajemen, serta penilaian terhadap penyajian Laporan Keuangan Konsolidasi secara keseluruhan. Kami yakin bahwa audit kami, memberikan dasar memadai untuk menyatakan pendapat. Menurut pendapat kami, Laporan Keuangan Konsolidasi yang kami sebut di atas menyajikan secara wajar, dalam semua hal yang material, Posisi Keuangan Konsolidasi PT Sat Nusapersada Tbk dan Entitas Anak tanggal 31 Desember 2012 dan 2011 dan 1 Januari 2011, Hasil Usaha, Perubahan Ekuitas serta Arus Kas Konsolidasi untuk tahun yang berakhir pada tanggal 31 Desember 2012 dan 2011 sesuai dengan Standar Akuntansi Keuangan di Indonesia.

INDEPENDENT AUDITOR’S REPORT Report No. 13162-B1B/JMM3.PA1 The Stockholders, Commissioners and Directors PT SAT NUSAPERSADA Tbk We have audited the accompanying Consolidated Statements of Financial Position of PT Sat Nusapersada Tbk and Subsidiary as of December 31, 2012 and 2011 and January 1, 2011, and the related Consolidated Statements of Comprehensive Income, Consolidated Statements of Changes in Equity and Consolidated Statements of Cash Flows for the years ended December 31, 2012 and 2011. These Consolidated Financial Statements are the responsibility of the Company’s management. Our responsibility is to express an opinion on these Consolidated Financial Statements based on our audits. We conducted our audits in accordance with auditing standards established by the Indonesian Institute of Certified Public Accountants. Those standards require that we plan and perform the audit to obtain reasonable assurance about whether the Consolidated Financial Statements are free of material misstatement. An audit includes examining, on a test basis, evidence supporting the amounts and disclosures in the Consolidated Financial Statements. An audit also includes assessing the accounting principles used and significant estimates made by management, as well as evaluating the overall Consolidated Financial Statement presentation. We believe that our audits provide a reasonable basis for our opinion. In our opinion, the Consolidated Financial Statements referred to above present fairly, in all material respects, the Financial Position of PT Sat Nusapersada Tbk and Subsidiary as of December 31, 2012 and 2011 and January 1, 2011, and the Results of their Operations, Changes in their Equity and their Cash Flows for the years ended December 31, 2012 and 2011, in conformity with Indonesian Financial Accounting Standards.

Page 153: annual report 2012 laporan tahunan 1
Page 154: annual report 2012 laporan tahunan 1

iii

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

LAPORAN POSISI KEUANGAN KONSOLIDASI (NERACA) PER 31 DESEMBER 2012 DAN 2011 DAN 1 JANUARI 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

CONSOLIDATED STATEMENTS OF FINANCIAL POSITION (BALANCE SHEETS)

AS OF DECEMBER 31, 2012 AND 2011 AND JANUARY 1, 2011

(Expressed in United States Dollar, except Otherwise Stated)

1 Januari/

January 1,

2 0 1 1 2 0 1 1

Catatan/ (Disajikan Kembali)/ (Disajikan Kembali)/

Notes 2 0 1 2 (Restated) (Restated)

ASET LANCAR CURRENT ASSETS

Kas dan Setara Kas 2e,2o,4&20 8.072.410 731.401 2.626.846 Cash and Cash Equivalents

Piutang Usaha kepada Pihak Ketiga 2h,2o,5,11&20 28.676.116 22.269.919 28.302.219 Trade Receivables to Third Parties

Piutang Lain-lain 2h,2o&20 49.707 17.125 196.189 Other Receivables

P e r s e d i a a n 2i,6&11 12.442.418 14.769.474 15.968.626 I n v e n t o r i e s

Pajak Dibayar di Muka 2o,10&20 - 13.685 176.418 Prepaid Taxes

Biaya Dibayar di Muka 212.855 179.055 673.040 P r e p a y m e n t s

Jumlah Aset Lancar 49.453.506 37.980.659 47.943.338 Total Current Assets

ASET TIDAK LANCAR NON CURRENT ASSETS

Aset Pajak Tangguhan 2q & 10 - 379.473 364.511 Deferred Tax Assets

Aset Tetap - Setelah Dikurangi Akumulasi Fixed Assets - Net of Accumulated

Penyusutan masing-masing sebesar Depreciation amounting to USD 54,043,835,

USD 54.043.835, USD 48.403.119 dan USD 48,403,119 and USD 47,949,743

USD 47.949.743 per 31 Desember 2012 as of December 31, 2012 and 2011

dan 2011 dan 1 Januari 2011 2j,2k,7&11 42.519.643 46.778.388 45.059.001 and January 1, 2011, respectively

Aset Tidak Lancar Lainnya : Other Assets :

Uang Jaminan 2o & 20 55.842 58.254 58.723 G u a r a n t e e s

Biaya Ditangguhkan - Bersih 2l 206.624 138.141 43.331 Deferred Charges - Net

Jumlah Aset Tidak Lancar 42.782.109 47.354.256 45.525.566 Total Non Current Assets

JUMLAH ASET 92.235.615 85.334.915 93.468.904 TOTAL ASSETS

A S E T A S S E T S

Catatan atas Laporan Keuangan Konsolidasi

merupakan bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasi secara keseluruhan

The accompanying Notes to the Consolidated Financial Statements form an integral part of these Consolidated

Financial Statements

Page 155: annual report 2012 laporan tahunan 1

iv

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

LAPORAN POSISI KEUANGAN KONSOLIDASI (NERACA) (Lanjutan) PER 31 DESEMBER 2012 DAN 2011 DAN 1 JANUARI 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

CONSOLIDATED STATEMENTS OF FINANCIAL POSITION (BALANCE SHEETS) (Continued) AS OF DECEMBER 31, 2012 AND 2011 AND

JANUARY 1, 2011 (Expressed in United States Dollar, except

Otherwise Stated)

1 Januari/

January 1,

2 0 1 1 2 0 1 1

Catatan/ (Disajikan Kembali)/ (Disajikan Kembali)/

Notes 2 0 1 2 (Restated) (Restated)

LIABILITAS JANGKA PENDEK CURRENT LIABILITIES

Hutang Usaha kepada Pihak Ketiga 2f,8&20 33.864.958 27.436.763 33.624.935 Trade Payables to Third Parties

Hutang Lain-lain 2f,9&20 1.346.913 2.626.687 3.689.038 Other Payables

Hutang Pajak 2g,10&20 146.916 108.566 134.491 Taxes Payable

Beban Masih Harus Dibayar 2f & 20 722.841 343.974 392.836 Accrued Expenses

Jumlah Liabilitas Jangka Pendek 36.081.628 30.515.990 37.841.300 Total Current Liabilities

LIABILITAS JANGKA PANJANG NON CURRENT LIABILITIES

Hutang Lain-lain 2f,9&20 - 169.981 370.523 Other Payables

Liabilitas Pajak Tangguhan 2q & 10 200.723 41.601 61.151 Deferred Tax Liabilities

Liabilitas Imbalan Kerja Jangka Panjang 2r,12&20 2.276.527 1.911.412 1.458.952 Long-term Employee Benefits Liabities

Jumlah Liabilitas Jangka Panjang 2.477.250 2.122.994 1.890.626 Total Non Current Liabilities

Jumlah Liabilitas 38.558.878 32.638.984 39.731.926 Total Liabilities

E K U I T A S E Q U I T Y

Modal Saham, nilai nominal Rp 150 per saham Capital Stock - Rp 150 par value per share

Modal Dasar - 4.920.000.000 saham Authorized - 4,920,000,000 shares

Ditempatkan dan Disetor - 1.771.448.000 Subscribed and Fully Paid - 1,771,448,000

saham 1b & 13 32.329.685 32.329.685 32.329.685 shares

Tambahan Modal Disetor 1b,2p&14 23.168.684 23.168.684 23.168.684 Additional Paid-in Capital

Difference Arising from Restructuring

Selisih Nilai Transaksi Restrukturisasi Transactions among Entities under

Entitas Sepengendali 2m & 15 (2.818.774) (2.818.774) (2.818.774) Common Control

Saldo Laba : Retained Earnings :

- Ditentukan Penggunaannya 5.366 5.366 5.366 - Appropriated

- Belum Ditentukan Penggunaannya 990.619 9.813 1.050.860 - Unappropriated

Ekuitas yang Dapat Diatribusikan Equity Attributable to Owners of the

Langsung kepada Pemilik Entitas Induk 53.675.580 52.694.774 53.735.821 Parent Company

Kepentingan Non Pengendali 1.157 1.157 1.157 Non-Controlling Interest

Jumlah Ekuitas 53.676.737 52.695.931 53.736.978 Total Equity

JUMLAH LIABILITAS DAN EKUITAS 92.235.615 85.334.915 93.468.904 TOTAL LIABILITIES AND EQUITY

LIABILITAS DAN EKUITAS LIABILITIES AND EQUITY

Catatan atas Laporan Keuangan Konsolidasi

merupakan bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasi secara keseluruhan

The accompanying Notes to the Consolidated Financial Statements form an integral part of these Consolidated

Financial Statements

Page 156: annual report 2012 laporan tahunan 1

v

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

LAPORAN LABA RUGI KOMPREHENSIF KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

2 0 1 1

Catatan/ (Disajikan Kembali)/

Notes 2 0 1 2 (Restated)

P E N D A P A T A N R E V E N U E S

P e n j u a l a n 2n & 16 236.876.417 231.946.353 S a l e s

Jasa Perakitan 2.497.397 2.637.369 Assembling Services

Jumlah Pendapatan 239.373.814 234.583.722 Total Revenues

BEBAN POKOK COST OF REVENUES

P e n j u a l a n 2n & 17 (229.557.812) (226.960.686) Cost of Goods Sold

Jasa Perakitan 2n & 18 (1.704.631) (1.797.036) Cost of Assembling Services

Jumlah Beban Pokok (231.262.443) (228.757.722) Total Cost of Revenues

LABA KOTOR 8.111.371 5.826.000 GROSS PROFIT

BEBAN USAHA OPERATING EXPENSES

P e n j u a l a n 2n & 19 (558.402) (618.517) S e l l i n g

Umum dan Administrasi (6.809.091) (6.775.671) General and Administrative

Jumlah Beban Usaha (7.367.493) (7.394.188) Total Operating Expenses

LABA (RUGI) USAHA 743.878 (1.568.188) INCOME (LOSS) FROM OPERATIONS

PENGHASILAN (BEBAN) LAIN-LAIN 2n OTHER INCOME (CHARGES)

Laba (Rugi) Selisih Kurs - Bersih 2o 277.430 (141.606) Gain (Loss) on Foreign Exchange - Net

Laba Penjualan Sisa Produksi 241.019 238.729 Gain on Sale of Waste Product

Jasa Giro dan Bunga Deposito 34.478 5.308 Interest on Bank Accounts and Time Deposits

Laba Penjualan Aset Tetap 2j & 7 11.951 151.265 Gain on Disposal of Fixed Assets

Beban Bunga Pinjaman 2s & 11 (65.397) (23.996) Loan Interest Expenses

Denda Pajak (2.503) (12.121) Tax Penalties

Lain-lain 349.108 275.050 O t h e r s

Jumlah Penghasilan Lain-lain - Bersih 846.086 492.629 Total Other Income - Net

LABA (RUGI) SEBELUM PAJAK PENGHASILAN 1.589.964 (1.075.559) INCOME (LOSS) BEFORE INCOME TAX

PAJAK PENGHASILAN 2q & 10 INCOME TAX

Pajak Kini (70.563) - Current Tax

Pajak Tangguhan (538.595) 34.512 Deferred Tax

LABA (RUGI) BERSIH 980.806 (1.041.047) NET INCOME (LOSS)

PENDAPATAN KOMPREHENSIF LAIN - - OTHER COMPREHENSIVE INCOME

LABA (RUGI) BERSIH KOMPREHENSIF 980.806 (1.041.047) NET COMPREHENSIVE INCOME (LOSS)

Page 157: annual report 2012 laporan tahunan 1

vi

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

LAPORAN LABA RUGI COMPREHENSIF KONSOLIDASI (Lanjutan) UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME (Continued)

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

2 0 1 1

Catatan/ (Disajikan Kembali)/

Notes 2 0 1 2 (Restated)

LABA (RUGI) BERSIH YANG DAPAT NET INCOME (LOSS) ATTRIBUTABLE TO :

DIATRIBUSIKAN KEPADA :

Pemilik Entitas Induk 980.806 (1.041.047) Owners of the Parent Company

Kepentingan Non Pengendali - - Non-Controlling Interest

J u m l a h 980.806 (1.041.047) T o t a l

LABA (RUGI) BERSIH KOMPREHENSIF YANG NET COMPREHENSIVE INCOME (LOSS)

DAPAT DIATRIBUSIKAN KEPADA : ATTRIBUTABLE TO :

Pemilik Entitas Induk 980.806 (1.041.047) Owners of the Parent Company

Kepentingan Non Pengendali - - Non-Controlling Interest

J u m l a h 980.806 (1.041.047) T o t a l

LABA (RUGI) BERSIH PER 1.000 SAHAM DASAR 2p 0,55 (0,59) NET INCOME (LOSS) PER 1,000 SHARES

Catatan atas Laporan Keuangan Konsolidasi

merupakan bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasi secara keseluruhan

The accompanying Notes to the Consolidated Financial Statements form an integral part of these Consolidated

Financial Statements

Page 158: annual report 2012 laporan tahunan 1

LAPORAN PERUBAHAN EKUITAS KONSOLIDASI CONSOLIDATED STATEMENTS OF CHANGES IN EQUITY

UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain) (Expressed in United States Dollar, except Otherwise Stated)

Selisih

Nilai Transaksi

Restrukturisasi

Entitas Sepengendali/

Difference Arising

Tambahan from Restructuring Kepentingan

Modal Disetor/ Transactions among Ditentukan Belum Ditentukan Non Pengendali/

Modal Saham/ Additional Entities under Penggunaannya/ Penggunaannya/ Jumlah/ Non-Controlling Jumlah Ekuitas/

Capital Stock Paid-in Capital Common Control Appropriated Unappropriated Total Interest Total Equity

SALDO PER 1 JANUARI 2011 BALANCE AS OF JANUARY 1, 2011

(Disajikan Kembali) 32.329.685 23.168.684 (2.818.774) 5.366 1.050.860 53.735.821 1.157 53.736.978 (Restated)

RUGI BERSIH KOMPREHENSIF 2011 NET COMPREHENSIVE LOSS IN 2011

(Disajikan Kembali) - - - - (1.041.047) (1.041.047) - (1.041.047) (Restated)

SALDO PER 31 DESEMBER 2011 BALANCE AS OF DECEMBER 31, 2011

(Disajikan Kembali) 32.329.685 23.168.684 (2.818.774) 5.366 9.813 52.694.774 1.157 52.695.931 (Restated)

LABA BERSIH KOMPREHENSIF 2012 - - - - 980.806 980.806 - 980.806 NET COMPREHENSIVE INCOME IN 2012

SALDO PER 31 DESEMBER 2012 32.329.685 23.168.684 (2.818.774) 5.366 990.619 53.675.580 1.157 53.676.737 BALANCE AS OF DECEMBER 31, 2012

Catatan atas Laporan Keuangan Konsolidasian merupakan The accompanying Notes to the Consolidated Financial Statements

bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasi secara keseluruhan form an integral part of these Consolidated Financial Statements

PT SAT NUSAPERSADA Tbk

DAN ENTITAS ANAK/AND SUBSIDIARY

Saldo Laba/

vii

Retained Earnings

Page 159: annual report 2012 laporan tahunan 1

viii

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

LAPORAN ARUS KAS KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

CONSOLIDATED STATEMENTS OF CASH FLOWS FOR THE YEARS ENDED DECEMBER 31,

2012 AND 2011

(Expressed in United States Dollar, except Otherwise Stated)

2 0 1 1

Catatan/ (Disajikan Kembali)/

Notes 2 0 1 2 (Restated)

ARUS KAS DARI AKTIVITAS OPERASI CASH FLOWS FROM OPERATING ACTIVITIES

Penerimaan Kas dari Pelanggan 232.967.617 240.616.027 Cash Receipts from Customers

Pembayaran kepada Komisaris, Direksi dan Karyawan (16.110.217) (14.902.813) Cash Paid to Commissioners, Directors and Employees

Pembayaran kepada Pemasok dan Lainnya (207.252.262) (219.730.663) Cash Paid to Suppliers and Others

Kas yang Dihasilkan dari Aktivitas Operasi 9.605.138 5.982.551 Cash Generated from Operating Activities

Penerimaan Restitusi Pajak Penghasilan Badan 10 13.685 96.134 Received from Refund of Corporate Income Tax

Pembayaran Pajak Penghasilan Badan 10 (41.000) - Payment of Corporate Income Tax

Kas Bersih Diperoleh dari Aktivitas Operasi 9.577.823 6.078.685 Net Cash Provided by Operating Activities

ARUS KAS DARI AKTIVITAS INVESTASI CASH FLOWS FROM INVESTING ACTIVITIES

Perolehan Aset Tetap 7 (2.104.221) (8.108.912) Acquisition of Fixed Assets

Penjualan Aset Tetap 7 34.653 287.473 Proceeds from Sale of Fixed Assets

Peningkatan Biaya Ditangguhkan (125.765) (100.709) Increase in Deferred Charges

Kas Bersih Digunakan untuk Aktivitas Investasi (2.195.333) (7.922.148) Net Cash Used in Investing Activities

ARUS KAS DARI AKTIVITAS PENDANAAN CASH FLOWS FROM FINANCING ACTIVITIES

Pembayaran Bunga dan Provisi Bank (41.481) (51.982) Payment of Bank Interest and Provision

Pembayaran Hutang Bank (6.906.995) - Payment of Bank Loans

Perolehan Hutang Bank 6.906.995 Proceed of Bank Loans

Kas Bersih Digunakan untuk Aktivitas Pendanaan (41.481) (51.982) Net Cash Used in Financing Activities

PENINGKATAN (PENURUNAN) BERSIH KAS NET INCREASE (DECREASE) IN CASH AND CASH

DAN SETARA KAS 7.341.009 (1.895.445) EQUIVALENTS

KAS DAN SETARA KAS, AWAL TAHUN 731.401 2.626.846 CASH AND CASH EQUIVALENTS, BEGINNING

KAS DAN BANK, AKHIR TAHUN 8.072.410 731.401 CASH AND CASH EQUIVALENTS, ENDING

Catatan atas Laporan Keuangan Konsolidasi merupakan bagian yang tidak terpisahkan dari Laporan

Keuangan Konsolidasi secara keseluruhan

The accompanying Notes to the Consolidated Financial Statements form an integral part of these Consolidated

Financial Statements

Page 160: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

1

1. GAMBARAN UMUM PERUSAHAAN a. Pendirian Perusahaan PT Sat Nusapersada (Perusahaan) didirikan

berdasarkan Akta No. 5 tanggal 1 Juni 1990 dari Notaris Maria Anastasia Halim, SH. Akta Pendirian Perusahaan telah memperoleh pengesahan dari Menteri Kehakiman Republik Indonesia dalam Surat Keputusan No. C2-4877.HT.01.01.Th.91 tanggal 18 September 1991 dan diumumkan dalam Berita Negara Republik Indonesia No. 93 tanggal 19 Nopember 1991, Tambahan No. 4299.

Anggaran Dasar Perusahaan telah

mengalami beberapa kali perubahan, terakhir dalam Akta No. 105 tanggal 26 Juni 2008 dari Notaris Fathiah Helmi, SH mengenai persetujuan perubahan Anggaran Dasar Perusahaan sesuai dengan Ketentuan Undang-undang No. 40 tahun 2007 tentang Perseroan Terbatas dan Peraturan Bapepam - LK No. IX.J.1 tanggal 14 Mei 2008 tentang Pokok-pokok Anggaran Dasar Perusahaan yang Melakukan Penawaran Umum Efek Bersifat Ekuitas dan Perusahaan Publik. Perubahan Anggaran Dasar Perusahaan tersebut telah memperoleh persetujuan Menteri Hukum dan Hak Asasi Manusia Republik Indonesia dalam Surat No. AHU-44546.AH.01.02 tanggal 24 Juli 2008 dan diumumkan dalam Berita Negara Republik Indonesia No. 39 tanggal 15 Mei 2012, Tambahan No. 20254.

Sesuai dengan Pasal 3 Anggaran Dasar

Perusahaan, ruang lingkup kegiatan Perusahaan adalah bergerak dalam bidang usaha perakitan alat-alat elektronik, developer, kontraktor, perdagangan, pertanian, pertambangan, perkebunan, perikanan, perhutanan dan angkutan darat.

1. THE COMPANY GENERAL INFORMATION a. Company Establishment PT Sat Nusapersada Tbk (the Company)

was established based on Notarial Deed No. 5 dated June 1, 1990 of Public Notary Maria Anastasia Halim, SH. The Deed of Establishment was approved by the Minister of Justice of the Republic of Indonesia in Decision Letter No. C2-4877.HT.01.01.Th.91 dated September 18, 1991 and published in State Gazette of the Republic of Indonesia No. 93 dated November 19, 1991, Supplement No. 4299.

The Company’s Articles of Association

have been amended several times, most recently by Notarial Deed No. 105 dated June 26, 2008 of Public Notary Fathiah Helmi, SH, concerning changes in the Company’s Articles of Association to comply with Law No. 40 year 2007 concerning Limited Liability Companies and Regulation of Capital Market and Financial Institution Supervisory Agency (Bapepam-LK) in Letter No. IX.J.1 dated May 14, 2008 concerning the Principles of Articles of Association of Companies Conducting Public Offering of Equity Share and Public Companies. Such change in the Company’s Articles of Association was approved by the Minister of Law and Human Rights of the Republic of Indonesia in Letter No. AHU-44546.AH.01.02 dated July 24, 2008 and published in State Gazette of the Republic of Indonesia No. 39 dated May 15, 2012, Supplement No. 20254.

According to Article 3 of the Company’s Articles of Association, the Company’s scope of activities comprises assembling electronic components, operating as developer and contractor, and engaging in trading, agriculture, mining, plantation, fishery, forestry and land transportation industries.

Page 161: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

2

1. GAMBARAN UMUM PERUSAHAAN (Lanjutan) a. Pendirian Perusahaan (Lanjutan)

Pada saat ini, Perusahaan bergerak dalam

bidang usaha perakitan alat-alat elektronik. Perusahaan berkedudukan di Batam. Kantor

Pusat dan pabrik Perusahaan berlokasi di Jl. Pelita VI No. 99, Batam, Propinsi Kepulauan Riau.

Perusahaan mulai beroperasi komersial

pada bulan Desember 1990. Perusahaan tidak memiliki entitas induk dan

entitas induk terakhir. b. Penawaran Umum Pada tanggal 21 Agustus 2007, melalui

Surat Pengantar Pernyataan Pendaftaran No. 755/SK/SNP/VIII/07, Perusahaan telah menawarkan sahamnya kepada masyarakat melalui pasar modal sejumlah 531.388.000 saham dengan nilai nominal Rp 150 per saham dengan harga penawaran Rp 580 per saham. Pada tanggal 26 Oktober 2007, berdasarkan Surat Ketua Badan Pengawas Pasar Modal dan Lembaga Keuangan (Bapepam-LK) No. S-5364/BL/2007, Perusahaan telah memperoleh Surat Pemberitahuan Efektif Pernyataan Penawaran. Selisih lebih jumlah yang diterima dari pengeluaran saham terhadap nilai nominalnya sebesar USD 24.370.397 dicatat dalam akun “Tambahan Modal Disetor” setelah dikurangi biaya emisi saham sebesar USD 1.201.713. Pada tanggal 8 Nopember 2007, seluruh saham Perusahaan telah tercatat pada Bursa Efek Indonesia.

1. THE COMPANY GENERAL INFORMATION (Continued) a. Company Establishment (Continued)

Currently, the Company’s activities comprise assembling electronic components.

The Company’s domicile is in Batam with

its head office and factory at Jl. Pelita VI No. 99, Batam, Riau Islands Province.

The Company commenced commercial operations in December 1990. The Company has no immediate holding entity and ultimate parent entity.

b. Public Offering

On August 21, 2007, through Registration Statement Letter No. 755/SK/SNP/ VIII/07, the Company conducted the initial public offering of its 531,388,000 shares at a par value of Rp 150 per share with an offering price of Rp 580 per share through the capital market. On October 26, 2007, based on Letter No. S-5364/BL/2007 from the Chairman of Capital Market Supervisory Board and Financial Institution (Bapepam-LK), the Company’s Statement Registration became effective. The excess amount received from the stock issuance over its nominal value amounting to USD 24,370,397 was recorded in the “Additional Paid-in Capital” account, after being deducted by the stock issuance cost of USD 1,201,713. On November 8, 2007, all the Company’s shares were listed on the Indonesia Stock Exchange.

Page 162: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

3

1. GAMBARAN UMUM PERUSAHAAN (Lanjutan) c. Entitas Anak PT SM Engineering (SME) Berdasarkan Akta Perjanjian Jual Beli

Saham No. 38 tanggal 18 Desember 2007 dari Notaris Fathiah Helmi, SH, Perusahaan membeli saham SME milik PT Sat Nusapersada Brothers dan Abidin, keduanya pihak sepengendali, secara keseluruhan sebanyak 2.499 saham dengan biaya perolehan sebesar Rp 23.000.000.000 (USD 2.441.873) atau 99,96 % dari seluruh modal ditempatkan dan disetor SME. Pembelian saham SME tersebut telah disetujui pemegang saham Perusahaan dalam Akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perusahaan No. 37 tanggal 18 Desember 2007 dari Notaris Fathiah Helmi, SH. Selisih biaya perolehan di atas nilai buku bagian Perusahaan atas ekuitas SME sebesar Rp 6.664.126.585 (USD 707.520) dicatat dalam akun Selisih Nilai Transaksi Restrukturisasi Entitas Sepengendali sebagai unsur Ekuitas di Laporan Posisi Keuangan (Neraca) Konsolidasi.

SME berkedudukan di Batam dengan kantor

pusat dan pabrik berlokasi di Lot 8 Citra Buana Centre Park III, Jl. Engku Putri, Batam, Propinsi Kepulauan Riau. SME bergerak dalam bidang industri pengepresan logam (metal stamping) dan beroperasi komersial pada bulan Oktober 2002.

Jumlah aset SME setelah eliminasi pada

tanggal 31 Desember 2012, 2011 dan 1 Januari 2011 masing-masing sebesar USD 2.583.510, USD 2.722.202 dan USD 3.148.386.

1. THE COMPANY GENERAL INFORMATION (Continued) c. S u b s i d i a r y PT SM Engineering (SME) Based on Share Sale and Purchase

Agreement Deed No. 38 dated December 18, 2007 of Public Notary Fathiah Helmi, SH, the Company purchased SME’s 2,499 shares owned by PT Sat Nusapersada Brothers and Abidin, both are entities under common control, at acquisition cost amounting to Rp 23,000,000,000 (USD 2,441,873) or representing 99.96 % of SME’s total subscribed and fully paid capital. The purchase was approved by the Company’s stockholders as stated in Deed of Minutes of Extraordinary General Meeting of Stockholders No. 37 dated December 18, 2007 of Public Notary Fathiah Helmi, SH. The excess of cost over book value of the Company’s share in SME’s equity amounting to Rp 6,664,126,585 (USD 707,520) was recorded in the Difference Arising from Restructuring Transactions with Entities under Common Control under the Equity section in the Consolidated Statements of Financial Position (Balance Sheets). SME’s domicile is in Batam with its head office and factory located at Lot 8 Citra Buana Centre Park III, Jl. Engku Putri, Batam, Riau Islands Province. SME’s scope of activities is in metal stamping and it commenced commercial operations in October 2002.

SME’s total assets after elimination as of December 31, 2012 and 2011 and January 1, 2011 amounted to USD 2,583,510, USD 2,722,202 and USD 3,148,386, respectively.

Page 163: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

4

1. GAMBARAN UMUM PERUSAHAAN (Lanjutan) d. Dewan Komisaris, Direksi dan Karyawan Berdasarkan Akta Akta No. 90 tanggal

26 Juni 2012 dari Notaris Soehendro Gautama, SH, M.Hum., dan No. 14 tanggal 7 Agustus 2007 dari Notaris Fathiah Helmi, SH, susunan pengurus Perusahaan per 31 Desember 2012 dan 2011 sebagai berikut :

Dewan Komisaris

Komisaris Utama : Sofjan Wanandi K o m i s a r i s : Usman Fan Komisaris Independen : A n a s

D i r e k s i Direktur Utama : A b i d i n D i r e k t u r : Bidin Yusuf Direktur Tidak Terafiliasi : M e g a w a t i

Susunan komite audit Perusahaan pada tanggal 31 Desember sebagai berikut :

1. THE COMPANY GENERAL INFORMATION (Continued) d. Commissioners, Directors and

Employees

Based on Notarial Deeds No. 90 dated June 26, 2012 of Public Notary Soehendro Gautama, SH, M.Hum. and No. 14 dated August 2007 of Public Notary Fathiah Helmi, SH, the Company’s management structure as of December 31, 2012 and 2011 is as follows :

Board of Commissioners President Commissioner : Sofjan Wanandi C o m m i s s i o n e r : Usman Fan Independent Commissioner : A n a s

Board of Directors President Director : A b i d i n D i r e c t o r : Bidin Yusuf Non-Affiliated Director : M e g a w a t i

The Company’s audit committee as of December 31, is as follows :

2 0 1 2 2 0 1 1

K e t u a : A n a s A n a s H e a d A n g g o t a : Glenn Martinus Glenn Martinus M e m b e r s N e t t y Ernyan Tan

Manajemen kunci meliputi anggota Dewan Komisaris dan Direksi Perusahaan. Gaji dan tunjangan yang dibayarkan kepada Komisaris dan Direksi Perusahaan dan Entitas Anak adalah sebesar USD 1.040.369 dan USD 1.097.655 masing-masing untuk tahun yang berakhir pada tanggal 31 Desember 2012 dan 2011. Perusahaan dan Entitas Anak memiliki 552 dan 600 karyawan tetap masing-masing pada tanggal 31 Desember 2012 dan 2011.

The key management comprises members of the Company’s Boards of Commissioners and Directors. Salaries and allowances paid to the Commissioners and Directors of the Company and Subsidiary amounted to USD 1,040,369 and USD 1,097,655 in 2012 and 2011, respectively. As of December 31, 2012 and 2011, the Company and Subsidiary had 552 and 600 permanent employees, respectively.

Page 164: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

5

1. GAMBARAN UMUM PERUSAHAAN (Lanjutan) e. Penyelesaian Laporan Keuangan

Konsolidasi

Laporan Keuangan Konsolidasi telah diselesaikan dan diotorisasi untuk terbit oleh manajemen Perusahaan pada tanggal 8 Maret 2013.

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN

a. Dasar Pengukuran dan Penyusunan

Laporan Keuangan Konsolidasi Laporan Keuangan Konsolidasi Perusahaan

telah disusun sesuai Standar Akuntansi Keuangan di Indonesia (SAK), yang mencakup Pernyataan dan Interpretasi yang dikeluarkan oleh Dewan Standar Akuntansi Keuangan Ikatan Akuntan Indonesia dan Keputusan Ketua Bapepam-LK No. KEP-347/BL/2012 tanggal 25 Juni 2012 tentang Penyajian dan Pengungkapan Laporan Keuangan Emiten atau Perusahaan Publik.

Laporan Keuangan Konsolidasi disusun

berdasarkan konsep Biaya Perolehan dan atas dasar Akrual, kecuali Laporan Arus Kas dan beberapa akun tertentu yang disusun berdasarkan pengukuran lain sebagaimana diungkapkan dalam masing-masing Catatan atas Laporan Keuangan Konsolidasi.

Laporan Arus Kas Konsolidasi menyajikan

penerimaan dan pengeluaran kas dan setara kas yang diklasifikasikan ke dalam aktivitas operasi, investasi dan pendanaan serta disusun berdasarkan metode Langsung (Direct method).

1. THE COMPANY GENERAL INFORMATION (Continued)

e. Completion of the Consolidated

Financial Statements The Consolidated Financial Statements

were completed and authorized for issue by the Company’s management on March 8, 2013.

2. SUMMARY OF SIGNIFICANT ACCOUNTING

POLICIES

a. Basis of Consolidated Financial Statement Measurement and Presentation

The Company’s Consolidated Financial Statements have been prepared in accordance with Indonesian Accounting Standards (“FAS”) comprising the Statements and Intepretations issued by the Board of Financial Accounting Standards of the Indonesian Institute of Accountants and Decision Letter of the Chief of Capital Market and Financial Institiution Supervisory Agency (Bapepam-LK) No. KEP-347/BL/2012 dated June 25, 2012 concerning the Presentation and Disclosures of Financial Statements of Public Listed Companies. The Consolidated Financial Statements have been prepared based on the Historical Cost concept and Accrual basis, except for the Statements of Cash Flows and certain accounts that have been prepared based on other measurements as explained in each Note to the Consolidated Financial Statements. The Consolidated Financial Statements of Cash Flows present receipts and disbursements of cash and cash equivalents classified into operating, investing, and financing activities and are prepared using the Direct method.

Page 165: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

6

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

a. Dasar Pengukuran dan Penyusunan

Laporan Keuangan Konsolidasi (Lanjutan)

Sejak 1 Januari 2012, Perusahaan mengubah mata uang pelaporan dari Rupiah menjadi Dolar Amerika Serikat sesuai dengan mata uang fungsional Perusahaan (Catatan 3).

b. Asumsi dan Sumber Estimasi Ketidakpastian

Penyusunan Laporan Keuangan Konsolidasi

sesuai dengan Standar Akuntansi Keuangan di Indonesia mengharuskan manajemen untuk membuat estimasi dan asumsi yang mempengaruhi nilai yang dilaporkan dalam Laporan Keuangan Konsolidasi. Karena adanya ketidakpastian yang melekat dalam penerapan estimasi, maka realisasinya dapat berbeda dari jumlah yang estimasi yang dibuat.

Informasi tentang asumsi utama yang dibuat

mengenai masa depan dan sumber utama dari estimasi ketidakpastian lain pada akhir periode pelaporan, yang memiliki risiko signifikan yang mengakibatkan penyesuaian material terhadap jumlah tercatat aset dan liabilitas dalam periode pelaporan berikutnya dijelaskan dibawah ini.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

a. Basis of Consolidated Financial

Statement Measurement and Presentation (Continued)

Effective January 1, 2012, the Company

changed its reporting currency from Indonesian Rupiah to United States Dollar to be in line with its functional currency.

b. Key Source of Estimation Uncertainty The preparation of the Consolidated

Financial Statements in accordance with financial accounting standards in Indonesia, requires the management to make estimates and assumptions that affect the reported amounts in the Consolidated Financial Statements. Due to inherent uncertainties in the estimation determination, the actual amounts reported in the future might possibly be different from those estimates.

Information about the key assumptions

concerning future and other key source of estimation at the end of the reporting period, that have the significant risk of causing a material adjustment to the carrying amount of assets and liabilities within the next financial year are discussed below.

Page 166: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

7

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

b. Asumsi dan Sumber Estimasi

Ketidakpastian (Lanjutan) Cadangan Penurunan Nilai Piutang Perusahaan mengevaluasi akun tertentu

yang diketahui bahwa para pelanggannya tidak dapat memenuhi kewajiban keuangannya. Dalam hal tersebut, Perusahaan mempertimbangkan, berdasarkan fakta dan situasi yang tersedia, termasuk namun tidak terbatas pada, jangka waktu hubungan dengan pelanggan dan status kredit dari pelanggan berdasarkan catatan kredit pihak ketiga yang tersedia untuk mencatat provisi spesifik atas pelanggan terhadap jumlah terhutang guna mengurangi jumlah piutang yang diharapkan dapat diterima oleh Perusahaan. Provisi spesifik ini dievaluasi kembali dan disesuaikan jika terdapat tambahan informasi yang diterima mempengaruhi jumlah cadangan penurunan nilai piutang.

Cadangan Penurunan Nilai Persediaan Dalam menentukan cadangan penurunan

nilai persediaan, manajemen menggunakan estimasi mengenai tingkat penjualan atau penggunaan atas persediaannya. Perubahan signifikan atas asumsi ini akan berdampak secara material terhadap hasil usaha.

Taksiran Masa Manfaat Ekonomis Aset

Tetap Masa manfaat setiap aset tetap Perusahaan

ditentukan berdasarkan taksiran masa manfaat ekonomisnya. Estimasi ini ditentukan berdasarkan evaluasi teknis internal dan pengalaman Perusahaan atas aset sejenis.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

b. Key Source of Estimation Uncertainty

(Continued) Allowance for Impairment of

Receivables The Company evaluates specific accounts

if it is known that its customers cannot afford their financial obligations. In these cases, the Company considers, based on available facts and circumstances, including but not limited to, the length of its relationship with the customers and the customers’ current credit status based on any third-party credit reports available to record specific allowance for impairment for customers against amounts due to reduce the receivable amounts that the Company expects to collect. These specific provisions for impairment are re-evaluated and adjusted as additional information received affects the amounts of allowance for impairment of receivables.

Allowance for Impairment of

Inventories In determining the allowance for

impairment of inventories, management uses estimates of the level of sales or use of the inventories. Significant changes in these assumptions will materially affect the results of operations.

Estimated Useful Lives of Fixed Assets The useful lives of each item of the

Company’s fixed assets are determined based on the estimated useful lives. These estimates are determined based on the Company’s internal technical evaluation and experience from similar assets.

Page 167: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

8

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

b. Asumsi dan Sumber Estimasi

Ketidakpastian (Lanjutan) Taksiran Masa Manfaat Ekonomis Aset

Tetap (Lanjutan) Masa manfaat setiap aset direview secara

periodik dan disesuaikan apabila prakiraan berbeda dengan estimasi sebelumnya karena keausan, keusangan teknis dan komersial, hukum atau keterbatasan lainnya atas pemakaian aset. Namun terdapat kemungkinan bahwa hasil operasi dimasa mendatang dapat dipengaruhi secara signifikan oleh perubahan atas jumlah serta periode pencatatan biaya yang diakibatkan karena faktor yang disebutkan diatas.

Perubahan masa manfaat aset tetap dapat

mempengaruhi jumlah biaya penyusutan yang diakui dan penurunan nilai tercatat aset. Tidak terdapat perubahan masa manfaat aset selama periode berjalan.

Penurunan Nilai Aset Non Moneter Review atas penurunan nilai dilakukan apabila terdapat indikasi penurunan nilai. Penentuan nilai pakai aset memerlukan estimasi mengenai arus kas yang diharapkan untuk dihasilkan dari penggunaan aset dan penjualan aset tersebut. Walaupun asumsi yang digunakan dalam mengestimasi nilai pakai aset yang tercermin dalam Laporan Keuangan Konsolidasi dianggap telah sesuai dan wajar, namun perubahan signifikan atas asumsi ini akan berdampak material terhadap penentuan jumlah yang dapat dipulihkan dan akibatnya kerugian penurunan nilai yang timbul akan berdampak terhadap hasil usaha.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

b. Key Source of Estimation Uncertainty

(Continued) Estimated Useful Lives of Fixed Assets

(Continued) The useful lives of each asset are

reviewed periodically and adjusted if different from previous estimates due to wear and tear, technical and commercial obsolescence, legal or other limitations on the use of assets. However, it is probable that future results of operations may be significantly affected by changes in the amount and period of recording costs due on account of the factors mentioned above.

Change in the useful life of fixed assets

can affect the amount of depreciation expense that is recognized and recorded asset impairment. There was no change in the useful lives of fixed assets during the period.

Impairment of Non Monetary Assets Impairment review is performed when

there is an indication of asset impairment. The determination of the asset use value requires the estimation of cash flows expected to result from the use of assets and the sale of assets. Although the assumptions used in estimating the value of disposable assets are reflected in the consolidated financial statements have been considered appropriate and reasonable, but significant changes in these assumptions would have a material effect on the determination of the amount that can be recovered and as a result, impairment losses will affect the results of business operations.

Page 168: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

9

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

b. Asumsi dan Sumber Estimasi

Ketidakpastian (Lanjutan) Imbalan Kerja Penentuan liabilitas imbalan pasca kerja tergantung pada pemilihan asumsi tertentu yang digunakan oleh aktuaris independen dalam menghitung jumlah liabilitas tersebut. Asumsi tersebut termasuk antara lain tingkat diskonto, tingkat kenaikan gaji tahunan, tingkat kecacatan, umur pensiun dan tingkat kematian. Hasil aktual yang berbeda dari asumsi yang ditetapkan Perusahaan langsung diakui dalam laba atau rugi pada saat terjadinya. Walaupun asumsi Perusahaan dianggap tepat dan wajar, namun perubahan signifikan pada kenyataannya atau perubahan signifikan dalam asumsi yang digunakan dapat berpengaruh secara signifikan terhadap liabilitas imbalan kerja Perusahaan. Pajak Penghasilan Estimasi signifikan dilakukan dalam menentukan penyisihan atas pajak penghasilan. Terdapat transaksi dan perhitungan tertentu yang penentuan pajak akhirnya adalah tidak pasti sepanjang kegiatan usaha normal.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

b. Key Source of Estimation Uncertainty

(Continued)

Employee Benefits The determination of post-employment

benefits obligation is dependent on selection of certain assumptions used by actuaries in calculating such amounts. Those assumptions include among others, discount rate and rate of salary increase, disability rate, pension age and mortality rate. Actual results that differ from the Company’s assumptions are directly recognized as profit or loss when incurred. Although it is believed that the Company’s assumptions are reasonable and appropriate, however significant changes in assumptions may materially affect the Company’s employee benefits liabilities.

Income Tax Significant estimates are required in

determining the provision for corporate income taxes. There are certain transactions and computation whose final tax determination is uncertain during the normal business activities.

Page 169: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

10

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

b. Asumsi dan Sumber Estimasi

Ketidakpastian (Lanjutan)

Nilai Wajar Instrumen Keuangan Penentuan nilai wajar instrumen keuangan memerlukan adanya estimasi-estimasi tertentu. Dalam pasar yang tidak aktif, manajemen menggunakan teknik penilaian tertentu untuk menentukan nilai wajar. Manajemen memilih teknik penilaian yang dapat memaksimumkan penggunaan parameter yang dapat diamati dan meminimalkan penggunaan yang tidak dapat diamati dalam menentukan nilai wajar. Ketika menentukan nilai wajar dengan cara tersebut di atas, manajemen juga memasukkan unsur kondisi pasar saat ini serta membuat penyesuaian risiko yang dianggap tepat akan dibuat oleh pelaku pasar.

c. Prinsip Konsolidasi Laporan Keuangan Konsolidasi meliputi

Laporan Keuangan Perusahaan dan Entitas Anak. Laporan Keuangan Konsolidasi disusun dengan menggunakan kebijakan akuntansi yang sama untuk peristiwa dan transaksi sejenis dalam kondisi yang sama, kecuali dinyatakan khusus.

Entitas Anak dikonsolidasi secara penuh

sejak tanggal akuisisi, yaitu tanggal Perusahaan memperoleh pengendalian, sampai dengan tanggal entitas induk kehilangan pengendalian. Pengendalian dianggap ada ketika Perusahaan memiliki secara langsung atau tidak langsung melalui Entitas Anak, lebih dari 50% hak suara.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

b. Key Source of Estimation Uncertainty

(Continued) Fair Value of Financial Instruments Measuring fair values of financial

instruments has led to the use of key estimates. In markets that are not active, management makes use of valuation techniques to measure fair values. Management selects valuation techniques that maximize the use of observable parameters and minimize the use of unobservable parameters to estimate the fair values. When estimating fair values in this way, management has taken into account current market conditions and included appropriate risk adjustments that market participants would make.

c. Principles of Consolidation The Consolidated Financial Statements

include the Financial Statements of the Company and Subsidiary. Consolidated Financial Statements are prepared using the same accounting policies for similar transactions and events in similar circumstances, unless otherwise specified.

The Subsidiary is fully consolidated from

the date on which control is transferred to the Company, and continued to be consolidated until the date such control ceases. Control is presumed to exist when the Company owns, directly or indirectly through a Subsidiary, more than 50% of the share ownership.

Page 170: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

11

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) c. Prinsip Konsolidasi (Lanjutan)

Saldo dan transaksi signifikan termasuk keuntungan/kerugian yang belum direalisasi atas transaksi antar perusahaan dieliminasi untuk mencerminkan posisi keuangan dan hasil usaha Perusahaan dan Entitas Anak sebagai satu kesatuan usaha. Rugi entitas anak yang tidak dimiliki secara penuh diatribusikan pada Kepentingan Non Pengendali (KNP), sebelumnya dikenal sebagai “Hak Minoritas” bahkan jika hal ini mengakibatkan KNP mempunyai saldo defisit. Perubahan dalam bagian kepemilikan Perusahaan pada Entitas Anak yang tidak mengakibatkan hilangnya pengendalian dicatat sebagai transaksi ekuitas. Ketika pengendalian atas entitas anak hilang, bagian kepemilikan yang tersisa di entitas tersebut diukur kembali pada nilai wajarnya dan keuntungan atau kerugian yang dihasilkan diakui dalam Laporan Laba Rugi Komprehensif Konsolidasi. Jika kehilangan pengendalian atas suatu Entitas Anak, maka Perusahaan :

• Menghentikan pengakuan aset (termasuk setiap goodwill) dan liabilitas entitas anak;

• Menghentikan pengakuan jumlah tercatat setiap KNP;

• Mengakui nilai wajar pembayaran yang diterima;

• Mengakui setiap sisa investasi pada nilai wajarnya, bila ada;

• Mengakui setiap perbedaan yang dihasilkan sebagai keuntungan atau kerugian dalam Laporan Laba Rugi Komprehensif Konsolidasi; dan

• Mereklasifikasi bagian induk atas komponen yang sebelumnya diakui sebagai pendapatan komprehensif lain ke Laporan Laba Rugi Komprehensif Konsolidasi, atau mengalihkan secara langsung ke saldo laba.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

c. Principles of Consolidation (Continued) All material intercompany accounts and

transactions, including unrealized gains or losses are eliminated to reflect the financial position and the results of operations of the Company and Subsidiary as one business entity.

Losses of a non-wholly owned subsidiary

are attributed to the Non-Controlling Interest (NCI) even if such losses result in a deficit balance for the NCI.

Changes in the Company’s ownership

interest in the Subsidiary that do not result in the loss of control are accounted for as equity transactions. When control over a previous subsidiary is lost, any remaining interest in the entity is remeasured at fair value and the resulting gain or loss is recognized in the consolidated profit and loss account.

In case of loss of control over the

Subsidiary, the Company :

• Derecognizes the assets (including goodwill) and liabilities of the subsidiary;

• Derecognizes the carrying amount of any NCI;

• Recognizes the fair value of the consideration received;

• Recognizes the fair value of any investment retained;

• Recognizes any surplus or deficit in profit or loss in statements of comprehensive income; and

• Reclassifies the parent’s share of components previously recognized in other comprehensive income to Statements of Comprehensive Income or retained earnings, as appropriate.

Page 171: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

12

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) c. Prinsip Konsolidasi (Lanjutan)

KNP mencerminkan bagian atas laba atau

rugi dan aset neto dari Entitas Anak yang tidak dapat diatribusikan secara langsung maupun tidak langsung pada Perusahaan, yang masing-masing disajikan dalam Laporan Laba Rugi Komprehensif Konsolidasi dan dalam ekuitas dalam Laporan Posisi Keuangan (Neraca) Konsolidasi, terpisah dari bagian yang dapat diatribusikan kepada pemilik entitas induk.

d. Kombinasi Bisnis Kombinasi bisnis dicatat dengan

menggunakan metode Akuisisi. Biaya perolehan dari sebuah akuisisi diukur pada nilai agregat imbalan yang dialihkan, diukur pada nilai wajar pada tanggal akuisisi dan jumlah setiap KNP pada pihak yang diakuisisi. Untuk setiap kombinasi bisnis, pihak pengakuisisi mengukur KNP pada entitas yang diakuisisi baik pada nilai wajar ataupun pada proporsi kepemilikan KNP atas aset neto yang teridentifikasi dari entitas yang diakuisisi. Biaya-biaya akuisisi yang timbul dibebankan langsung pada tahun berjalan.

Pada tanggal akuisisi, selisih lebih antara

penjumlahan imbalan yang dialihkan dan jumlah yang diakui untuk KNP dengan aset teridentifikasi dan liabilitas yang diambil-alih (aset neto) dicatat sebagai goodwill. Jika imbalan lebih rendah dari nilai wajar aset neto dari perusahaan yang diakuisisi maka selisihnya diakui dalam Laporan Laba Rugi Komprehensif Konsolidasi. Selisih yang timbul dari transaksi dengan pihak sepengendali dicatat sebagai ”Selisih Nilai Transaksi Restrukturisasi Entitas Sepengendali” dalam bagian Ekuitas.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

c. Principles of Consolidation (Continued) NCI represents the portion of the profit or

loss and net assets of the subsidiary not attributable directly or indirectly to the Company, which are presented in the consolidated statements of comprehensive income and under the equity section of the consolidated statements of financial position, respectively, separately from the corresponding portion attributable to the owner of the parent entity.

d. Business Combination Business combination is recorded by using

the acquisition method. Cost of acquisition is measured at the sum value of the consideration transferred, measured at fair value at the acquisition date, and the amount of each NCI on acquired parties. For each business combination, the acquirer measures the NCI on the acquired entity either at fair value or the proportion of NCI’s ownership of net identifiable assets of the acquired entity. Costs incurred in respect of acquisition are charged directly to the current year.

At the date of acquisition, the excess of the

sum of the consideration transferred and the amount recognized for the NCI with identifiable assets and liabilities taken over (net assets) is recorded as goodwill. If the consolidation is lower than the fair value of net assets of companies acquired, the difference is recognized in the Consolidated Statements of Comprehensive Income. Differences arising from transactions with related parties are accounted for as “Differences Arising from Restructuring Transactions among Entities Under Common Control” in the Equity.

Page 172: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

13

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

e. Kas dan Setara Kas Kas dan setara kas terdiri dari kas, bank dan

deposito yang jatuh tempo dalam waktu 3 bulan atau kurang sejak saat penempatan dan tidak dijaminkan serta tidak dibatasi penggunaannya.

f. Instrumen Keuangan Efektif tanggal 1 Januari 2012, Perusahaan

dan Entitas Anak menerapkan PSAK 50 (Revisi 2010),“Instrumen Keuangan : Penyajian”, PSAK 55 (Revisi 2011),“Instrumen Keuangan : Pengakuan dan Pengukuran” dan PSAK 60, “Instrumen Keuangan : Pengungkapan”. Penerapan PSAK 50 revisi, PSAK 55 revisi dan PSAK 60 ini tidak memberikan pengaruh signifikan terhadap Laporan Keuangan Konsolidasi.

Aset Keuangan Pengakuan Awal dan Pengukuran Aset keuangan diklasifikasikan sebagai aset

keuangan yang dinilai pada nilai wajar melalui laporan laba atau rugi, pinjaman yang diberikan dan piutang, investasi yang dimiliki hingga jatuh tempo, dan aset keuangan tersedia untuk dijual. Perusahaan dan Entitas Anak menentukan klasifikasi aset keuangan pada saat pengakuan awal.

Aset keuangan diakui pada Laporan Posisi

Keuangan (Neraca) jika dan hanya jika Perusahaan dan Entitas Anak menjadi salah satu pihak yang terlibat dalam perjanjian instrumen keuangan.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

e. Cash and Cash Equivalents Cash and cash equivalents consist of cash

on hand and in banks and time deposits with maturities of three (3) months or less and not collateralized nor with a restricted use.

f. Financial Instruments Effective January 1, 2012, the Company

adopted SFAS 50 (Revised 2010), “Financial Instruments : Presentation”, SFAS 55 (Revised 2011), “Financial Instruments : Recognition and Measurement”, and SFAS 60, “Financial Instruments : Disclosures”. The implementation of these revised SFAS 50, Revised SFAS 55 and SFAS 60 had no significant impact on the Consolidated Financial Statements.

Financial Assets Initial Recognition and Measurement Financial assets are classified as financial

assets at fair value through profit or loss, loans and receivables, held-to-maturity investments and available-for-sale financial assets. The Company and Subsidiary determine the classification of financial assets at initial recognition.

Financial assets are recognized in the

Statements of Financial Position (Balance Sheets) when, and only when, the Company and Subsidiary become a party to the contractual provisions of the financial instrument.

Page 173: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

14

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

f. Instrumen Keuangan (Lanjutan) Aset Keuangan (Lanjutan) Pengakuan Awal dan Pengukuran (Lanjutan) Pada saat pengakuan awal, aset keuangan

diukur pada nilai wajarnya, ditambah, dalam hal aset keuangan tidak diukur pada nilai wajar dalam laporan laba rugi, biaya transaksi yang dapat diatribusikan secara langsung dengan perolehan atau penerbitan aset keuangan tersebut.

Seluruh pembelian dan penjualan yang lazim

pada aset keuangan diakui atau dihentikan pengakuannya pada tanggal perdagangan seperti contohnya tanggal pada saat Perusahaan dan Entitas Anak berkomitmen untuk membeli atau menjual aset. Pembelian atau penjualan yang lazim adalah pembelian atau penjualan aset keuangan yang mensyaratkan penyerahan aset dalam kurun waktu umumnya ditetapkan dengan peraturan atau kebiasaan yang berlaku di pasar.

Perusahaan dan Entitas Anak menentukan

klasifikasi aset keuangan pada saat pengakuan awal dan, jika diperbolehkan dan sesuai, akan dievaluasi kembali setiap akhir tahun keuangan.

Aset keuangan Perusahaan dan Entitas

Anak terdiri dari kas dan setara kas, piutang usaha kepada pihak ketiga, piutang lain-lain, aset lain-lain dan uang jaminan termasuk dalam kategori pinjaman yang diberikan dan piutang.

Pinjaman yang diberikan dan piutang

merupakan aset keuangan dengan pembayaran tetap atau telah ditentukan dan tidak mempunyai kuotasi di pasar aktif.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

f. Financial Instruments (Continued) Financial Assets (Continued) Initial Recognition and Measurement

(Continued) When financial assets are recognized

initially, they are measured at fair value, plus, in the case of financial assets not at fair value through profit or loss, directly attributable transaction costs.

All regular way purchases and sales of

financial assets are recognized or derecognized on the trade date, i.e., the date that the Company and Subsidiary commit to purchase or sell the asset. Regular way purchases or sales are purchases or sales of financial assets that require delivery of assets within the period generally established by regulations or conventions in the market place concerned.

The Company and Subsidiary determine

the classification of their financial assets after initial recognition and, where allowed and appropriate, re-evaluate this designation at each financial year end.

The Company and Subsidiary’s financial

assets of cash and cash equivalents, trade receivables - third parties, other receivables and other assets - guarantees were categorized as loans and receivables.

Loans and receivables are financial assets

with fixed or determinable payments that are not quoted in an active market.

Page 174: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

15

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) f. Instrumen Keuangan (Lanjutan) Aset Keuangan (Lanjutan) Pengukuran Setelah Pengakuan Awal Pinjaman yang diberikan dan piutang adalah

aset keuangan non-derivatif dengan pembayaran tetap atau telah ditentukan dan tidak mempunyai kuotasi di pasar aktif. Aset keuangan tersebut dicatat pada biaya perolehan diamortisasi menggunakan metode Suku Bunga Efektif. Keuntungan atau kerugian diakui pada Laporan Laba Rugi Komprehensif Konsolidasi pada saat pinjaman yang diberikan dan piutang tersebut dihentikan pengakuannya atau mengalami penurunan nilai serta melalui proses amortisasi.

Penghentian Pengakuan Penghentian pengakuan atas suatu aset

keuangan (atau, apabila dapat diterapkan untuk bagian dari aset keuangan atau bagian dari kelompok aset keuangan sejenis) terjadi bila : (1) hak kontraktual atas arus kas yang berasal dari aset keuangan tersebut berakhir; atau (2) Perusahaan dan Entitas Anak memindahkan hak untuk menerima arus kas yang berasal dari aset keuangan tersebut atau menanggung liabilitas untuk membayar arus kas yang diterima tersebut tanpa penundaan yang signifikan kepada pihak ketiga melalui suatu kesepakatan penyerahan dan salah satu diantara : (a) Perusahaan dan Entitas Anak secara substansial memindahkan seluruh risiko dan manfaat atas kepemilikan aset keuangan tersebut, atau (b) Perusahaan dan Entitas Anak secara substansial tidak memindahkan dan tidak memiliki seluruh risiko dan manfaat atas kepemilikan aset keuangan tersebut, namun telah memindahkan pengendalian atas aset tersebut.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

f. Financial Instruments (Continued) Financial Assets (Continued) Subsequent Measurement Loans and receivables are non-derivative

financial assets with fixed or determinable payments that are not quoted in an active market. Such financial assets are subsequently measured at amortized cost using the Effective Interest method, less impairment. Gains and losses are recognized in the Consolidated Statements of Comprehensive Income when the loans and receivables are derecognized or impaired, as well as through the amortization process.

Derecognition A financial asset (or where applicable, a

part of a financial asset or part of a group of similar financial assets) is derecognized when: (1) the rights to receive cash flows from the asset have expired; or (2) the Company and Subsidiary have transferred their rights to receive cash flows from the asset or have assumed an obligation to pay the received cash flows in full without material delay to a third party under a “pass-through” arrangement; and either (a) the Company and Subsidiary have transferred substantially all the risks and rewards of the asset, or (b) the Company and Subsidiary have neither transferred nor retained substantially all the risks and rewards of the asset, but have transferred control of the asset.

Page 175: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

16

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) f. Instrumen Keuangan (Lanjutan) Aset Keuangan (Lanjutan) Penurunan Nilai Aset Keuangan Pada setiap akhir periode pelaporan,

Perusahaan dan Entitas Anak mengevaluasi apakah terdapat bukti yang obyektif bahwa aset keuangan atau kelompok aset keuangan mengalami penurunan nilai.

Untuk pinjaman yang diberikan dan piutang

yang dicatat pada biaya perolehan diamortisasi, Perusahaan dan Entitas Anak terlebih dahulu menentukan bahwa terdapat bukti obyektif mengenai penurunan nilai secara individual atas aset keuangan yang signifikan secara individual, atau secara kolektif untuk aset keuangan yang tidak signifikan secara individual. Jika Perusahaan dan Entitas Anak menentukan tidak terdapat bukti obyektif mengenai penurunan nilai atas aset keuangan yang dinilai secara individual, terlepas aset keuangan tersebut signifikan atau tidak, maka aset tersebut dimasukkan ke dalam kelompok aset keuangan yang memiliki karakteristik risiko kredit yang sejenis dan menilai penurunan nilai kelompok tersebut secara kolektif. Aset yang penurunan nilainya dinilai secara individual dan untuk itu kerugian penurunan nilai diakui atau tetap diakui, tidak termasuk dalam penilaian penurunan nilai secara kolektif.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

f. Financial Instruments (Continued) Financial Assets (Continued) Impairment of Financial Assets The Company and Subsidiary assess at

each reporting date whether there is any objective evidence that a financial asset or a group of financial assets is impaired.

For loans and receivables carried at

amortized cost, the Company and Subsidiary first assess whether objective evidence of impairment exists individually for financial assets that are individually significant, or collectively for financial assets that are not individually significant. If the Company and Subsidiary determine that no objective evidence of impairment exists for an individually assessed financial asset, whether significant or not, the asset is included in a group of financial assets with similar credit risk characteristics and collectively assessed for impairment. Assets that are individually assessed for impairment and for which an impairment loss is, or continues to be, recognized are not included in a collective assessment of impairment.

Page 176: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

17

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) f. Instrumen Keuangan (Lanjutan) Aset keuangan (Lanjutan) Penurunan Nilai Aset Keuangan (Lanjutan) Jika terdapat bukti obyektif bahwa kerugian

penurunan nilai telah terjadi, jumlah kerugian tersebut diukur sebagai selisih antara nilai tercatat aset dengan nilai kini estimasi arus kas masa datang (tidak termasuk kerugian kredit di masa mendatang yang belum terjadi). Nilai kini estimasi arus kas masa datang didiskonto dengan menggunakan suku bunga efektif awal dari aset keuangan tersebut. Jika pinjaman yang diberikan dan piutang memiliki suku bunga variabel, maka tingkat diskonto yang digunakan untuk mengukur setiap kerugian penurunan nilai adalah suku bunga efektif yang berlaku.

Nilai tercatat atas aset keuangan dikurangi

melalui penggunaan pos cadangan penurunan nilai dan jumlah kerugian yang terjadi diakui dalam Laporan Laba Rugi Konsolidasi. Pendapatan bunga selanjutnya diakui sebesar nilai tercatat yang diturunkan nilainya berdasarkan tingkat suku bunga efektif awal dari aset keuangan. Pinjaman yang diberikan dan piutang beserta dengan cadangan terkait dihapuskan jika tidak terdapat kemungkinan yang realistis atas pemulihan di masa mendatang dan seluruh agunan telah terealisasi atau dialihkan kepada Perusahaan dan Entitas Anak. Jika, pada tahun berikutnya, nilai estimasi kerugian penurunan nilai aset keuangan bertambah atau berkurang karena peristiwa yang terjadi setelah penurunan nilai diakui, maka kerugian penurunan nilai yang diakui sebelumnya bertambah atau berkurang dengan menyesuaikan pos cadangan penurunan nilai. Jika di masa mendatang penghapusan tersebut dapat dipulihkan, jumlah pemulihan tersebut diakui pada Laporan Laba Rugi Komprehensif Konsolidasi.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

f. Financial Instruments (Continued) Financial Assets (Continued) Impairment of Financial Assets (Continued)

If there is objective evidence that an impairment loss has occurred, the amount of the loss is measured as the difference between the asset’s carrying amount and the present value of estimated future cash flows (excluding future expected credit losses that have not yet been incurred). The present value of the estimated future cash flows is discounted at the financial asset’s original effective interest rate. If a loan has a variable interest rate, the discount rate for measuring impairment loss is the current effective interest rate. The carrying amount of the financial asset is reduced through the use of an allowance for impairment account and the amount of the loss is recognized in the consolidated statement of income. Interest income continues to be accrued on the reduced carrying amount based on the original effective interest rate of the financial asset. Loans and receivables, together with the associated allowance, are written off when there is no realistic prospect of future recovery and all collateral has been realized or has been transferred to the Company and Subsidiary. If, in a subsequent year, the amount of the estimated impairment loss increases or decreases because of an event occurring after the impairment was recognized, the previously recognized impairment loss is increased or reduced by adjusting the allowance for impairment account. If a future write-off is later recovered, the recovery is recognized in the Consolidated Statement of Comprehensive Income.

Page 177: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

18

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) f. Instrumen Keuangan (Lanjutan)

Liabilitas Keuangan Pengakuan Awal dan Pengukuran Liabilitas keuangan diklasifikasikan sebagai liabilitas keuangan yang diukur pada nilai wajar melalui laporan laba atau rugi, liabilitas keuangan pada biaya perolehan diamortisasi atau derivatif yang telah ditetapkan untuk tujuan lindung nilai yang efektif, jika sesuai. Perusahaan dan Entitas Anak menentukan klasifikasi liabilitas keuangan pada saat pengakuan awal. Saat pengakuan awal, liabilitas keuangan diukur pada nilai wajar, dan dalam hal hutang dan pinjaman, termasuk biaya transaksi yang dapat diatribusikan secara langsung. Liabilitas keuangan Perusahaan dan Entitas Anak terdiri dari hutang usaha kepada pihak ketiga, hutang lain-lain dan beban masih harus dibayar yang termasuk dalam kategori liabilitas keuangan pada biaya perolehan diamortisasi. Pengukuran Setelah Pengakuan Awal Setelah pengakuan awal, liabilitas keuangan diukur pada biaya perolehan diamortisasi menggunakan metode Suku Bunga Efektif. Keuntungan dan kerugian diakui dalam Laporan Laba Rugi Komprehensif Konsolidasi pada saat pinjaman dan hutang jangka panjang dihentikan pengakuannya atau diturunkan nilainya melalui proses amortisasi.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

f. Financial Instruments (Continued) Financial Liabilities Initial Recognition and Measurement Financial liabilities are classified as

financial liabilities at fair value through profit or loss, financial liabilities measured at amortized cost, or as derivatives designated as hedging instruments in an effective hedge, as appropriate. The Company and Subsidiary determine the classification of their financial liabilities at initial recognition.

Financial liabilities are recognized initially at

fair value and, in the case of loans and borrowings, inclusive of directly attributable transaction costs.

The Company and Subsidiary’s financial

liabilities of trade payables to third parties, other payables and accrued expenses were categorized as financial liabilities masured at amortized cost.

Subsequent Measurement Subsequent to initial recognition, all

financial liabilities are measured at amortized cost using the Effective Interest method. Gains and losses are recognized in the Consolidated Statements of Comprehensive Income when the loans and borrowings are derecognized or impaired through an amortization process.

Page 178: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

19

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) f. Instrumen Keuangan (Lanjutan)

Liabilitas Keuangan (Lanjutan) Penghentian Pengakuan Liabilitas keuangan dihentikan pengakuannya ketika liabilitas yang ditetapkan dalam kontrak dihentikan atau dibatalkan atau kadaluwarsa. Ketika liabilitas keuangan awal digantikan dengan liabilitas keuangan lain dari pemberi pinjaman yang sama dengan ketentuan yang berbeda secara substansial, atau modifikasi secara substansial atas liabilitas keuangan yang saat ini ada, maka pertukaran atau modifikasi tersebut dicatat sebagai penghapusan liabilitas keuangan awal dan pengakuan liabilitas keuangan baru. Selisih antara nilai tercatat liabilitas keuangan tersebut diakui sebagai laba atau rugi. Saling Hapus Instrumen Keuangan Aset keuangan dan liabilitas keuangan saling hapus dan nilai netonya disajikan dalam Laporan Posisi Keuangan (Neraca) Konsolidasi jika, dan hanya jika, terdapat hak yang berkekuatan hukum untuk melakukan saling hapus atas jumlah yang telah diakui dari aset keuangan dan liabilitas keuangan tersebut dan terdapat intensi untuk menyelesaikan dengan menggunakan dasar neto, atau untuk merealisasikan aset dan menyelesaikan liabilitasnya secara bersamaan.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

f. Financial Instruments (Continued) Financial Liabilities (Continued) Derecognition A financial liability is derecognized when

the obligation under the liability is discharged or cancelled or has expired.

When an existing financial liability is

replaced by another from the same lender on substantially different terms, or the terms of an existing liability are substantially modified, such an exchange or modification is treated as a derecognition of the original liability and the recognition of a new liability, and the difference in the respective carrying amounts is recognized in profit or loss.

Offsetting of Financial Instruments Financial assets and financial liabilities are

offset and the net amount is reported in the Consolidated Statement of Financial Position (Balance Sheet) if, and only if, there is a currently enforceable legal right to offset the recognized amounts and there is an intention to settle on a net basis, or to realize the assets and settle the liabilities simultaneously.

Page 179: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

20

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) f. Instrumen Keuangan (Lanjutan)

Nilai Wajar Instrumen Keuangan Nilai wajar instrumen keuangan yang secara aktif diperdagangkan di pasar keuangan ditentukan dengan mengacu pada kuotasi harga pasar yang berlaku pada penutupan pasar pada akhir periode pelaporan. Untuk instrumen keuangan yang tidak diperdagangkan di pasar aktif, nilai wajar ditentukan dengan menggunakan teknik penilaian. Teknik penilaian tersebut meliputi penggunaan transaksi pasar terkini yang dilakukan secara wajar (arm’s-length market transactions), referensi atas nilai wajar terkini dari instrumen lain yang secara substantial sama, analisis arus kas yang didiskonto, atau model penilaian lainnya.

g. S e w a Efektif tanggal 1 Januari 2012, Perusahaan

menerapkan PSAK 30 (Revisi 2011), “Sewa”. Penerapan PSAK 30 revisi ini tidak memberikan dampak yang signifikan terhadap Laporan Keuangan Konsolidasi.

Penentuan apakah suatu perjanjian

merupakan perjanjian sewa atau perjanjian yang mengandung sewa didasarkan atas substansi perjanjian pada tanggal awal sewa dan apakah pemenuhan perjanjian tergantung pada penggunaan suatu aset dan perjanjian tersebut memberikan suatu hak untuk menggunakan aset tersebut. Sewa yang mengalihkan secara substansial seluruh risiko dan manfaat yang terkait dengan kepemilikan aset, diklasifikasikan sebagai sewa pembiayaan. Selanjutnya, suatu sewa diklasifikasikan sebagai sewa operasi, jika sewa tidak mengalihkan secara substansial seluruh risiko dan manfaat yang terkait dengan kepemilikan aset.

Dalam sewa operasi dimana Perusahaan

dan Entitas Anak sebagai lessee, Perusahaan dan Entitas Anak mengakui pembayaran sewa sebagai beban dengan dasar Garis Lurus selama masa sewa.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

f. Financial Instruments (Continued)

Fair Value of Financial Instruments The fair value of financial instruments that

are traded in active markets is determined by reference to quoted market prices at the market closing at the reporting period-end. For financial instruments where there is no active market, fair value is determined using valuation techniques. Such techniques may include using a recent arm’s length market transaction, reference to the current fair value of another instrument that is substantially the same, discounted cash flow analysis, or other valuation models.

g. L e a s e s Effective January 1, 2012, the Company

adopted SFAS 30 (Revised 2011), “Leases”. The adoption of SFAS 30 (Revised 2011) had no significant impact on the Consolidated Financial Statements.

The determination of whether an

arrangement is, or contains, a lease is based on the substance of the arrangement at the inception date and whether the fulfillment of the arrangement is dependent on the use of a specific asset and the arrangement conveys a right to use the asset. Leases that transfer to the lessee substantially all of the risks and rewards incidental to ownership of the leased item are classified as finance leases. Leases which do not transfer substantially all of the risks and rewards incidental to ownership of the leased item are classified as operating leases.

Under an operating lease, the Company

and Subsidiary recognize lease payments as an expense on a Straight-line basis over the lease term.

Page 180: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

21

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) h. Piutang Usaha dan Piutang Lain-lain Piutang usaha dan piutang lain-lain pada

awalnya diakui sebesar nilai wajar dan selanjutnya diukur pada biaya perolehan diamortisasi, setelah dikurangi cadangan penurunan nilai piutang.

Cadangan penurunan nilai piutang dibentuk

pada saat terdapat bukti obyektif bahwa saldo piutang tidak dapat ditagih. Piutang dan cadangan penurunan nilai piutang dihapus pada saat piutang tersebut dipastikan tidak tertagih.

i. P e r s e d i a a n Persediaan dicatat berdasarkan nilai

terendah antara biaya perolehan dengan nilai realisasi bersih. Biaya perolehan ditentukan dengan menggunakan metode Rata-rata.

Nilai realisasi bersih adalah estimasi harga

jual dalam kegiatan usaha normal, dikurangi taksiran harga penyelesaian dan beban penjualan.

j. Aset Tetap Efektif tanggal 1 Januari 2012, Perusahaan

menerapkan secara prospektif PSAK 16 (Revisi 2011), ”Aset Tetap”.

ISAK 25, “Hak Atas Tanah“, yang merupakan

interpretasi dari PSAK 16 (Revisi 2011) menetapkan bahwa biaya pengurusan legal hak atas tanah dalam bentuk Hak Guna Usaha (HGU), Hak Guna Bangunan (HGB) dan Hak Pakai (HP) yang dikeluarkan pada saat tanah diperoleh pertama kali diakui sebagai bagian dari biaya perolehan tanah dan tidak diamortisasi. Sementara itu, biaya yang terjadi sehubungan dengan perpanjangan atau pembaharuan hak-hak tersebut diatas diakui sebagai aset tak berwujud dan diamortisasi sepanjang umur hukum hak atau umur ekonomi tanah, mana yang lebih pendek.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

h. Trade Receivables and Other

Receivables Trade and other receivables are recognised

initially at fair value and subsequently measured at amortised cost, less provision for doubtful receivables.

Provision for doubtful receivables are

established when there is objective evidence that the outstanding amounts will not be collected. Doubtful accounts are written off during the period in which they are determined to be not collectible.

i. I n v e n t o r i e s Inventories are stated at the lower of cost

or net realizable value. Cost of inventories is determined based on the Average method.

Net realizable value is the estimated selling

price in the ordinary course business activities, less estimated cost of completion and selling expenses.

j. Fixed Assets Effective January 1, 2012, the Company

prospectively adopted SFAS 16 (Revised 2011), “Fixed Assets”.

IFAS 25, “Land Rights”, which is an

interpretation of SFAS 16 (Revised 2011), prescribes that the costs incurred in order to acquire legal rights over land in form of “Hak Guna Usaha” (HGU), “Hak Guna Bangunan” (HGB) and “Hak Pakai” (HP) upon initial acquisition of land be recognized as part of the acquisition cost of the land and are not amortized. Meanwhile, costs incurred in connection with the extension or renewal of the above rights are recognized as intangible asset and are amortized throughout the validity period of the rights or the economic useful life of the land, whichever is shorter.

Page 181: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

22

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

j. Aset Tetap (Lanjutan) Sehubungan dengan perubahan diatas, pada

tanggal 1 Januari 2012 saldo beban tangguhan yang berasal dari biaya pengurusan legal hak atas tanah awal direklasifikasi ke akun Aset Tetap dan amortisasinya dihentikan.

Selain hal yang telah dijelaskan diatas,

penerapan PSAK 16 revisi ini tidak memberikan pengaruh signifikan terhadap Laporan Posisi Keuangan (Neraca) Konsolidasi. Perusahaan dan Entitas Anak memilih model Biaya sebagai kebijakan akuntansi untuk pengukuran aset tetapnya.

Aset tetap dibukukan berdasarkan biaya

perolehan setelah dikurangi akumulasi penyusutan dan rugi penurunan nilai, jika ada. Aset tetap, kecuali tanah dan aset dalam penyelesaian, disusutkan dengan menggunakan metode Garis Lurus (Straight-line method) berdasarkan taksiran masa manfaat keekonomian masing-masing aset tetap, sebagai berikut :

Bangunan dan Sarana 10 - 20 tahun Mesin dan Peralatan 4 - 12 tahun K e n d a r a a n 4 tahun Inventaris Kantor dan Mess 4 - 8 tahun

Tanah tidak disusutkan. Aset dalam penyelesaian dinyatakan sebesar biaya perolehan dan disajikan sebagai bagian dari aset tetap. Akumulasi biaya perolehan aset tersebut akan dipindahkan ke masing-masing aset tetap pada saat aset tersebut selesai dikerjakan dan siap digunakan. Penyusutan mulai dibebankan pada bulan aset tersebut digunakan.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

j. Fixed Assets (Continued) In connection with the above changes, on

January 1, 2012, deferred charges arising from the initial acquisition of legal rights over land were reclassified to “Fixed Assets” and no longer amortized.

Other than as described above, the

adoption of SFAS 16 (Revised 2011) had no significant impact on the Company’s Consolidated Financial Statements. The Company and Subsidiary chose the cost method as their accounting policy for fixed assets measurement.

Fixed assets are stated at cost less

accumulated depreciation and accumulated losses on impairment value. Except for land and construction in progress which is not depreciated. Fixed assets are depreciated using the Straight-line method over the estimated useful lives of the assets as follows :

Buildings and Infrastructures 10 - 20 years Machinery and Equipment 4 - 12 years V e h i c l e s 4 years Office and Mess Equipment 4 - 8 years Land is not depreciated. Construction in progress is presented at

cost. And presented as part of fixed assets Accumulated costs of such asset will be reclassified to the respective asset when the asset is completed and ready for use. Depreciation starts in the month the asset is used.

Page 182: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

23

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

j. Aset Tetap (Lanjutan) Biaya-biaya setelah pengakuan awal aset

diakui sebagai bagian dari nilai tercatat aset atau sebagai aset yang terpisah, sebagaimana seharusnya, hanya apabila kemungkinan besar Perusahaan dan Entitas Anak akan mendapatkan manfaat ekonomis di masa depan berkenaan dengan aset tersebut dan biaya perolehan aset dapat diukur dengan handal. Nilai yang terkait dengan penggantian komponen tidak diakui. Biaya perbaikan dan pemeliharaan dibebankan ke dalam laba rugi selama periode dimana biaya-biaya tersebut terjadi.

Nilai residu, umur manfaat aset dan metode

penyusutan ditelaah, dan jika perlu disesuaikan, pada setiap akhir periode pelaporan.

Apabila aset tetap dilepas, maka nilai

tercatat dan akumulasi penyusutannya dikeluarkan dari Laporan Posisi Keuangan (Neraca) Konsolidasi dan keuntungan atau kerugian yang dihasilkan diakui dalam Laporan Laba Rugi Komprehensif Konsolidasi periode berjalan.

k. Penurunan Nilai Aset Non-keuangan Aset non-keuangan ditelaah untuk

mengetahui apakah telah terjadi penurunan nilai bilamana terdapat kejadian atau perubahan keadaan yang mengindikasikan bahwa nilai tercatat aset tersebut tidak dapat diperoleh kembali. Kerugian akibat penurunan nilai diakui sebesar selisih antara nilai tercatat aset dengan nilai yang dapat diperoleh kembali dari aset tersebut.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

j. Fixed Assets (Continued) Subsequent costs are included in the

asset's carrying amount or recognized as a separate asset, as appropriate, only when it is probable that future economic benefits associated with the item will flow to the Company and Subsidiary and the cost of the item can be measured reliably. Amounts of component replacement, repairs and maintenance costs are charged to profit or loss during the period in which they are incurred.

The residual values, useful lives and

methods of depreciation are reviewed, and adjusted prospectively if appropriate, at each financial year-end.

When assets are retired or otherwise

disposed of, their carrying values and the related accumulated depreciation are removed from the accounts and any resulting gain or loss is reflected in the Consolidated Statement of Comprehensive Income for the year.

k. Impairment of Non-Financial Assets Non-financial assets are reviewed for

impairment whenever events or changes in circumstances indicate that the carrying amount may not be recoverable. Losses due to impairment loss is recognized equal to the difference between the assets’ carrying value of the recoverable amount of the assets.

Page 183: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

24

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) k. Penurunan Nilai Aset Non-keuangan

(Lanjutan) Nilai yang dapat diperoleh kembali adalah

nilai yang lebih tinggi antara nilai wajar dikurangi biaya untuk menjual dan nilai pakai aset. Dalam rangka mengukur penurunan nilai, aset dikelompokkan hingga unit terkecil yang menghasilkan arus kas terpisah.

Setiap tanggal pelaporan, aset non-

keuangan, selain goodwill, yang telah mengalami penurunan nilai ditelaah untuk menentukan apakah terdapat kemungkinan pemulihan penurunan nilai. Jika terjadi pemulihan nilai, maka langsung diakui dalam laba rugi, tetapi tidak boleh melebihi akumulasi rugi penurunan nilai yang telah diakui sebelumnya.

l. Aset Tidak Berwujud - Biaya

Ditangguhkan Biaya yang terjadi sehubungan dengan

pengurusan perpanjangan legal hak atas tanah ditangguhkan dan diamortisasi berdasarkan masa manfaatnya yaitu 20 dan 30 tahun dengan menggunakan metode Garis Lurus (Straight-line method).

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

k. Impairment of Non-Financial Assets

(Continued) Recoverable amount is the higher of its fair

value less cost to sell and its value in use of the assets. For the purposes of assessing impairment, assets are grouped at the lowest levels for which there are separately identifiable cash flows.

At each reporting date, non-financial

assets, other than goodwill, that suffered impairment are reviewed for possible reversal of the impairment. Recoverable amount is immediately recognized in profit or loss, but not in excess of any accumulated impairment loss previously recognized.

l. Intangible Assets – Deferred Charges Expenses incurred in connection with

obtaining the extension of legal rights to the land are deferred and amortized over the useful life of 20 and 30 years using the Straight-line method.

Page 184: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

25

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

m. Selisih Nilai Transaksi Restrukturisasi

Entitas Sepengendali Transaksi yang dilakukan dengan entitas

sepengendali diterapkan metode Penyatuan Kepemilikan (Pooling of Interest). Transaksi kombinasi bisnis antara entitas sepengendali berupa pengalihan bisnis yang dilakukan dalam rangka reorganisasi entitas-entitas yang berada dalam suatu kelompok usaha yang sama bukan perubahan pemilikan dalam arti substansi ekonomi, sehingga transaksi demikian tidak menimbulkan laba rugi bagi seluruh kelompok usaha atau bagi entitas individual dalam kelompok usaha tersebut. Selisih antara harga pengalihan dengan jumlah tercatat dari setiap transaksi kombinasi bisnis antara entitas sepengendali pada tanggal pengalihan dicatat sebagai “Selisih Nilai Transaksi Restrukturisasi Entitas Sepengendali” dan disajikan dalam bagian Ekuitas di Laporan Posisi Keuangan (Neraca) Konsolidasi.

n. Pengakuan Pendapatan dan Beban Pendapatan diakui bila besar kemungkinan

manfaat ekonomi akan diperoleh Perusahaan dan Entitas Anak dan jumlahnya dapat diukur secara andal.

Pendapatan dari penjualan barang diakui

pada saat risiko dan manfaat kepemilikan barang secara signifikan telah berpindah kepada pelanggan.

Pendapatan jasa diakui pada saat jasa diberikan.

Beban diakui pada saat terjadinya (basis

Akrual).

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

m. Differences Arising from Restructuring

Transactions among Entities under Common Control

Transactions carried out with entities under

common control are applied to the Pooling of Interest method. Business combination transactions between entities under common control, in the form of business transfers done in the framework of the reorganization of the entities that are in the same business group do not representa change of ownership in terms of economic substance, so the transactions would not result in a gain or loss for the entire business group or individual entities within the business groups. The differences between the transfer price and the carrying amount of each business combination transaction between entities under common control at the date of transfer are recorded as "Differences Arising from Restructuring Transactions among Entities under Common Control" and presented in the Equity in the Consolidated Statements of Financial Position (Balance Sheets).

n. Revenue and Expense Recognition Revenue is recognized when there is likely

that the economic benefits will be obtained by the Company and Subsidiary and the amount can be measured reliably.

Revenues from sales are recognized when

the risk and the ownership benefits of the goods are significantly transferred to the customers.

Revenues from services are recognized

when the services are rendered. Expenses are recognized as incurred

(Accrual basis).

Page 185: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

26

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

o. Transaksi dan Saldo dalam Mata Uang

Asing Efektif tanggal 1 Januari 2012, Perusahaan

dan Entitas Anak menerapkan PSAK 10 (Revisi 2010), ”Pengaruh Perubahan Kurs Valuta Asing”. Standar yang telah direvisi ini mensyaratkan entitas untuk menentukan mata uang fungsional dan menjabarkan seluruh mata uang asing ke mata uang fungsionalnya. Mata uang fungsional ditentukan dengan menggunakan hierarki faktor primer dan sekunder. Sebuah entitas boleh menyajikan laporan keuangannya dalam mata uang apapun. Berdasarkan PSAK 10 tersebut, Perusahaan dan Entitas Anak mengubah mata uang pelaporan dari Rupiah ke Dolar Amerika Serikat, sebagai mata uang fungsional Perusahaan dan Entitas Anak.

Transaksi dalam tahun berjalan yang

menggunakan mata uang asing dibukukan berdasarkan kurs yang berlaku pada saat transaksi terjadi.

Pada tanggal Laporan Posisi Keuangan

(Neraca) Konsolidasi, aset dan liabilitas moneter dalam mata uang asing dijabarkan ke dalam Dolar Amerika Serikat dengan menggunakan kurs tengah Bank Indonesia yang berlaku pada tanggal tersebut. Laba atau rugi kurs yang timbul dari transaksi dan penyesuaian aset dan liabilitas dalam mata uang asing tersebut dikreditkan atau dibebankan dalam Laporan Laba Rugi Komprehensif Konsolidasi tahun berjalan.

Nilai tukar yang digunakan Perusahaan pada

tanggal Laporan Posisi Keuangan (Neraca) Konsolidasi sebagai berikut :

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

o. Foreign Currency Transactions and

Translation Effective January 1, 2012, the Company

adopted SFAS 10 (Revised 2010), “The Effects of Changes in Foreign Exchange Rates”. The revised standard requires an entity to determine the functional currency and translate all foreign currencies to the functional currency. Functional currency is determined by using a hierarchy of primary and secondary factors. An entity may present its financial statements in any currency. Based on SFAS 10, the Company and Subsidiary have changed the reporting currency from Indonesian Rupiah to United States Dollar, which is the functional currency of the Company and Subsidiary.

Transactions during the year using foreign

currencies are recorded based on the prevailing exchange rate at the time the transaction occurs.

At Consolidated Statement of Financial

Position (Balance Sheet) dates, monetary assets and liabilities denominated in foreign currencies are converted into United States Dollar at the middle rates of Bank Indonesia prevailing at such dates. Any resulting gain or loss is credited or charged to the Consolidated Statement of Comprehensive Income for the year.

The conversion rates used by the Company

at Statement of Financial Position (Balance Sheet) dates are as follows :

2 0 1 2 2 0 1 1

IDR 1.000 0,1034 0,1103 IDR 1,000

SGD 1 0,8177 0,7691 SGD 1

JPY 1 0,0116 0,0129 JPY 1

MYR 1 0,3267 0,3146 MYR 1

Page 186: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

27

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

p. Biaya Emisi Saham Biaya emisi saham merupakan akumulasi

biaya yang terjadi sehubungan dengan penawaran umum saham Perusahaan kepada masyarakat. Biaya emisi saham disajikan sebagai pengurang ekuitas dan tidak diamortisasi.

q. Pajak Penghasilan Efektif tanggal 1 Januari 2012, Perusahaan

menerapkan PSAK 46 (Revisi 2010), “Pajak Penghasilan”. Penerapan PSAK 46 revisi ini tidak memberikan pengaruh yang signifikan terhadap Laporan Keuangan Konsolidasi.

Beban pajak kini ditentukan berdasarkan

penghasilan kena pajak dalam periode yang bersangkutan yang dihitung berdasarkan tarif pajak yang berlaku. Pajak kini dihitung untuk setiap perusahaan sebagai badan hukum yang berdiri sendiri.

Pajak tangguhan diakui menggunakan

metode liabilitas atas perbedaan temporer antara dasar pengenaan pajak aset dan liabilitas dan nilai tercatatnya dalam Laporan Keuangan Konsolidasi pada akhir periode pelaporan. Liabilitas pajak tangguhan diakui untuk semua perbedaan temporer kena pajak dan aset pajak tangguhan diakui untuk perbedaan temporer yang boleh dikurangkan dan akumulasi rugi fiskal, sepanjang besar kemungkinan dapat dimanfaatkan untuk mengurangi laba kena pajak pada masa datang.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

p. Stock Issuance Cost The stock issuance cost is an accumulation

of expenses incurred in a connection with the initial public offering. The stock issuance cost is presented as deduction to additional paid-in capital and not amortized.

q. Income Tax Effective January 1, 2012, the Company

adopted SFAS 46 (Revised 2010), “Income Taxes”. The adoption of SFAS 46 (Revised 2010) had no significant impact on the Company's Consolidated Financial Statements.

The current tax expense is determined

based on the taxable income in the period calculated based on the prevailing tax rates. Current tax is calculated for every company as an independent legal entity.

Deferred tax is provided using the liability

method on temporary differences between the tax bases of assets and liabilities and their carrying amounts for financial reporting purposes at the end of the reporting period. Deferred tax liabilities are recognized for all taxable temporary differences and deferred tax assets are recognized for all deductible temporary differences and carryforward of unused fiscal losses, to the extent that it is probable that taxable profit will be available against which the deductible temporary differences and the carry-forward of unused fiscal losses can be utilized.

Page 187: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

28

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) q. Pajak Penghasilan (Lanjutan) Pajak tangguhan diukur dengan

menggunakan tarif pajak yang berlaku atau secara substantial telah berlaku pada tanggal Laporan Posisi Keuangan (Neraca) Konsolidasi. Perubahan nilai tercatat aset atau liabilitas pajak tangguhan yang disebabkan penyisihan dan/atau penyesuaian kembali dari seluruh perbedaan temporer, termasuk perubahan tarif pajak dibebankan atau dikreditkan pada Laporan Laba Rugi Komprehensif Konsolidasi tahun berjalan.

Aset dan liabilitas pajak tangguhan saling

hapus ketika terdapat hak yang dapat dipaksakan secara hukum untuk melakukan saling hapus aset pajak kini terhadap liabilitas pajak kini dan pajak tangguhan tersebut terkait dengan entitas kena pajak yang sama dan otoritas perpajakan yang sama.

Untuk setiap entitas yang dikonsolidasi,

pengaruh pajak atas perbedaan temporer dan akumulasi rugi pajak yang masing-masing dapat berupa aset atau liabilitas, disajikan dalam jumlah bersih untuk masing-masing entitas tersebut.

Jumlah tambahan pokok dan denda pajak

yang ditetapkan dengan Surat Ketetapan Pajak (SKP) diakui sebagai pendapatan atau beban dalam Laporan Laba Rugi Komprehensif Konsolidasi periode berjalan, kecuali jika diajukan upaya penyelesaian selanjutnya. Jumlah tambahan pokok pajak dan denda yang ditetapkan dengan SKP ditangguhkan pembebanannya sepanjang memenuhi kriteria pengakuan aset.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

q. Income Tax (Continued) Deferred income tax is calculated at the tax

rates that have been enacted or substantively enacted at the Consolidated Statement of Financial Position (Balance Sheet) date. Changes in the carrying amount of deferred tax assets or liabilities due to a provision and/or readjustment to all temporary differences are credited or charged to the current Consolidated Statement of Comprehensive Income.

Deferred tax assets and deferred tax

liabilities are offset if a legally enforceable right exists to set off current tax assets against current income tax liabilities and the deferred taxes relate to the same taxable entity and the same taxation authority.

For each of the consolidated entities, the

tax effects of temporary differences and fiscal loss carry forwards each of which can be either an asset or a liability, are presented on a net basis for each of these entities.

Additional principal amount of tax and

penalties established by the Tax Assessment (SKP) is recognized as income or expense in the Consolidated Statement of Comprehensive Income for the period, unless there are further proposed remedies. An additional amount of principal outstanding taxes and penalties are deferred when they meet the recognition criteria of assets.

Page 188: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

29

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

r. Imbalan Kerja Efektif tanggal 1 Januari 2012, Perusahaan

menerapkan PSAK 24 (Revisi 2010), “Imbalan Kerja”. PSAK 24 (Revisi 2010) memperbolehkan entitas untuk menerapkan metode yang sistematis atas pengakuan yang lebih cepat dari kerugian/keuntungan aktuarial, yang antara lain adalah pengakuan langsung dari seluruh keuntungan/kerugian aktuarial. Karena Perusahaan dan Entitas Anak tidak memilih metode ini namun tetap menggunakan metode pengakuan keuntungan/kerugian sebelumnya seperti diuraikan lebih lanjut berikut ini, maka penerapan PSAK 24 revisi ini tidak memberikan pengaruh yang signifikan atas Laporan Keuangan Konsolidasi.

Imbalan Kerja Jangka Pendek Imbalan kerja jangka pendek diakui pada

saat terutang kepada karyawan. Imbalan Pasca Kerja Perusahaan memberikan imbalan pasca-

kerja kepada karyawannya sesuai dengan ketentuan dari Undang-undang Ketenagakerjaan No. 13/2003 tanggal 25 Maret 2003. Penyisihan atas imbalan pasca-kerja dihitung menggunakan metode aktuaria Proyeksi Kredit Unit.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

r. Employee Benefits Effective January 1, 2012, the Company

implemented SFAS 24 (Revised 2010), “Employee Benefits”. SFAS 24 (Revised 2010) permits entities to adopt certain systematic methods of faster recognition, which include, among others, immediate recognition of all actuarial gains and losses. Since the Company and Subsidiary opted not to apply this method but to continuously use the previous actuarial gain/loss recognition method as further disclosed below, the initial adoption of this revised SFAS 24 had no significant impact on the Consolidated Financial Statements.

Short-term Employee Benefits Short-term employee benefits are

recognized when they accrue to the employees.

Post-Employment Benefits The Company provides post-employment

benefits to its employees in conformity with the requirements of Labor Law No. 13/2003 dated March 25, 2003. The provision for post-employment benefits is determined using the Projected Unit Credit actuarial method.

Page 189: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

30

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

r. Imbalan Kerja (Lanjutan) Imbalan Pasca Kerja (Lanjutan) Penyisihan biaya jasa kini dibebankan

langsung pada operasi tahun berjalan. Keuntungan atau kerugian aktuarial diakui sebagai penghasilan atau beban apabila akumulasi keuntungan dan kerugian aktuarial yang belum diakui pada akhir periode pelaporan sebelumnya melebihi 10% dari nila ikini liabilitas imbalan pasti. Keuntungan atau kerugian yang melebihi batas 10% ini diamortisasi selama sisa masa kerja rata-rata karyawan dengan metode Garis Lurus. Selanjutnya, biaya jasa masa lalu yang timbul dari pengenalan program imbalan pasti atau perubahan dari liabilitas imbalan pada program imbalan pasti yang telah ada, ditangguhkan dan diamortisasi sampai dengan periode dimana imbalan tersebut telah menjadi hak karyawan.

s. Informasi Segmen Segmen adalah bagian khusus dari

Perusahaan dan Entitas Anak yang terlibat baik dalam menyediakan produk dan jasa (segmen usaha), maupun dalam menyediakan produk dan jasa dalam lingkungan ekonomi tertentu (segmen geografis), yang memiliki risiko dan imbalan yang berbeda dari segmen lainnya.

Pendapatan, beban, hasil, aset dan liabilitas

segmen termasuk item-item yang dapat diatribusikan langsung kepada suatu segmen serta hal-hal yang dapat dialokasikan dengan dasar yang sesuai segmen tersebut.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

r. Employee Benefits (Continued)

Post-Employment Benefits (Continued) Provisions for current service costs are

charged directly to current operations. Actuarial gains or losses are recognized as income or expenses when the net cumulative unrecognized actuarial gains or losses at the end of the previous reporting period exceed 10% of the defined benefit obligation at that date. These gains or losses in excess of the 10% threshold are recognized on the Straight-line basis over the expected average remaining working lives of the employees. Further, past service costs arising from the introduction of a defined benefit plan or changes in the benefits payable of an existing plan are required to be amortized over the period until the benefits concerned become vested.

s. Segment Information A segment is a distinguishable component

of the Company and Subsidiary engaged in providing products and services (business segment) or in providing products and services within a particular economic environment (geographical segment), which is subject to risks and rewards that are different from those in other segments.

Segment revenues, expenses, results,

assets and liabilities include items that can be directly attributed to a segment and items that can be allocated on a basis appropriate to that segment.

Page 190: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

31

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan) t. Laba (Rugi) Bersih Per Saham Efektif tanggal 1 Januari 2012, Perusahaan

menerapkan PSAK 56 (Revisi 2011), ”Laba Per Saham”. Penerapan PSAK 56 revisi ini tidak memberikan pengaruh yang signifikan terhadap Laporan Keuangan Konsolidasi.

Laba bersih per saham dihitung dengan

membagi laba bersih tahun berjalan yang dapat diatribusikan kepada pemilik entitas induk dengan jumlah rata-rata tertimbang dari jumlah saham yang beredar pada tahun yang bersangkutan.

Jumlah rata-rata tertimbang dari jumlah

saham yang beredar untuk tahun yang berakhir pada tanggal 31 Desember 2012 dan 2011 masing-masing sejumlah 1.771.448.000 saham.

Pada tanggal 31 Desember 2012 dan 2011,

Perusahaan tidak mempunyai efek berpotensi saham biasa yang bersifat dilutif, sehingga laba per saham dilusian tidak dihitung dan disajikan pada Laporan Laba Rugi Komprehensif Konsolidasi.

u. Transaksi dengan Pihak Berelasi Berdasarkan PSAK 7 (Revisi 2010),

”Pengungkapan Pihak-pihak Berelasi”, suatu pihak dianggap berelasi dengan Perusahaan jika :

Pihak-pihak berelasi adalah orang atau entitas yang terkait dengan Perusahaan :

a) Orang atau anggota keluarga terdekat mempunyai relasi dengan Perusahaan jika orang tesebut :

i) Memiliki pengendalian atau

pengendalian bersama atas Perusahaan;

ii) Memiliki pengaruh signifikan atas Perusahaan; atau

iii) Personil manajemen kunci Perusahaan atau entitas induk Perusahaan.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

t. Net Income (Loss) per Share Effective January 1, 2012, the Company

adopted SFAS 56 (Revised 2011), “Earnings per Share”. The adoption of this revised SFAS 56 (Revised 2011) had no significant impact on the Consolidated Financial Statements.

Net income per share is calculated by

dividing the net income for the year attributable to the owners of the parent company by the weighted average number of ordinary shares outstanding during the year.

The number of weighted average number

of shares outstanding for the years ended December 31, 2012 and 2011 was 1,771,448,000 shares, each.

As of December 31, 2012 and 2011, the

Company has no outstanding potential dilutive ordinary shares accordingly no diluted income per share are not calculated and presented in the Consolidated Statements of Comprehensive Income.

u. Related Party Transactions Based on SFAS 7 (Revised 2010), “Related

Party disclosure”, a party is considered to be related to the Company if :

Related parties represent a person or an entity who is related to the Company :

a) The person or immediate family members have a relationship with the company if the person :

i) Has control or joint control over the

Company; ii) Has significant influence over the

Company; or iii) Is the key management personnel

of the Company or parent entity of the Company.

Page 191: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

32

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

u. Transaksi dengan Pihak Berelasi

(Lanjutan)

b) Suatu entitas berelasi dengan Perusahaan jika memenuhi salah satu hal berikut :

i) Entitas dan Perusahaan adalah

anggota dari kelompok usaha yang sama (artinya entitas induk, entitas anak dan entitas anak berikutnya terkait dengan entitas lain).

ii) Satu entitas adalah entitas asosiasi atau ventura bersama dari entitas lain (atau entitas asosiasi atau ventura bersama yang merupakan anggota suatu kelompok usaha, yang mana entitas lain tersebut adalah anggotanya).

iii) Kedua entitas tersebut adalah ventura bersama dari pihak ketiga yang sama.

iv) Satu entitas adalah ventura bersama dari entitas ketiga dan entitas yang lain adalah entitas asosiasi dari entitas ketiga.

v) Entitas tersebut adalah suatu program imbalan pasca kerja untuk imbalan kerja dari salah satu entitas pelapor atau entitas yang terkait dengan Perusahaan. Jika Perusahaan adalah entitas yang menyelenggarakan program tersebut, maka entitas sponsor juga berelasi dengan Perusahaan.

vi) Entitas yang dikendalikan atau dikendalikan bersama oleh orang yang diidentifikasi dalam huruf a).

vii) Orang yang diidentifikasi dalam huruf a) i) memiliki pengaruh signifikan atas entitas atau personil manajemen kunci entitas (atau entitas induk dari entitas).

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

u. Related Party Transactions (Continued)

b) An entity is related to the Company if any of the following conditions applies :

i) The entity and the Company are members of the same company (which means that each parent, subsidiary and fellow subsidiary is related to the others).

ii) One entity is an associate or joint venture of the other entity (or an associate or joint venture of which the other entity is a member).

iii) Both entities are joint ventures of

the same third party. iv) One entity is a joint venture of a

third entity and the other entity is an associate of the third entity.

v) The entity is a post-employment

benefit plan for the benefit of employees of either the Company or an entity related to the Company. If the Company is itself such a plan, the sponsoring employers are also related to the Company.

vi) The entity is controlled or jointly

controlled by a person identified in a).

vii) A person identified in a) i) has significant influence over the entity or is a member of the key management personnel of the entity.

Page 192: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

33

2. IKHTISAR KEBIJAKAN AKUNTANSI SIGNIFIKAN (Lanjutan)

u. Transaksi dengan Pihak Berelasi

(Lanjutan) Transaksi dengan pihak berelasi dilakukan

berdasarkan persyaratan yang disetujui oleh kedua belah pihak, dimana persyaratan tersebut mungkin tidak sama dengan transaksi lain yang dilakukan dengan pihak-pihak tidak berelasi. Seluruh transaksi dan saldo yang material dengan pihak-pihak berelasi diungkapkan dalam Catatan atas Laporan Keuangan Konsolidasi.

3. PERUBAHAN MATA UANG PELAPORAN

Pada tanggal 1 Januari 2012, Perusahaan mengubah mata uang pelaporan dari Rupiah ke Dolar Amerika Serikat sesuai mata uang fungsionalnya karena secara substansial sebagian besar transaksi berikut didenominasi dalam mata uang Dolar Amerika Serikat : - Penjualan dan pendapatan Perusahaan dan

Entitas Anak dalam Dolar Amerika Serikat. - Pembelian Perusahaan dan Entitas Anak

dalam Dolar Amerika Serikat. Dengan demikian, manajemen berpendapat bahwa perubahan mata uang pelaporan akan menghasilkan penyajian transaksi Perusahaan yang lebih tepat dalam Laporan Keuangan Konsolidasi. Perubahan mata uang pelaporan Perusahaan sesuai dengan PSAK 10 (Revisi 2010), ”Pengaruh Perubahan Kurs Valuta Asing”.

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Continued)

u. Related Party Transactions (Continued) Transactions with related parties are made

on terms agreed by both parties, in which the terms may not be the same as those unrelated parties. All material transactions and balances with related parties are disclosed in the Notes to the Consolidated Financial Statements.

3. CHANGE REPORTING CURRENCY On January 1, 2012, the Company changed its

reporting currency from Indonesian Rupiah to United States Dollar to be in line with its functional currency since substantially most of the following transactions are denominated in United States Dollar :

- Sales and earnings of the Company and

Subsidiary in United States Dollars. - Purchases of the Company and Subsidiary in

United States Dollars. Thus, the management believes that the change

of the reporting currency will result in a more accurate presentation of the Company's transactions in the Consolidated Financial Statements. The change of the Company’s reporting currency is in accordance with SFAS 10 (Revised 2010), "The Effects of Changes in Foreign Exchange Rates".

Page 193: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

34

3. PERUBAHAN MATA UANG PELAPORAN (Lanjutan)

Untuk tujuan komparatif, Laporan Keuangan Konsolidasi dan catatan yang terkait pada tanggal 31 Desember 2011 telah dinilai kembali, seolah-olah Dolar Amerika Serikat adalah mata uang pelaporan dalam tahun tersebut, dengan menggunakan prosedur sebagai berikut : - Pos moneter Perusahaan dikonversi menjadi

Dolar Amerika Serikat menggunakan kurs akhir tahun, sedangkan pos non-moneter termasuk ekuitas dikonversi menggunakan kurs yang berlaku pada tanggal transaksi; dan

- Penghasilan dan beban dikonversi

menggunakan kurs rata-rata bulanan, kecuali beberapa transaksi yang dikonversi menggunakan kurs yang berlaku pada tanggal transaksi terkait dengan aset dan liabilitas non moneter.

Berikut ini adalah Laporan Posisi Keuangan (Neraca) Konsolidasi tanggal 31 Desember 2011 dan 1 Januari 2011 yang disajikan dalam mata uang Rupiah.

3. CHANGE OF REPORTING CURRENCY (Continued)

For comparative purposes, the Consolidated

Financial Statements and the related notes as of December 31, 2011 had been revalued as if United States Dollar had been the reporting currency in the year, using the following procedures : - The Company’s monetary posts were

converted to United States Dollar using the year-end’s exchange rates, while non-monetary posts including the equity were converted using the exchange rates prevailing at the transaction dates, and

- Income and expenses were converted using

the monthly average exchange rates, except for several transactions of non-monetary assets and liabilities which were converted using the exchange rates prevailing at the transaction dates.

The following are the Statements of Financial

Position (Balance Sheets) as of December 31, 2011 and January 1, 2011 presented in Rupiah :

31 Desember/ 1 Januari/

December 31, January 1,

2 0 1 1 2 0 1 1

ASET LANCAR CURRENT ASSETS

Kas dan Setara Kas 6.632.352.340 23.617.976.208 Cash and Cash Equivalents

Piutang Usaha kepada Pihak Ketiga 201.943.588.098 254.465.254.032 Trade Receivables to Third Parties

Piutang Lain-lain 155.293.923 1.763.937.848 Other Receivables

P e r s e d i a a n 135.436.088.877 143.925.227.611 I n v e n t o r i e s

Pajak Dibayar di Muka 125.196.967 1.742.296.135 Prepaid Taxes

Biaya Dibayar di Muka 1.591.063.033 6.028.524.020 P r e p a y m e n t s

Jumlah Aset Lancar 345.883.583.238 431.543.215.854 Total Current Assets

Page 194: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

35

3. PERUBAHAN MATA UANG PELAPORAN (Lanjutan)

3. CHANGE OF REPORTING CURRENCY (Continued)

31 Desember/ 1 Januari/

December 31, January 1,

2 0 1 1 2 0 1 1

ASET TIDAK LANCAR NON CURRENT ASSETS

Aset Pajak Tangguhan 3.755.941.642 2.033.462.877 Deferred Tax Assets

Aset Tetap - Setelah Dikurangi Akumulasi Fixed Assets - Net of Accumulated

Penyusutan masing-masing sebesar Depreciation amounting to

Rp 367.657.135.778 dan Rp 361.049.337.510 Rp 367,657,135,778 and Rp 361,049,337,510

per 31 Desember 2011 dan 1 Januari 2011 405.649.471.089 391.248.463.907 as of December 31, 2011 and January 1, 2011

Aset Lain-lain : Other Assets :

J a m i n a n 537.306.584 537.306.584 G u a r a n t e e s

Biaya Ditangguhkan - Bersih 1.093.312.192 204.315.627 Deferred Charges - Net

Jumlah Aset Tidak Lancar 411.036.031.507 394.023.548.995 Total Non Current Assets

JUMLAH ASET 756.919.614.745 825.566.764.849 TOTAL ASSETS

LIABILITAS JANGKA PENDEK CURRENT LIABILITIES

Hutang Usaha kepada Pihak Ketiga 248.796.569.221 302.321.789.026 Trade Payables to Third Parties

Hutang Lain-lain 23.818.800.258 33.168.136.600 Other Payables

Hutang Pajak 984.475.113 1.209.204.334 Taxes Payable

Beban Masih Harus Dibayar 3.119.159.670 3.531.986.051 Accrued Expenses

Jumlah Liabilitas Jangka Pendek 276.719.004.262 340.231.116.011 Total Current Liabilities

LIABILITAS JANGKA PANJANG NON CURRENT LIABILITIES

Hutang Lain-lain 1.541.391.129 3.331.376.727 Other Payables

Liabilitas Pajak Tangguhan 380.802.957 558.249.325 Deferred Tax Liabilities

Liabilitas Imbalan Kerja 17.332.683.205 13.117.434.119 Employee Benefits Liabilities

Jumlah Liabilitas Jangka Panjang 19.254.877.291 17.007.060.171 Total Non Current Liabilities

Jumlah Liabilitas 295.973.881.553 357.238.176.182 Total Liabilities

E K U I T A S E Q U I T Y

Capital Stock - Rp 150 par value per share

Modal Saham, nilai nominal Rp 150 per saham Authorized - 4,920,000,000 shares

Modal Dasar - 4.920.000.000 saham Subscribed and Fully Paid - 1,771,448,000

Ditempatkan dan Disetor - 1.771.448.000 saham 265.717.200.000 265.717.200.000 shares

Tambahan Modal Disetor 217.229.578.833 217.229.578.833 Additional Paid-in Capital

Differences Arising from Restructuring

Selisih Nilai Transaksi Restrukturisasi Entitas Transactions among Entities under

Sepengendali (26.550.026.585) (26.550.026.585) Common Control

Saldo Laba : Retained Earnings :

- Ditentukan Penggunaannya 50.000.000 50.000.000 - Appropriated

- Belum Ditentukan Penggunaannya 4.488.505.944 11.871.361.419 - Unappropriated

Ekuitas yang Dapat Diatribusikan Langsung Equity Attributable to Owners of the

kepada Pemilik Entitas Induk 460.935.258.192 468.318.113.667 Parent Company

Kepentingan Non Pengendali 10.475.000 10.475.000 Non-Controlling Interest

Jumlah Ekuitas 460.945.733.192 468.328.588.667 Total Equity

JUMLAH LIABILITAS DAN EKUITAS 756.919.614.745 825.566.764.849 TOTAL LIABILITIES AND EQUITY

Page 195: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

36

3. PERUBAHAN MATA UANG PELAPORAN (Lanjutan)

Berikut ini adalah Laporan Laba Rugi Komprehensif Konsolidasi untuk tahun yang berakhir pada tanggal 31 Desember 2011 (disajikan kembali) yang disajikan dalam mata uang Rupiah.

3. CHANGE OF REPORTING CURRENCY (Continued)

The following is the Consolidated Statements of Comprehensive Income for the year ended December 31, 2011 (restated) presented in Indonesian Rupiah :

P E N D A P A T A N R E V E N U E S

P e n j u a l a n 2.034.514.891.841 S a l e s

Jasa Perakitan 23.113.918.440 Assembling Services

Jumlah Pendapatan 2.057.628.810.281 Total Revenues

BEBAN POKOK COST OF REVENUES

P e n j u a l a n (1.989.466.056.676) Cost of Goods Sold

Jasa Perakitan (15.766.487.205) Cost of Assembling Services

Jumlah Beban Pokok (2.005.232.543.881) Total Cost of Revenues

LABA KOTOR 52.396.266.400 GROSS PROFIT

BEBAN USAHA OPERATING EXPENSES

P e n j u a l a n (5.427.912.649) S e l l i n g

Umum dan Administrasi (59.466.393.441) General and Administrative

Jumlah Beban Usaha (64.894.306.090) Total Operating Expenses

RUGI USAHA (12.498.039.690) LOSS FROM OPERATIONS

PENGHASILAN (BEBAN) LAIN-LAIN OTHER INCOME (CHARGES)

Laba Penjualan Sisa Produksi 2.088.571.640 Gain on Sale of Waste Product

Rugi Selisih Kurs - Bersih (1.885.584.897) Loss on Foreign Exchange - Net

Laba Penjualan Aset Tetap 1.240.814.877 Gain on Disposal of Fixed Assets

Bunga dan Administrasi Bank (398.930.517) Bank Interest and Charges

Lain-lain 2.170.387.979 O t h e r s

Jumlah Penghasilan Lain-lain - Bersih 3.215.259.082 Total Other Income - Net

RUGI SEBELUM PAJAK PENGHASILAN (9.282.780.608) LOSS BEFORE INCOME TAX

PAJAK PENGHASILAN INCOME TAX

Pajak Kini - Current Tax

Pajak Tangguhan 1.899.925.133 Deferred Tax

RUGI BERSIH (7.382.855.475) NET LOSS

PENDAPATAN KOMPREHENSIF LAIN - OTHER COMPREHENSIVE INCOME

RUGI BERSIH KOMPREHENSIF (7.382.855.475) NET COMPREHENSIVE LOSS

RUGI BERSIH KOMPREHENSIF YANG DAPAT NET COMPREHENSIVE LOSS ATTRIBUTABLE

DIATRIBUSIKAN KEPADA : TO :

Pemilik Entitas Induk (7.382.855.475) Owners of the Parent Company

Kepentingan Non Pengendali - Non-Controlling Interest

J u m l a h (7.382.855.475) T o t a l

RUGI BERSIH PER SAHAM DASAR (4,17) NET LOSS PER SHARE

Page 196: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

37

4. KAS DAN SETARA KAS Rinciannya sebagai berikut :

4. CASH AND CASH EQUIVALENTS

The details are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

K a s Cash on Hand

R u p i a h 11.038 9.057 7.267 R u p i a h

S G D 6.150 1.922 5.044 S G D

M Y R 516 493 1.093 M Y R

J u m l a h 17.704 11.472 13.404 T o t a l

B a n k Cash in Banks

Dalam Mata Uang USD United States Dollar

PT Bank Mandiri (Persero) Tbk 761.947 441.204 112.872 PT Bank Mandiri (Persero) Tbk

Sumitomo Mitsui Banking Corporation - Sumitomo Mitsui Banking Corporation -

Cabang Singapura 61.986 19.536 1.437.700 Singapoore Branch

PT Bank Internasional Indonesia Tbk 2.382.023 2.726 62.440 PT Bank Internasional Indonesia Tbk

Dalam Mata Uang SGD Singapore Dollar

PT Bank Mandiri (Persero) Tbk 43.730 100.135 24.325 PT Bank Mandiri (Persero) Tbk

Sumitomo Mitsui Banking Corporation - Sumitomo Mitsui Banking Corporation -

Cabang Singapura 38.417 48.004 23.887 Singapoore Branch

PT Bank Internasional Indonesia Tbk 2.256 2.321 31.563 PT Bank Internasional Indonesia Tbk

Dalam Mata Uang Rupiah Indonesian Rupiah

PT Bank Mandiri (Persero) Tbk 110.897 102.602 100.906 PT Bank Mandiri (Persero) Tbk

PT Bank Internasional Indonesia Tbk 2.466 2.411 18.123 PT Bank Internasional Indonesia Tbk

PT Bank Negara Indonesia (Persero) Tbk 984 761 1.173 PT Bank Negara Indonesia (Persero) Tbk

PT Bank Danamon Indonesia Tbk - - 453 PT Bank Danamon Indonesia Tbk

Dalam Mata Uang JPY Japanese Yen

Sumitomo Mitsui Banking Corporation - Sumitomo Mitsui Banking Corporation -

Cabang Singapura - 229 - Singapoore Branch

J u m l a h 3.404.706 719.929 1.813.442 T o t a l

Deposito Berjangka - Dalam Mata Uang USD Time Deposit - United States Dollar

PT Bank Internasional Indonesia Tbk 4.650.000 - 800.000 PT Bank Internasional Indonesia Tbk

J U M L A H 8.072.410 731.401 2.626.846 T O T A L

Tingkat bunga per tahun sebagai berikut :

The annual interest rates are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Dalam Mata Uang Rupiah - - 5,5 % Indonesian Rupiah

Dalam Mata Uang Dolar Amerika Serikat 2 % - 2,25 % 1,5 % - 1,75 % 1,75 % - 2,25 % United States Dollar

Dalam Mata Uang Dolar Renminbi - - 1,35 % Renminbi

Pada tanggal 31 Desember 2012 dan 2011 dan 1 Januari 2011, tidak ada kas dan setara kas yang dibatasi penggunaannya dan seluruh setara kas ditempatkan pada pihak ketiga.

As of December 31, 2012 and 2011 and January 1, 2011, there was no restricted cash and cash equivalents and all cash equivalents were placed at third parties.

Page 197: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

38

5. PIUTANG USAHA KEPADA PIHAK KETIGA Rinciannya sebagai berikut :

5. TRADE RECEIVABLES TO THIRD PARTIES

The details are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Kenwood Electronics Technologies (M) Kenwood Electronics Technologies (M)

Sdn. Bhd. 15.208.300 12.069.866 9.652.554 Sdn. Bhd.

Panasonic AVC Network (S) Pte. Ltd. 3.504.853 134.935 4.929.086 Panasonic AVC Network (S) Pte. Ltd.

Japan Servo Motors (S) Pte. Ltd. 3.217.920 2.162.288 3.595.752 Japan Servo Motors (S) Pte. Ltd.

Sony Energy Devices Corporation 2.092.442 2.744.632 869.969 Sony Energy Devices Corporation

TOA E & I (S) Pte. Ltd. 2.076.823 1.454.549 1.971.678 TOA E & I (S) Pte. Ltd.

Allied Telesyn International (Asia) Pte. Ltd. 1.222.718 514.606 1.344.163 Allied Telesyn International (Asia) Pte. Ltd.

Sony Electronics (S) Pte. Ltd. 450.194 1.716.543 2.805.847 Sony Electronics (S) Pte. Ltd.

Minebea Electronics Motor (S) Pte. Ltd. - 560.697 1.869.427 Minebea Electronics Motor (S) Pte. Ltd.

Lain-lain (Saldo masing-masing di bawah Others (Accounts with balances below

USD 500.000) 902.866 911.803 1.263.743 USD 500,000, each)

J u m l a h 28.676.116 22.269.919 28.302.219 T o t a l

Rincian piutang usaha berdasarkan umur piutang sebagai berikut :

The details of trade receivables by age category are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)

2 0 1 2 (Restated) (Restated)

0 - 30 hari 17.139.754 13.259.317 17.083.402 0 - 30 days

31 - 60 hari 9.509.317 7.161.331 7.609.476 31 - 60 days

61 - 90 hari 898.521 1.761.768 3.251.528 61 - 90 days

> 90 dari 1.128.524 87.503 357.813 > 90 days

J u m l a h 28.676.116 22.269.919 28.302.219 T o t a l

Rincian piutang usaha berdasarkan jenis mata uang adalah sebagai berikut :

The details of trade receivables by currency are as follows :

1 Januari

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Dolar Amerika Serikat 28.548.075 21.767.469 27.612.251 United States Dollar

Dolar Singapura 128.041 502.450 689.968 Singapore Dollar

J u m l a h 28.676.116 22.269.919 28.302.219 T o t a l

Page 198: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

39

5. PIUTANG USAHA KEPADA PIHAK KETIGA (Lanjutan) Piutang usaha sebesar Rp 95.000.000.000 atau ekuivalen sebesar USD 9.824.198 (per 31 Desember 2012) digunakan sebagai jaminan sehubungan dengan fasilitas kredit yang diperoleh dari PT Bank Mandiri (Persero) Tbk (Catatan 11). Berdasarkan pengalaman dan penelaahan, manajemen berkeyakinan Perusahaan tidak mengalami kesulitan atas kolektibilitas piutang usaha, sehingga tidak dilakukan cadangan penurunan nilai piutang usaha.

5. TRADE RECEIVABLES TO THIRD PARTIES (Continued)

Trade receivables of Rp 95,000,000,000 or

equivalents to USD 9,824,198 (as of December 31, 2012) are used as collateral for the credit facilities obtained from PT Bank Mandiri (Persero) Tbk (Note 11).

Based on the review of the status of each

individual receivable account at year-end, the management believes that all receivables are collectible. Accordingly, no allowance for doubtful accounts was provided.

6. P E R S E D I A A N Rinciannya sebagai berikut :

6. I N V E N T O R I E S The details are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Barang Jadi 174.448 119.318 187.352 Finished Goods

Barang dalam Proses 5.955.927 7.217.601 8.186.283 Work in Process

Bahan Baku 5.259.821 6.253.274 6.266.143 Raw Materials

Bahan Pembantu 684.586 840.083 941.922 Supporting Materials

Suku Cadang Mesin 367.636 339.198 386.926 Machinery Spare Parts

J u m l a h 12.442.418 14.769.474 15.968.626 T o t a l

Persediaan telah diasuransikan terhadap risiko kebakaran dan risiko lainnya dengan jumlah pertanggungan secara keseluruhan sebesar USD 20.000.000 dan SGD 1.100.000. Manajemen Perusahaan berpendapat bahwa jumlah pertanggungan tersebut memadai untuk menutupi kemungkinan kerugian yang timbul dari risiko yang dipertanggungkan. Persediaan dengan jumlah tercatat sebesar Rp 30.000.000.000 atau ekuivalen sebesar USD 3.102.378 (per 31 Desember 2012) digunakan sebagai jaminan atas fasilitas kredit yang diperoleh dari PT Bank Mandiri (Persero) Tbk (Catatan 11). Berdasarkan hasil penelaahan kondisi persediaan pada akhir tahun, manajemen berkeyakinan bahwa tidak ada cadangan penurunan nilai persediaan yang perlu dibentuk pada tanggal 31 Desember 2012 dan 2011 dan 1 Januari 2011.

Inventories have been insured against losses from fire and other risks with total insurance coverage of USD 20,000,000 and SGD 1,100,000. The management believes that the insurance coverage is adequate to cover possible losses arising from such risks.

Inventories with a carrying value of

Rp 30,000,000,000 or equivalent to USD 3,102,378 (as of December 31, 2112) are used as collateral for the credit facilities obtained from PT Bank Mandiri (Persero) Tbk (Note 11).

Based on the results of inventory review at year-

end, management believes that no allowance of inventories impairment should be made as of December 31, 2012 and 2011 and January 1, 2011.

Page 199: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

40

7. ASET TETAP Rincian per 31 Desember sebagai berikut :

7. FIXED ASSETS The details as of December 31, are as follows :

Saldo Awal/ Penambahan/ Pengurangan/ Reklasifikasi/ Saldo Akhir/

Beginning Balance Additions Deductions Reclassifications Ending Balance

Biaya Perolehan At Cost

Pemilikan Langsung Direct Acquisitions

T a n a h 3.134.713 556.278 - - 3.690.991 L a n d

Bangunan dan Sarana 22.353.508 515.784 31.568 - 22.837.724 Buildings and Infrastructures

Mesin dan Peralatan 61.052.095 558.139 160.486 - 61.449.748 Machinery and Equipment

K e n d a r a a n 2.366.902 330.295 93.121 - 2.604.076 V e h i c l e s

Inventaris Kantor 6.205.424 195.666 494.133 - 5.906.957 Office Equipment

Inventaris Mess 68.865 5.117 - - 73.982 Mess Equipment

J u m l a h 95.181.507 2.161.279 779.308 - 96.563.478 Total Direct Acquisitions

Akumulasi Penyusutan Accumulated Depreciation

Pemilikan Langsung Direct Acquisitions

Bangunan dan Sarana 9.633.441 1.144.957 29.312 - 10.749.086 Buildings and Infrastructures

Mesin dan Peralatan 31.174.354 4.896.409 142.227 - 35.928.536 Machinery and Equipment

K e n d a r a a n 2.178.577 121.065 92.338 - 2.207.304 V e h i c l e s

Inventaris Kantor 5.350.529 233.688 492.729 - 5.091.488 Office Equipment

Inventaris Mess 66.218 1.203 - - 67.421 Mess Equipment

J u m l a h 48.403.119 6.397.322 756.606 - 54.043.835 T o t a l

Jumlah Tercatat 46.778.388 42.519.643 Carrying Value

2 0 1 2

Saldo Awal/ Penambahan/ Pengurangan/ Reklasifikasi/ Saldo Akhir/

Beginning Balance Additions Deductions Reclassifications Ending Balance

Biaya Perolehan At Cost

Pemilikan Langsung Direct Acquisitions

T a n a h 3.134.713 - - - 3.134.713 L a n d

Bangunan dan Sarana 17.425.259 445.691 78.505 4.561.063 22.353.508 Buildings and Infrastructures

Mesin dan Peralatan 61.441.966 5.418.023 5.807.894 - 61.052.095 Machinery and Equipment

K e n d a r a a n 2.344.091 72.081 49.270 - 2.366.902 V e h i c l e s

Inventaris Kantor 6.032.162 173.742 480 - 6.205.424 Office Equipment

Inventaris Mess 68.865 - - - 68.865 Mess Equipment

Jumlah Pemilikan

Langsung 90.447.056 6.109.537 5.936.149 4.561.063 95.181.507 Total Direct Acquisitions

Dalam Penyelesaian Construction in Progress

Bangunan dan Sarana 2.561.688 1.999.375 - (4.561.063) - Buildings and Infrastructure

J u m l a h 93.008.744 8.108.912 5.936.149 - 95.181.507 T o t a l

Akumulasi Penyusutan Accumulated Depreciation

Pemilikan Langsung Direct Acquisitions

Bangunan dan Sarana 8.638.275 1.073.671 78.505 - 9.633.441 Buildings and Infrastructures

Mesin dan Peralatan 32.013.307 4.832.735 5.671.688 - 31.174.354 Machinery and Equipment

K e n d a r a a n 2.116.067 111.778 49.268 - 2.178.577 V e h i c l e s

Inventaris Kantor 5.116.836 234.173 480 - 5.350.529 Office Equipment

Inventaris Mess 65.258 960 - - 66.218 Mess Equipment

J u m l a h 47.949.743 6.253.317 5.799.941 - 48.403.119 T o t a l

Jumlah Tercatat 45.059.001 46.778.388 Carrying Value

2 0 1 1

(Disajikan Kembali)/(Restated)

Page 200: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

41

7. ASET TETAP (Lanjutan) Beban penyusutan untuk tahun yang berakhir pada tanggal-tanggal 31 Desember 2012 dan 2011 dialokasikan sebagai berikut :

7. FIXED ASSETS (Continued)

Depreciation expenses for the years ended December 31, 2012 and 2011 are allocated to :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Beban Pokok Penjualan 5.741.089 5.610.866 Cost of Goods Sold

Beban Umum dan Administrasi 464.090 453.831 General and Administrative Expenses

Beban Pokok Jasa Perakitan 192.143 188.620 Cost of Assembling Services

J u m l a h 6.397.322 6.253.317 T o t a l

Rincian pengurangan aset tetap yang merupakan penjualan aset tetap dengan rincian sebagai berikut :

Deductions of fixed assets from direct acquisitions represent the sale of fixed assets with details as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Harga Jual 34.653 287.473 Selling Price

Jumlah Tercatat (22.702) (136.208) Carrying Value

Laba Penjualan Aset Tetap 11.951 151.265 Gain on Sale of Fixed Assets

Termasuk dalam penambahan tahun 2012, sebesar USD 57.058 merupakan reklasifikasi dari biaya ditangguhkan sesuai penerapan ISAK 25, “Hak atas Tanah”. Pengurangan tahun 2012 dan 2011 atas bangunan dan sarana merupakan pengalihan kepada karyawan. Pada tahun 2011, penghapusan aset tetap dengan biaya perolehan dan akumulasi penyusutan sebesar USD 480. Jumlah tercatat bruto dari aset tetap yang telah disusutkan penuh dan masih digunakan tahun 2012 sebesar USD 16.574.324.

Items included in additions of fixed assets in 2012 amounting to USD 57,058 represent the reclassification from deferred costs in according IFAS 25, “Landrights”.

Deductions in 2012 and 2011 of buildings and

infrastructures represent transfers to employees. In 2011, the disposal of equipment at cost and

the accumulated depreciation amounted to USD 480.

The total gross carrying value of fixed assets

which had been fully depreciated and still being used in 2012 amounted to USD 16,574,324.

Page 201: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

42

7. ASET TETAP (Lanjutan) Bangunan, mesin dan peralatan telah diasuransikan terhadap risiko kebakaran dan risiko lainnya dengan nilai pertanggungan secara keseluruhan sebesar USD 47.620.000, SGD 7.100.000, dan IDR 3.480.000.000. Manajemen berpendapat bahwa nilai pertanggungan tersebut cukup memadai untuk menutupi kemungkinan kerugian yang timbul dari risiko yang dipertanggungkan. Aset tetap dengan jumlah tercatat sebesar USD 9.463.716 per 31 Desember 2012 digunakan sebagai jaminan atas fasilitas kredit yang diperoleh dari PT Bank Mandiri (Persero) Tbk (Catatan 11).

Berdasarkan hasil penelaahan manajemen

Perusahaan, tidak terdapat kejadian dan perubahan keadaan yang mengindikasikan adanya penurunan nilai aset tetap pada tanggal 31 Desember 2012 dan 2011. Manajemen Perusahaan juga berpendapat tidak terdapat perubahan estimasi masa manfaat dan perubahan yang signifikan dalam ekspektasi pola konsumsi manfaat ekonomi masa depan (metode penyusutan) terhadap aset tetap tersebut.

7. FIXED ASSETS (Continued) Buildings, machinery and equipment were

insured with insurance coverage of USD 47,620,000, SGD 7,100,000 and IDR 3,480,000,000. The management believes that the insurance coverage is adequate to cover possible losses arising from such risks.

Fixed assets with a carrying value of

USD 9,463,716 as of December 31, 2012 were used as collateral for the credit facilities obtained from PT Bank Mandiri (Persero) Tbk (Note 11).

Based on management’s evaluation, there are no

events or changes in circumstances that indicate any decline in fixed assets value as of December 31, 2012 and 2011.

The Company’s management also believes that

there were no changes in the estimated useful lives and significant changes in the expected pattern on the future useful life benefit consumption (depreciation method) of the fixed assets.

Page 202: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

43

8. HUTANG USAHA KEPADA PIHAK KETIGA Rinciannya sebagai berikut :

8. TRADE PAYABLES TO THIRD PARTIES The details are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Kenwood Electronic Technologies (M) Kenwood Electronic Technologies (M)

Sdn. Bhd. 12.414.457 10.044.005 7.571.947 Sdn. Bhd.

Sony Electronics (S) Pte. Ltd. 5.771.131 5.289.076 5.718.241 Sony Electronics (S) Pte. Ltd.

Allied Telesyn Internasional (Asia) Pte. Ltd. 3.362.585 1.909.111 2.861.495 Allied Telesyn Internasional (Asia) Pte. Ltd.

Panasonic AVC Network (S) Pte. Ltd. 2.710.674 94.490 4.681.576 Panasonic AVC Network (S) Pte. Ltd.

Japan Servo Motors (S) Pte. Ltd. 2.650.739 1.876.637 3.099.911 Japan Servo Motors (S) Pte. Ltd.

TOA E & I (S) Pte. Ltd. 2.222.583 1.894.137 2.336.373 TOA E & I (S) Pte. Ltd.

Sony Energy Devices Corporation 1.977.930 2.459.970 861.093 Sony Energy Devices Corporation

Minebea Electronics Motor (S) Pte. Ltd. - 666.201 2.520.356 Minebea Electronics Motor (S) Pte. Ltd.

Lain-lain (Saldo masing-masing di bawah Others (Accounts with balances below

USD 1.000.000) 2.754.859 3.203.136 3.973.943 USD 1,000,000, each)

J u m l a h 33.864.958 27.436.763 33.624.935 T o t a l

Rincian hutang usaha berdasarkan umur hutang sebagai berikut :

The details of trade payables by age category as of December 31, are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

0 - 30 hari 17.905.762 14.628.814 18.657.045 0 - 30 days

31 - 60 hari 11.875.563 8.285.669 6.832.756 31 - 60 days

61 - 90 hari 2.589.552 2.422.003 4.914.016 61 - 90 days

> 90 hari 1.494.081 2.100.277 3.221.118 > 90 days

J u m l a h 33.864.958 27.436.763 33.624.935 T o t a l

Rincian hutang usaha berdasarkan jenis mata uang adalah sebagai berikut :

The details of trade payables by currency are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Dolar Amerika Serikat 33.726.218 27.000.900 32.929.176 United States Dollar

Dolar Singapura 100.198 368.161 663.547 Singapore Dollar

R u p i a h 38.542 67.702 32.212 Indonesian Rupiah

J u m l a h 33.864.958 27.436.763 33.624.935 T o t a l

Page 203: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

44

9. HUTANG LAIN-LAIN

Rinciannya sebagai berikut :

9. OTHER PAYABLES The details are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Bagian Lancar C u r r e n t

Sumitomo Mitsui Finance & Leasing Sumitomo Mitsui Finance & Leasing

(Singapore) Pte. Ltd. 202.763 272.536 200.700 (Singapore) Pte. Ltd.

Hitachi Capital Singapore Pte. Ltd. 133.912 248.271 - Hitachi Capital Singapore Pte. Ltd.

PT Sarana Solusindo Informatika 98.110 - 24.835 PT Sarana Solusindo Informatika

Penguin Speed Cargo Pte. Ltd. 63.662 63.903 133.860 Penguin Speed Cargo Pte. Ltd.

Seltech Putera Batam/Seltech Utama 63.183 - - Seltech Putera Batam/Seltech Utama

Hitachi High Technologies 54.980 40.978 270.561 Hitachi High Technologies

Ciptatama Dimensi Prima 54.786 - 9.941 Ciptatama Dimensi Prima

Long Shine Equipment & Supplies Pte. Ltd. 39.352 103.260 162.142 Long Shine Equipment & Supplies Pte. Ltd.

PT Fanindo Chriptonic 38.252 78.322 183.621 PT Fanindo Chriptonic

Fuji Machine MFG (Singapore) Pte. Ltd. 12.874 1.013.171 - Fuji Machine MFG (Singapore) Pte. Ltd.

Trans Technology Pte. Ltd. 6.131 187.881 566.486 Trans Technology Pte. Ltd.

PT Centric Powerindo 3.234 96.298 95.440 PT Centric Powerindo

Lain-lain (Saldo masing-masing di bawah Others (Accounts with balances below

USD 50.000) 575.674 522.067 2.041.452 USD 50,000, each)

J u m l a h 1.346.913 2.626.687 3.689.038 T o t a l

Bagian Tidak Lancar Non Current

Sumitomo Mitsui Finance & Leasing Sumitomo Mitsui Finance & Leasing

(Singapore) Pte. Ltd. - 169.981 370.523 (Singapore) Pte. Ltd.

J U M L A H 1.346.913 2.796.668 4.059.561 T O T A L

Hutang lain-lain terutama terjadi dari hutang pembelian dan pembangunan aset tetap dan seluruhnya kepada pihak ketiga.

10. P E R P A J A K A N

Rinciannya sebagai berikut :

Other payables mainly arose from payables on puchases and constructions of fixed assets, all to third parties.

10. T A X A T I O N The details are as follows :

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Pajak Dibayar di Muka Prepaid Taxes

Pajak Pertambahan Nilai - - 87.358 Value Added Tax

Pajak Penghasilan Pasal 22 - 230 230 Income Tax Article 22

Pajak Penghasilan Pasal 23 - 13.455 13.455 Income Tax Article 23

Pajak Penghasilan Pasal 28 - - 75.375 Income Tax Article 28

J u m l a h - 13.685 176.418 T o t a l

Page 204: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

45

10. P E R P A J A K A N (Lanjutan)

10. T A X A T I O N (Continued)

1 Januari/

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Hutang Pajak Taxes Payable

Pajak Penghasilan Pasal 15 - - 4 Income Tax Article 15

Pajak Penghasilan Pasal 21/26 110.954 106.971 104.414 Income Tax Article 21/26

Pajak Penghasilan Pasal 23 1.123 955 2.332 Income Tax Article 23

Pajak Penghasilan Pasal 25 4.496 - - Income Tax Article 25

Pajak Penghasilan Pasal 29 30.098 - - Income Tax Article 29

Pajak Penghasilan Pasal 4 ayat 2 245 640 27.741 Income Tax Article 4 (2)

J u m l a h 146.916 108.566 134.491 T o t a l

Pajak Penghasilan Badan Rincian penghasilan (beban) pajak penghasilan badan adalah sebagai berikut :

Corporate Income Tax The details of corporate income tax (expense)

are as follows :

Pajak Kini/ Pajak Tangguhan/ J u m l a h/

Current Tax Deferred Tax T o t a l

P e r u s a h a a n - (562.138) (562.138) The Company

Entitas Anak (70.563) 23.543 (47.020) S u b s i d i a r y

J u m l a h (70.563) (538.595) (609.158) T o t a l

2 0 1 2

Pajak Kini/ Pajak Tangguhan/ J u m l a h/

Current Tax Deferred Tax T o t a l

P e r u s a h a a n - 14.962 14.962 The Company

Entitas Anak - 19.550 19.550 S u b s i d i a r y

J u m l a h - 34.512 34.512 T o t a l

(Disajikan Kembali)/(Restated)

2 0 1 1

Page 205: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

46

10. P E R P A J A K A N (Lanjutan) Pajak Kini Rekonsiliasi antara laba (rugi) sebelum pajak penghasilan dengan laba (rugi) fiskal untuk tahun yang berakhir pada tanggal-tanggal 31 Desember 2012 dan 2011 sebagai berikut :

10. T A X A T I O N (Continued) Current Tax The reconciliation between income (loss) before income tax and estimated fiscal loss for the years ended December 31, 2012 and 2011 is as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Laba (Rugi) sebelum Pajak Penghasilan menurut Income (Loss) before Income Tax - Consolidated

Laporan Laba Rugi Komprehensif Konsolidasi 1.589.964 (1.075.559) Statements of Comprehensive Income

Dikurangi : Deductions :

Laba sebelum Pajak Penghasilan - Entitas Anak (203.235) (295.555) Income before Income Tax - Subsidiary

Laba (Rugi) sebelum Pajak Penghasilan -

Perusahaan 1.386.729 (1.371.114) Income (Loss) before Income Tax - The Company

Beda Temporer : Timing Differences :

Penyusutan Aset Tetap Pemilikan Langsung - 6.111.189 5.959.887

Komersial Depreciation of Fixed Assets - Commercial

Penyusutan Aset Tetap Pemilikan Langsung -

Fiskal (5.337.589) (5.973.659) Depreciation of Fixed Assets - Fiscal

Laba Penjualan Aset Tetap - Komersial (11.913) (151.192) Gain on Sale of Fixed Assets - Commercial

Laba Penjualan Aset Tetap - Fiskal 6.346 138.258 Gain on Sale of Fixed Assets - Fiscal

Cadangan Imbalan Kerja 398.556 444.920 Provision for Employee Benefits

Pembayaran Imbalan Kerja (64.415) (2.428) Payment of Employee Benefits

Jumlah Beda Temporer 1.102.174 415.786 Total Timing Differences

Beda Tetap : Permanent Differences :

Penyusutan Aset Tetap yang Tidak Diakui Fiskal 144.685 137.867 Nondeductible Depreciation of Fixed Assets

Sumbangan dan Representasi 122.940 145.831 Entertainment and Donations

Rugi Pengalihan Aset Tetap yang Telah Loss on Transfer of Fixed Assets Subjected

Dikenakan PPh Final - Fiskal 15.869 33.432 to Final Income Tax - Fiscal

A s u r a n s i 12.365 11.343 I n s u r a n c e

P a j a k 4.820 12.121 T a x e s

Interest on Bank Current Accounts and

Jasa Giro dan Bunga Deposito (34.433) (5.154) Time Deposits

Lain-lain 19.333 16.140 O t h e r s

Jumlah Beda Tetap 285.579 351.580 Total Permanent Differences

Laba (Rugi) Fiskal 2.774.482 (603.748) Fiscal Income (Loss)

Penyesuaian Kurs 512.900 49.427 Exchange Rate Adjustments

Laba (Rugi) Fiskal setelah Penyesuaian 3.287.382 (554.321) Income (Loss) after Adjustments

Akumulasi Kerugian Fiskal, Awal Tahun : Accumulated Fiscal Loss, Beginning :

2 0 0 8 (sesuai SKPLB) (1.107.593) (1.107.593) 2 0 0 8 (SKPLB)

2 0 0 9 (sesuai SKPLB) (6.142.921) (6.142.921) 2 0 0 9 (SKPLB)

2 0 1 0 (sesuai SKPLB) (2.189.143) (2.252.486) 2 0 1 0

2 0 1 1 (554.321) - 2 0 1 1

Akumulasi Kerugian Fiskal, Akhir Tahun (6.706.596) (10.057.321) Accumulated Fiscal Loss, Ending

Page 206: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

47

10. P E R P A J A K A N (Lanjutan)

Pajak Kini (Lanjutan)

10. T A X A T I O N (Continued) Current Tax (Continued)

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Beban Pajak Kini Current Tax Expenses

P e r u s a h a a n - - The Company

Entitas Anak 70.563 - S u b s i d i a r y

J u m l a h 70.563 - T o t a l

Pajak Dibayar di Muka Prepaid Taxes

P e r u s a h a a n - - The Company

Entitas Anak (40.465) - S u b s i d i a r y

J u m l a h (40.465) - T o t a l

Pajak Penghasilan Kurang Bayar Income Tax Underpayment

P e r u s a h a a n - - The Company

Entitas Anak (30.098) - S u b s i d i a r y

J u m l a h (30.098) - T o t a l

Sampai dengan tanggal penyelesaian Laporan Keuangan Konsolidasi ini, Perusahaan belum menyampaikan Surat Pemberitahuan Pajak (SPT) Tahunan untuk tahun pajak 2012. Taksiran laba fiskal 2012 tidak mengacu pada Dolar Amerika Serikat diatas, melainkan atas dasar Rupiah. Pada tanggal 7 September 2012, Perusahaan telah menerima surat persetujuan dari Menteri Keuangan Kepala Kantor Wilayah DJP Jakarta mengenai penyelenggaraan pembukuan dengan menggunakan satuan mata uang Dolar Amerika Serikat mulai tahun buku 2013. Oleh karena itu, pada tahun fiskal 2012, Perusahaan menggunakan mata uang Rupiah untuk menghitung dan melaporkan pajak penghasilan badannya. Berdasarkan peraturan Perpajakan Indonesia rugi fiskal dapat diperhitungkan hingga jangka waktu lima tahun. Perusahaan menghitung sendiri jumlah pajak yang terutang dalam Surat Pemberitahuan Pajak. Otoritas Pajak dapat meninjau kewajiban pajak Perusahaan dalam batas waktu 5 tahun sejak tanggal terhutangnya pajak.

Up to the completion date of the Consolidated Financial Statements, the Company has not submitted its Annual Corporate Income Returns (SPT) for the 2012 fiscal year. The estimated taxable income in 2012 refers to Indonesian Rupiah, not based on United States Dollar. On September 7, 2012, the Company received a letter of approval from the Minister of Finance Head of Directorate General of Taxes, Jakarta about the implementation of accounting in United States Dollar starting year 2013. In fiscal year 2012, the Company used Indonesian Rupiah to calculate and report its corporate income tax. Based on Indonesian tax regulations, fiscal loss can be calculated up to five years. The Company calculates the total taxes payable in the Annual Tax Return on a self-assessment basis. The tax authorities may assess the Company’s tax liabilities within five years from the date the taxes payable become due.

Page 207: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

48

10. P E R P A J A K A N (Lanjutan) Pajak Tangguhan

Perhitungan beban pajak tangguhan dan saldo aset (liabilitas) pajak tangguhan adalah sebagai berikut :

10. T A X A T I O N (Continued) Deferred Tax The calculation of provision for deferred income tax and the balance of deferred tax assets (liabilities) is as follows :

Dikreditkan Dikreditkan

(Dibebankan) (Dibebankan)

ke Laporan ke Laporan

Laba Rugi Laba Rugi

Komprehensif Komprehensif

Konsolidasi/ Konsolidasi/

Credit Credit

1 Januari/ (Charged) 31 Desember/ (Charged)

January 1, to Consolidated December 31, to Consolidated

2 0 1 1 Statement of 2 0 1 1 Statement of 31 Desember/

(Disajikan Kembali)/ Comprehensive (Disajikan Kembali)/ Comprehensive December 31,

(Restated) Income (Restated) Income 2 0 1 2

P e r u s a h a a n The Company

Aset Tetap (2.582.945) (6.676) (2.589.621) 192.008 (2.397.613) Fixed Assets

Imbalan Kerja 344.141 110.623 454.764 83.535 538.299 Employee Benefits

Rugi Fiskal 2.603.315 (88.985) 2.514.330 (837.681) 1.676.649 Fiscal Losses

J u m l a h 364.511 14.962 379.473 (562.138) (182.665) T o t a l

Entitas Anak S u b s i d i a r y

Aset Tetap (81.749) 17.058 (64.691) 15.799 (48.892) Fixed Assets

Imbalan Kerja 20.598 2.492 23.090 7.744 30.834 Employee Benefits

J u m l a h (61.151) 19.550 (41.601) 23.543 (18.058) T o t a l

J U M L A H 364.511 34.512 379.473 (538.595) (200.723) T O T A L

(61.151) (41.601)

Rekonsiliasi Pajak Penghasilan Badan Rekonsiliasi antara beban (manfaat) pajak dan hasil perkalian laba (rugi) sebelum pajak penghasilan dengan tarif pajak yang berlaku adalah sebagai berikut :

Reconciliation of Corporate Income Tax The reconciliation between the tax expense (benefit) and the amounts computed by applying the prevailing tax rates to income (loss) before provision for income tax is as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Laba (Rugi) sebelum Pajak Penghasilan menurut Income (Loss) before Income Tax - Consolidated

Laporan Laba Rugi Komprehensif Konsolidasi 1.589.964 (1.075.559) Statement of Comprehensive Income

Laba sebelum Pajak Penghasilan - Entitas Anak (203.235) (295.555) Income before Income Tax - Subsidiary

Laba (Rugi) sebelum Pajak Penghasilan - Perusahaan 1.386.729 (1.371.114) Income (Loss) before Income Tax - The Company

Tarif Pajak yang Berlaku 346.682 (342.779) Prevailing Tax Rates

Pengaruh Pajak atas : Tax Effects on :

Beda Tetap 71.395 87.895 Permanent Differences

Penyesuaian Akumulasi Kerugian Fiskal 144.061 239.922 Accumulated Fiscal Loss Adjustments

Beban (Manfaat) Pajak - Perusahaan 562.138 (14.962) Tax Expense (Benefit) - The Company

Beban (Manfaat) Pajak - Entitas Anak 47.020 (19.550) Tax Expense (Benefit) - Subsidiary

Beban (Manfaat) Pajak 609.158 (34.512) Tax Expense (Benefit)

Page 208: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

49

10. P E R P A J A K A N (Lanjutan) Pemeriksaan Pajak Pada bulan April 2011, Perusahaan menerima Surat Ketetapan Pajak Lebih Bayar (SKPLB) atas pajak penghasilan badan tahun 2009 sejumlah Rp 824.257.039 dan penyesuaian atas rugi fiskal tahun 2009 dari Rp 59.962.295.652 menjadi Rp 57.743.458.520. Perusahaan telah menerima hasil SKPLB tersebut. Pada bulan yang sama, Perusahaan juga menerima Surat Ketetapan Pajak Kurang Bayar (SKPKB) atas pajak penghasilan pasal 21 dan 23 tahun 2009 sejumlah Rp 31.796.654 yang telah dilunasi pada bulan Mei 2011. Pada bulan April 2012, Perusahaan menerima Surat Ketetapan Pajak Lebih Bayar (SKPLB) atas pajak penghasilan badan tahun 2010 sejumlah Rp 125.196.967 dan penyesuaian atas rugi fiskal tahun 2010 dari Rp 20.252.103.606 menjadi Rp 19.682.585.450. Perusahaan telah menerima hasil SKPLB tersebut. Pada bulan yang sama, Perusahaan juga menerima Surat Ketetapan Pajak Kurang Bayar (SKPKB) atas pajak penghasilan pasal 23 dan pasal 4 ayat 2 tahun 2010 sejumlah Rp 22.998.367 dan Perusahaan telah membayarnya dalam tahun yang sama.

11. HUTANG BANK

Pada tahun 2008, Perusahaan memperoleh fasilitas kredit dari PT Bank Mandiri (Persero) Tbk, untuk tambahan modal kerja industri perakitan elektronik. Fasilitas tersebut bersifat berulang (revolving) dengan maksimum kredit secara keseluruhan sebesar Rp 15.000.000.000 dan USD 6.275.000.

10. T A X A T I O N (Continued)

Tax Investigation In April 2011, the Company received Tax

Assessment Letter on Overpayment (SKPLB) of Corporate Income Tax for fiscal year 2009 amounting to Rp 824,257,039 and adjustment to fiscal loss year 2009 from Rp 59,962,295,652 to Rp 57,743,458,520. The Company had received the results. In the same month, the Company also received Tax Assessment Letter on Underpayment (SKPKB) on Income Tax Articles 21 and 23 for year 2009 amounting to Rp 31,796,654 which was settled in May 2011.

In April 2012, the Company received Tax

Assessment Letter on Overpayment (SKPLB) of Corporate Income for fiscal year 2010 amounting to Rp 125,196,967 and adjustment to fiscal loss year 2010 from Rp 20,252,103,606 to Rp 19,682,585,450. The Company had received the results. In the same month, the Company also received Tax Assessment Letter on Underpayment (SKPKB) of income tax articles 23 and 4 (2) year 2010 amounted to Rp 22,998,367 which were settled in the same year.

11. BANK LOANS In 2008, the Company obtained a working credit

facility from PT Bank Mandiri (Persero) Tbk, to be used as additional working capital for the electronic assembly industry. The revolving credit facility has a maximum credit limit of Rp 15,000,000,000 and USD 6,275,000.

Page 209: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

50

11. HUTANG BANK (Lanjutan)

Fasilitas kredit tersebut telah diubah menjadi : - Fasilitas kredit modal kerja dalam mata uang

Rupiah untuk modal kerja industri perakitan elektronik. Fasilitas ini bersifat berulang (revolving) dengan maksimum kredit secara keseluruhan sebesar Rp 15.000.000.000.

- Fasilitas kredit modal kerja valas dalam mata

uang USD untuk modal kerja industri perakitan elektronik. Fasilitas ini bersifat berulang (revolving) dengan maksimum kredit sebesar USD 6.275.000.

- Fasilitas treasury line untuk menghedge

transaksi impor dan ekspor terhadap risiko fluktuasi kurs USD/IDR, USD/SGD dan USD/JPY. Fasilitas ini bersifat uncommitted line dengan maksimum limit USD 3.000.000 untuk limit notional.

Fasilitas kredit tersebut telah diperpanjang

beberapa kali, terakhir akan jatuh tempo pada tanggal 29 Oktober 2013.

Tingkat bunga yang dibebankan per tahun sebagai berikut :

11. BANK LOANS (Continued)

The facility has been changed into :

- Working capital credit facility in Indonesian Rupiah used for additional working capital for the electronic assembly industry. The revolving credit facility has a maximum credit limit of Rp 15,000,000,000.

- Working capital credit facility in USD for the

electronic assembly industry working capital. The revolving credit facility has a maximum credit limit of USD 6,275,000.

- Tresury line facility for hedging import and

export transactions against foreign currency fluctuation risks between USD and IDR rates, USD and SGD rates, and USD and JPY rates. The uncommited line credit facility has a notional maximum credit limit of to USD 3,000,000.

All credit facilities above have been extended several times and will mature on October 29, 2013. The loans bore annual interest rates as follows :

Dalam Mata Uang Rupiah 9,75 % - 11,5 % In Indonesian Rupiah

Dalam Mata Uang Dolar Amerika Serikat 6 % - 7 % In United States Dollar

Page 210: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

51

11. HUTANG BANK (Lanjutan) Jaminan yang diberikan meliputi : a. Jaminan utama berupa :

- Seluruh persediaan yang diikat dengan Akta Jaminan Fidusia sebesar Rp 30.000.000.000.

- Seluruh piutang yang diikat dengan Akta

Jaminan Fidusia sebesar Rp 95.000.000.000.

b. Jaminan tambahan berupa :

- Enam belas bidang tanah yang terletak di Jalan Pelita VI, Kelurahan Kampung Pelita, Kecamatan Lubuk Baja, Kotamadya Batam, Propinsi Kepulauan Riau atas nama Perusahaan berikut seluruh bangunan, mesin dan sarana pelengkapnya yang diikat dengan Hak Tanggungan Peringkat II sebesar Rp 79.610.000.000.

- 9 bidang tanah dan bangunan di Jalan

Pelita VI, Kelurahan Lampung Pelita atas nama Perusahaan yang diikat dengan Hak Tanggungan Peringkat II sebesar Rp 5.631.000.000.

- Mesin-mesin penunjang produksi milik

Perusahaan yang diikat dengan Akta Jaminan Fidusia sebesar Rp 12.848.594.600.

Sehubungan dengan fasilitas tersebut, tanpa persetujuan tertulis dari Bank, Perusahaan dibatasi dalam beberapa hal, antara lain : memindahtangankan barang jaminan, melakukan perubahan pengurus dan pemegang saham mayoritas/pengendali, memperoleh fasilitas kredit atau pinjaman lain dari lembaga keuangan lain, dan mengikat diri sebagai penjamin hutang atau menjaminkan harta kekayaan Perusahaan kepada pihak lain.

11. BANK LOANS (Continued) The loans are collateralized by :

a. Principal guarantees as follows :

- All inventories bound by a Fiduciary

Guarantee Deed amounting to Rp 30,000,000,000.

- All trade receivables bound by a

Fiduciary Guarantee Deed amounting to Rp 95,000,000,000.

b. Additional guarantees as follows :

- Sixteen plots of land located on Pelita IV

Street, Kampung Pelita Village, Lubuk Baja Subdistrict, Municipality, Riau Islands Province under the name of the Company including all the buildings, machinery and infrastructures bound by the Second Rank Security Right amounting to Rp 79,610,000,000;

- 9 plots of land and buildings located on

Pelita IV Street, Lampung Pelita Village under the name of the Company bound by the Second Rank Security Right amounting to Rp 5,631,000,000.

- The Company’s supporting production

machinery bound by a Fiduciary Guarantee Deed amounting to Rp 12,848,594,600.

In relation to such credit facilities, the Company,

without any written consent from the bank, should not, among others, tranfer the ownership of the guarantees, change the Company’s management and majority stockholders/ controllers, obtain any credit from other financial institutions and engage as a guarantor or pledge the Company’s assets as collateral to other parties.

Page 211: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

52

11. HUTANG BANK (Lanjutan)

Per 31 Desember 2012 dan 2011, Perusahaan tidak memiliki saldo hutang kepada PT Bank Mandiri (Persero) Tbk. Beban bunga pinjaman untuk tahun yang berakhir pada tanggal-tanggal 31 Desember 2012 dan 2011 masing-masing sebesar USD 65.397 dan USD 23.996.

11. BANK LOANS (Continued)

As of December 31, 2012 and 2011, the Company had no payables to PT Bank Mandiri (Persero) Tbk.

Interest loan expense for the years ended

December 31, 2012 and 2011 amounted to USD 65,397 and USD 23,996, respectively.

12. LIABILITAS IMBALAN KERJA JANGKA PANJANG Liabilitas imbalan kerja jangka panjang Perusahaan dan Entitas Anak hanya berhubungan dengan liabilitas imbalan pasca kerja. Imbalan ini tidak didanakan. Perusahaan dan Entitas Anak menghitung dan mencatat liabilitas imbalan kerja untuk semua karyawan tetap sesuai dengan Undang-undang No. 13 tahun 2003 tentang “Ketenagakerjaan”. Liabilitas imbalan kerja ditentukan berdasarkan aktuaria independen PT Bestama Aktuaria. Pada tanggal 31 Desember 2012 dan 2011 dan 1 Januari 2011, jumlah karyawan yang berhak masing-masing sebanyak 552, 600 dan 648 karyawan. Asumsi yang digunakan untuk menghitung liabilitas imbalan kerja pada tanggal Laporan Posisi Keuangan (Neraca) Konsolidasi adalah sebagai berikut :

12. LONG-TERM EMPLOYEE BENEFITS LIABILITIES

Long-term employee benefits liabilities of the Company and Subsidiary are connected only with post-employment benefits liabilities. These benefits are not funded. The Company and Subsidiary, calculate and record the estimated liabilities for employee benefits for all permanent employees in accordance with Labor Law No. 13 of 2003. The provision for employment benefits is based on the calculation of an independent actuary, PT Bestama Aktuaria. The total number of employees entitled for such benefits was 552, 600 and 648 employees as of December 31, 2012 and 2011 and January 1, 2011, respectively. The assumptions used in determining the estimated liabilities for employee benefits at Statement of Financial Position (Balance Sheet) dates are as follows :

1 Januari /

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Usia Pensiun Normal 60 tahun/years 60 tahun/years 60 tahun/years Normal Pension Age

Tingkat Kenaikan Gaji per tahun 10% 10% 10% Salary Increment Rate per annum

Tingkat Diskonto per tahun 6,20 % 7,1% - 7,2% 9,50% Discount Rate per annum

Tingkat Mortalita TMI 2011 TMI II 2000 TMI II 2000 Mortality Rate

Tingkat Cacat 10 % x mortalita/mortality 10 % x mortalita/mortality 10 % x mortalita/mortality Disability Rate

Tingkat Pengunduran Diri 0 % - 3 % 0 % - 3 % 0 % - 1 % Resignation Rate

Metode Penilaian Proyeksi Kredit Unit/ Proyeksi Kredit Unit/ Proyeksi Kredit Unit/ Valuation Method

Project Unit Credit Project Unit Credit Project Unit Credit

Page 212: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

53

12. LIABILITAS IMBALAN KERJA JANGKA PANJANG (Lanjutan) Liabilitas imbalan kerja pada tanggal Laporan Posisi Keuangan (Neraca) Konsolidasi sebagai berikut :

12. LONG-TERM EMPLOYEE BENEFITS LIABILITIES (Continued) The details of employee benefits liabilities as of Consolidated Statement of Financial Position (Balance Sheet) are as follows :

1 Januari /

January 1,

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) (Restated)

Nilai Kini Liabilitas Imbalan Kerja 3.340.018 2.610.634 1.713.496 Present Value of Defined Benefits

Kerugian Aktuaria yang Belum Diakui (1.011.237) (639.453) (190.182) Unrealized Actuarial Loss

Biaya Jasa Lalu yang Belum Diakui (52.254) (59.769) (64.362) Unrealized Past Service Cost

Jumlah Liabilitas 2.276.527 1.911.412 1.458.952 Total Liabilities

Mutasi saldo liabilitas imbalan kerja sebagai berikut :

The changes of employee benefits liabilities are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Saldo Awal 1.911.412 1.458.952 Beginning Balance

Cadangan Tahun Berjalan 561.964 444.566 Provision for Employee Benefits

Dampak Perubahan Tanggal Mulai Kerja - 32.253 Effects of Changes in Employment Start Date

Pembayaran Imbalan Kerja (64.458) (2.428) Payment of Employee Benefits

Selisih Kurs atas Imbalan Kerja (132.391) (21.931) Foreign Exchange Difference in Employee Benefits

Saldo Akhir 2.276.527 1.911.412 Ending Balance

Rincian cadangan tahun berjalan sebagai berikut :

The details of current year provision for employee benefits are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Biaya Jasa Kini 360.274 289.281 Current Service Costs

Biaya Bunga 178.907 164.942 Interest Cost

Kerugian (Keuntungan) Bersih Aktuaria yang Diakui 18.880 (13.785) Net Realized Actuarial Loss (Gain)

Biaya Jasa Lalu yang Diakui 3.903 4.128 Past Service Cost

J u m l a h 561.964 444.566 T o t a l

Dampak Penyesuaian - 32.253 Adjustment Effects

J U M L A H 561.964 476.819 T O T A L

Page 213: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

54

12. LIABILITAS IMBALAN KERJA JANGKA PANJANG (Lanjutan) Beban cadangan imbalan kerja disajikan dalam akun Beban Umum dan Administrasi. Manajemen telah menelaah asumsi yang digunakan dan berpendapat bahwa asumsi tersebut telah memadai. Manajemen berkeyakinan bahwa liabilitas imbalan kerja tersebut telah memadai untuk menutupi liabilitas imbalan kerja Perusahaan.

12. LONG-TERM EMPLOYEE BENEFITS LIABILITIES (Continued) Provision for employee benefits is presented in the General and Administrative Expenses. The management has evaluated the assumptions used and believes that such assumptions are sufficient. The management believes that the provision for the estimated employee benefits liabilities is sufficient to cover the Company’s employee benefits liabilities.

13. MODAL SAHAM Berdasarkan laporan dari biro administrasi efek, PT Raya Saham Registra, susunan pemegang saham Perusahaan sebagai berikut :

13. CAPITAL STOCK Based on the report of a securities administration

bureau, PT Raya Saham Registra, the composition of the Company’s stockholders is as follows :

Jumlah Saham/

Number of Jumlah/

Shares Total

Abidin (Direktur Utama) 1.177.500.000 66,47 % 22.626.262 Abidin (President Director)

PT Trimegah Securities Tbk 390.928.000 22,07 6.254.181 PT Trimegah Securities Tbk

Bidin Yusuf (Direktur) 62.560.000 3,53 1.202.122 Bidin Yusuf (Director)

M a s y a r a k a t 140.460.000 7,93 2.247.120 P u b l i c

J u m l a h 1.771.448.000 100,00 % 32.329.685 T o t a l

Pemegang Saham of Ownership

Persentase

Kepemilikan/

Stockholders

2 0 1 2

Subscribed and Fully Paid

Percentage

Modal Ditempatkan dan Disetor/

Jumlah Saham/

Number of Jumlah/

Shares Total

Abidin (Direktur Utama) 1.177.500.000 66,47 % 22.626.262 Abidin (President Director)

Millenium Restructure Fund II 390.928.000 22,07 6.254.181 Millenium Restructure Fund II

Bidin Yusuf (Direktur) 62.560.000 3,53 1.202.122 Bidin Yusuf (Director)

M a s y a r a k a t 140.460.000 7,93 2.247.120 P u b l i c

J u m l a h 1.771.448.000 100,00 % 32.329.685 T o t a l

Stockholders

1 Januari dan 31 Desember 2011/

January 1, and December 31, 2011

Kepemilikan/

Percentage

Pemegang Saham of Ownership

(Disajikan Kembali)/(Restated)

Modal Ditempatkan dan Disetor/

Subscribed and Fully Paid

Persentase

Page 214: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

55

14. TAMBAHAN MODAL DISETOR

Rincian per 31 Desember 2012 dan 2011 (disajikan kembali) dan 1 Januari 2011 (disajikan kembali) sebagai berikut :

14. ADDITIONAL PAID-IN CAPITAL The details as of December 31, 2012 and 2011 (restated) and January 1, 2011 (restated) are as follows :

Agio Saham - Penawaran Umum Perdana 24.370.397 Share Premium - Initial Public Offering

Biaya Emisi Saham - Penawaran Umum Perdana (1.201.713) Share Issuance Costs - Initial Public Offering

Jumlah - Bersih 23.168.684 Total - Net

15. SELISIH NILAI TRANSAKSI

RESTRUKTURISASI ENTITAS SEPENGENDALI Rincian per 31 Desember 2012 dan 2011 (disajikan kembali) dan 1 Januari 2011 (disajikan kembali) sebagai berikut :

15. DIFFERENCES ARISING FROM RESTRUCTURING TRANSACTIONS AMONG ENTITIES UNDER COMMON CONTROL

The details as of December 31, 2012 and 2011

(restated) and January 1, 2011 (restated) are as follows :

Selisih Nilai

Transaksi

Restrukturisasi

Entitas

Sepengendali/

Differences

Arising from

Restructuring

Transactions

Biaya among Entities

Perolehan/ Nilai Buku/ under Common

At Cost Book Value Control

Pembelian Saham SME 2.441.873 1.734.353 (707.520) Purchase of SME's Shares

Pembelian Aset SNB 2.229.536 2.241.650 12.114 Purchase of SNB's Assets

Pembelian Bisnis SNB 2.123.368 - (2.123.368) Purchase of SNB's Business

J u m l a h 6.794.777 3.976.003 (2.818.774) T o t a l

Berdasarkan Akta Perjanjian Jual Beli Saham No. 38 tanggal 18 Desember 2007 dari Notaris Fathiah Helmi, SH, Perusahaan membeli saham PT SM Engineering (SME) milik PT Sat Nusapersada Brothers (SNB) dan Abidin secara keseluruhan sebanyak 2.499 saham dengan biaya perolehan sebesar Rp 23.000.000.000 (setara USD 2.441.873) atau 99,96 % dari seluruh modal ditempatkan dan disetor SME.

Based on Deed of Share Sale and Purchase Agreement No. 38 dated December 18, 2007 of Notary Fahtiah Helmi, SH, the Company purchased 2,499 shares of PT SM Engineering (SME) owned by PT Sat Nusapersada Brothers (SNB) and Abidin at a cost of Rp 23,000,000,000 (equivalent to USD 2,441,873) or 99.96 % of SME’s total subscribed and fully paid capital.

Page 215: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

56

15. SELISIH NILAI TRANSAKSI RESTRUKTURISASI ENTITAS SEPENGENDALI (Lanjutan)

Berdasarkan Akta Perjanjian Jual Beli Aset dan Bisnis dalam SNB No. 44 tanggal 28 Desember 2007 dari Notaris Fathiah Helmi, SH, Perusahaan membeli aset dan bisnis SNB dengan biaya perolehan masing-masing sebesar Rp 21.000.000.000 (setara USD 2.229.536) dan Rp 20.000.000.000 (setara USD 2.123.368). Pembelian saham SME, aset dan bisnis SNB tersebut telah disetujui oleh pemegang saham Perusahaan dalam Akta Berita Acara Rapat Umum Pemegang Saham Luar Biasa Perusahaan No. 37 tanggal 18 Desember 2007 dari Notaris Fathiah Helmi, SH. Abidin merupakan pemegang saham mayoritas Perusahaan dan SME, dan merupakan direktur utama Perusahaan, SME, SNB dan SNE.

16. P E N D A P A T A N

Jumlah ini merupakan penjualan bersih dan penghasilan jasa perakitan alat-alat elektronik untuk tahun yang berakhir pada tanggal-tanggal 31 Desember 2012 dan 2011. Rinciannya sebagai berikut :

15. DIFFERENCES ARISING FROM RESTRUCTURING TRANSACTIONS AMONG ENTITIES UNDER COMMON CONTROL (Continued)

Based on Deed of Sale and Purchase Agreement of Assets and Business of SNB No. 44 dated December 28, 2007 of Public Notary Fathiah Helmi, SH, the Company purchased SNB’s assets and business at a cost of Rp 21,000,000,000 (equivalent to USD 2,229,536) and Rp 20,000,000,000 (equivalent to USD 2,123,368), respectively.

The purchases of SME’s shares, SNB’s assets

and business have been approved by the Company’s stockholders in Deed of Extraordinary General Meeting of Stockholders Deed No. 37 dated December 18, 2007 of Public Notary Fathiah Helmi, SH.

Abidin is the majority stockholder of the

Company and SME, and the President Director of the Company, SME, SNB and SNE.

16. R E V E N U E S This account represents the net sales and

revenues of assembling services for the years ended December 31, 2012 and 2011.

The details are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Penjualan - Bersih 236.876.417 231.946.353 Sales - Net

Jasa Perakitan 2.497.397 2.637.369 Assembling Services

J u m l a h 239.373.814 234.583.722 T o t a l

Seluruh penjualan dan jasa perakitan dilakukan dengan pihak ketiga.

All sales and assembling services made with third parties.

Page 216: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

57

16. P E N D A P A T A N (Lanjutan) Rincian pelanggan dengan nilai pendapatan bersih melebihi 10 % dari jumlah pendapatan bersih sebagai berikut :

16. R E V E N U E S (Lanjutan) The details of customers whose net revenue

value exceeded 10 % of the total revenue are as follows :

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) 2 0 1 2 (Restated)

% %

Kenwood Electronic Tehnologies Kenwood Electronic Tehnologies

(M) Sdn. Bhd. 87.722.338 87.922.495 36,65 37,48 (M) Sdn. Bhd.

Sony Electronics (S) Pte. Ltd 50.681.750 80.118.651 21,17 34,15 Sony Electronics (S) Pte. Ltd

Sony Energy Devices Corporation 30.409.830 20.982.341 12,70 8,94 Sony Energy Devices Corporation

Panasonic AVC Network (S) Pte. Ltd. 30.178.083 2.286.969 12,61 0,98 Panasonic AVC Network (S) Pte. Ltd.

J u m l a h 198.992.001 191.310.456 83,13 81,55 T o t a l

Persentase dari Jumlah

Pendapatan Bersih/

Percentage of Total Net Revenues

Rincian pelanggan dengan nilai pendapatan bersih melebihi 10 % dari jumlah pendapatan bersih per segmen adalah sebagai berikut :

The details of customers whose net revenue value exceeded 10 % of the total revenue per segment are as follows :

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) 2 0 1 2 (Restated)

% %

Pendapatan Industri Industries Revenue

Kenwood Electronic Tehnologies Kenwood Electronic Tehnologies

(M) Sdn. Bhd. 87.722.338 87.922.495 37,03 37,91 (M) Sdn. Bhd.

Sony Electronics (S) Pte. Ltd 50.681.750 80.118.651 21,40 34,54 Sony Electronics (S) Pte. Ltd

Sony Energy Devices Corporation 30.409.830 20.982.341 12,84 9,05 Sony Energy Devices Corporation

Panasonic AVC Network (S) Pte. Ltd. 30.178.083 2.286.969 12,74 0,99 Panasonic AVC Network (S) Pte. Ltd.

J u m l a h 198.992.001 191.310.456 84,01 82,49 T o t a l

Pendapatan Jasa Perakitan Assembling Service Revenue

Singapore Epson Industrial Pte. Ltd. 2.213.463 2.101.652 88,63 79,69 Singapore Epson Industrial Pte. Ltd.

Persentase dari Jumlah

Pendapatan Bersih/

Percentage of Total Net Revenues

Page 217: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

58

17. BEBAN POKOK PENJUALAN

Rinciannya sebagai berikut :

17. COST OF GOODS SOLD The details are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Persediaan Awal, Bahan Baku 6.253.274 6.266.143 Beginning Inventories, Raw Materials

Pembelian Bersih 199.754.163 197.905.390 Net Purchases

Persediaan Akhir, Bahan Baku (5.259.821) (6.253.274) Ending Inventories, Raw Materials

Bahan Baku yang Digunakan 200.747.616 197.918.259 Raw Materials Used

Upah Langsung 8.497.609 7.623.457 Direct Labors

Biaya Produksi Tidak Langsung 19.106.043 20.382.254 Factory Overhead

Jumlah Biaya Produksi 228.351.268 225.923.970 Total Production Costs

Barang dalam Proses, Awal 7.217.601 8.186.283 Work in Progress, Beginning

Barang dalam Proses, Akhir (5.955.927) (7.217.601) Work in Progress, Ending

Jumlah Biaya Pokok Produksi 229.612.942 226.892.652 Cost of Goods Manufactured

Persediaan Barang Jadi, Awal 119.318 187.352 Finished Goods Inventories, Beginning

Persediaan Barang Jadi, Akhir (174.448) (119.318) Finished Goods Inventories, Ending

Beban Pokok Penjualan 229.557.812 226.960.686 Cost of Goods Sold

Seluruh pembelian dilakukan dengan pihak ketiga.

Rincian Biaya Produksi Tidak Langsung sebagai berikut :

All purchases were made with third parties The details of Factory Overhead are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

P e n y u s u t a n 5.741.089 5.610.866 D e p r e c i a t i o n

Gaji dan Tunjangan 4.281.638 3.976.865 Salaries and Allowances

Bahan Pembantu 2.318.422 3.770.092 Indirect Materials

L i s t r i k 2.246.332 2.641.221 E l e c t r i c i t y

P e n g e p a k a n 2.206.800 1.913.702 P a c k a g i n g

Perbaikan dan Pemeliharaan 1.741.526 1.948.138 Repairs and Maintenance

Lain-lain 570.236 521.370 O t h e r s

J u m l a h 19.106.043 20.382.254 T o t a l

Page 218: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

59

17. BEBAN POKOK PENJUALAN (Lanjutan) Rincian pemasok dengan nilai pembelian bersih melebihi 10 % dari jumlah pembelian bersih sebagai berikut :

17. COST OF GOODS SOLD (Continued) The details of suppliers whose net purchase value exceeded 10 % of the total net purchases are as follows :

2 0 1 1 2 0 1 1

(Disajikan Kembali)/ (Disajikan Kembali)/

2 0 1 2 (Restated) 2 0 1 2 (Restated)

% %

Kenwood Electronic Tehnologies Kenwood Electronic Tehnologies

(M) Sdn. Bhd. 74.754.632 76.224.569 37,42 38,52 (M) Sdn. Bhd.

Sony Electronics (S) Pte. Ltd 38.438.147 63.820.347 19,25 32,25 Sony Electronics (S) Pte. Ltd

Sony Energy Devices Corporation 27.086.114 18.983.589 13,56 9,59 Sony Energy Devices Corporation

Panasonic AVC Network (S) Pte. Ltd. 23.275.731 2.161.144 11,65 1,09 Panasonic AVC Network (S) Pte. Ltd.

J u m l a h 163.554.624 161.189.649 81,88 81,45 T o t a l

Persentase dari Jumlah

Pembelian Bersih/

Percentage of Total Net Revenues

18. BEBAN POKOK JASA PERAKITAN Rinciannya sebagai berikut :

18. COST OF ASSEMBLING SERVICES The details are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Bahan Pembantu 765.131 784.318 Indirect Materials

Upah Langsung 230.769 252.882 Direct Labors

P e n y u s u t a n 192.143 188.620 D e p r e c i a t i o n

Perbaikan dan Pemeliharaan 187.435 208.941 Repairs and Maintenance

Gaji dan Tunjangan 162.700 173.714 Salaries and Allowances

L i s t r i k 90.183 98.767 E l e c t r i c i t y

P e n g e p a k a n 27.577 36.164 P a c k a g i n g

Lain-lain 48.693 53.630 O t h e r s

J u m l a h 1.704.631 1.797.036 T o t a l

Page 219: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

60

19. BEBAN USAHA

Rinciannya sebagai berikut :

19. OPERATING EXPENSES The details are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Beban Penjualan Selling Expenses

Jasa Pemasaran 330.307 379.731 Marketing Fees

Gaji dan Tunjangan 127.334 133.224 Salaries and Allowances

P e n g a n g k u t a n 86.253 96.534 T r a n s p o r t a t i o n

Lain-lain 14.508 9.028 O t h e r s

J u m l a h 558.402 618.517 T o t a l

General and Administrative

Beban Umum dan Administrasi Expenses

Gaji dan Tunjangan 4.357.823 4.343.806 Salaries and Allowances

Cadangan Imbalan Kerja 561.964 476.819 Provision for Employee Benefits

P e n y u s u t a n 464.090 453.831 D e p r e c i a t i o n

Inventaris Kantor 195.622 200.799 Office Equipment

Representasi dan Sumbangan 161.087 145.831 Representation and Donations

Perbaikan dan Pemeliharaan 156.099 155.419 Repairs and Maintenance

Listrik, Air dan Telepon 141.867 128.415 Electricity, Water and Telephone

Jasa Profesional 128.573 95.093 Professional Fees

A s t e k 101.124 105.477 Employee Insurance

Amortization of Building Use Rights

Amortisasi HGB 85.921 193.523 (HGB)

Bahan Bakar 80.345 82.604 F u e l

P e r i j i n a n 73.547 87.897 L i c e n c e s

Lain-lain (Saldo masing-masing Others (Accounts with balances

dibawah USD 80.000) 301.029 306.157 below USD 80,000, each)

J u m l a h 6.809.091 6.775.671 T o t a l

J U M L A H 7.367.493 7.394.188 T O T A L

Page 220: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

61

20. ASET DAN LIABILITAS MONETER DALAM MATA UANG ASING

Rincian aset dan liabilitas moneter Perusahaan

dalam mata uang asing sebagai berikut :

20. MONETARY ASSETS AND LIABILITIES DENOMINATED IN FOREIGN CURRENCIES

The details of monetary assets and liabilities

denominated in foreign currencies are as follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

A s e t A s s e t s

Kas dan Bank IDR 1.212.490.198 1.041.287.550 Cash on Hand and in Banks

SGD 110.741 198.128

MYR 1.580 1.567

JPY - 17.770

Piutang Usaha SGD 156.589 653.283 Trade Receivables

Piutang Lain-lain IDR 387.937.957 129.409.464 Other Receivables

SGD 11.727 3.711

Pajak Dibayar di Muka IDR - 125.196.967 Prepaid Tax

J a m i n a n IDR 497.558.000 497.558.000 G u a r a n t e e s

L i a b i l i t a s L i a b i l i t i e s

Hutang Usaha IDR (372.697.324) (613.923.958) Trade Payables

SGD (122.538) (478.682)

Hutang Lain-lain IDR (833.165.901) (786.326.559) Other Payables

SGD (376.772) (216.298)

JPY (29.076.117) (141.118.079)

Hutang Pajak IDR (1.420.685.205) (984.475.113) Taxes Payable

Beban Masih Harus Dibayar IDR (3.637.195.222) (3.119.159.670) Accrued Expenses

SGD (4.860) -

JPY (170.725) -

Liabilitas Imbalan Kerja IDR (22.014.011.264) (17.332.683.205) Employee Benefits Liabilities

Jumlah Aset (Liabilitas) - Bersih IDR (26.179.768.761) (21.043.116.524) Total Assets (Liabilities) - Net

SGD (225.113) 160.142

MYR 1.580 1.567

JPY (29.246.842) (141.100.309)

Equivalent to United States Dollar

Setara dengan Dolar Amerika Serikat using Exchange Rates at

berdasarkan kurs pada tanggal Consolidated Statement of

Laporan Posisi Keuangan (Neraca) Financial Position (Balance Sheet)

Konsolidasi USD 3.229.529 (4.014.366) Dates

Page 221: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

62

21. INFORMASI SEGMEN Segmen Usaha Informasi segmen usaha sebagai berikut :

21. SEGMENT INFORMATION Business Segment The business segment information is as follows :

Industri Perakitan Jasa Perakitan

Electronic Assembling Electronic Assembling Eliminasi/ J u m l a h/

Industry Services Elimination T o t a l

P e n d a p a t a n : R e v e n u e s :

Pendapatan Eksternal 236.876.417 2.497.397 - 239.373.814 External Revenues

Pendapatan Antar Segmen - - - - Inter-Segment Revenues

Jumlah Pendapatan 236.876.417 2.497.397 - 239.373.814 Total Revenues

Beban Pokok Penjualan (229.557.812) (1.704.631) - (231.262.443) Cost of Goods Sold

Laba Kotor 7.318.605 792.766 - 8.111.371 Gross Profit

Aset Segmen 28.384.526 291.590 - 28.676.116 Segment Assets

Aset Tidak Dapat Dialokasikan 63.559.499 Unallocated Assets

Jumlah Aset Konsolidasi 92.235.615 Total Consolidated Assets

Liabilitas Tidak Dapat Dialokasikan - - - 38.558.878 Unallocated Liabilities

2 0 1 2

Industri Perakitan Jasa Perakitan

Electronic Assembling Electronic Assembling Eliminasi/ J u m l a h/

Industry Services Elimination T o t a l

P e n d a p a t a n : R e v e n u e s :

Pendapatan Eksternal 231.946.353 2.637.369 - 234.583.722 External Revenues

Pendapatan Antar Segmen - - - - Inter-Segment Revenues

Jumlah Pendapatan 231.946.353 2.637.369 - 234.583.722 Total Revenues

Beban Pokok Penjualan (226.960.686) (1.797.036) - (228.757.722) Cost of Goods Sold

Laba Kotor 4.985.667 840.333 - 5.826.000 Gross Profit

Aset Segmen 21.885.933 383.986 - 22.269.919 Segment Assets

Aset Tidak Dapat Dialokasikan 63.064.996 Unallocated Assets

Jumlah Aset Konsolidasi 85.334.915 Total Consolidated Assets

Liabilitas Tidak Dapat Dialokasikan - - - 32.638.984 Unallocated Liabilities

2 0 1 1

(Disajikan Kembali)/(Restated)

Page 222: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

63

21. INFORMASI SEGMEN (Lanjutan) Segmen Geografis Informasi segmen geografis sebagai berikut :

21. SEGMENT INFORMATION (Continued) Geographical Segment The geographical segment information is as

follows :

2 0 1 1

(Disajikan Kembali)/

2 0 1 2 (Restated)

Luar Negeri O v e r s e a s

S i n g a p u r a 116.495.598 111.743.792 S i n g a p o r e

M a l a y s i a 87.856.746 88.273.052 M a l a y s i a

J e p a n g 32.556.800 32.096.323 J a p a n

E r o p a 11.420 3.800 E u r o p e

V i e t n a m 13.393 - V i e t n a m

Dalam Negeri 2.439.857 2.466.755 D o m e s t i c

J u m l a h 239.373.814 234.583.722 T o t a l

22. MANAJEMEN RISIKO KEUANGAN

Risiko keuangan utama yang dihadapi Perusahaan adalah risiko kredit, risiko nilai tukar mata uang asing, risiko suku bunga, risiko likuiditas dan risiko harga. Kebijakan keuangan dijalankan secara berhati-hati dengan mengelola risiko-risiko tersebut agar tidak menimbulkan potensi kerugian bagi Perusahaan dan Entitas Anak. Risiko Kredit Risiko kredit adalah risiko bahwa perusahaan akan mengalami kerugian yang timbul dari pelanggan, klien atau pihak lawan yang gagal memenuhi liabilitas kontraktual mereka. Tidak ada risiko kredit yang terpusat secara signifikan. Perusahaan melakukan kesepakatan mengenai jangka waktu pembayaran pada saat pengadaan kontrak kerja dengan para pelanggannya dan memonitor sistem pembayaran dari pelanggan dan telah menerapkan denda kepada pelanggan yang telah melewati masa tenggang pembayaran yang telah ditentukan serta penundaan pengiriman barang kepada pelanggan untuk mengurangi risiko kredit.

22. FINANCIAL RISK MANAGEMENT The financial risks that may faced by the

Company are credit risk, foreign exchange rate risk, interest rate risk, liquidity risk and price risk. Financial policies implemented carefully with manage those risks so not cause potential loss to the Company and Subsidiary.

Credit Risk Credit risk is the risk that the Company will incur

a loss arising from its customers, clients or counter parties that fail to discharge their contractual obligations. There are no significant concentrations of credit risk. The Company make an agreement on payment terms at the time of procurement contracts with its customers and monitor the customers’ payment system and have applied penalties for customers having exceeded the agreed-upon payment term that have been determined and delays in delivery of goods to customers for reducing credit risk.

Page 223: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

64

22. MANAJEMEN RISIKO KEUANGAN (Lanjutan)

Risiko Kredit (Lanjutan) Perusahaan dan Entitas Anak juga menghadapi risiko kredit yang berasal dari penempatan dana di bank. Untuk mengatasi risiko ini, Perusahaan dan Entitas Anak memiliki kebijakan untuk menempatkan dananya hanya di bank-bank dengan reputasi baik. Eksposur maksimum atas risiko kredit tercermin dari nilai tercatat setiap aset keuangan pada tanggal 31 Desember 2012 adalah sebagai berikut :

22. FINANCIAL RISK MANAGEMENT (Continued) Credit Risk (Continued)

The Company and Subsidiary also face credit risk arising from the placement of funds in banks. The Company and Subsidiary have a policy to put their funds only in banks with a good reputation. The maximum exposure to credit risk is reflected in the carrying amount of each financial asset as of December 31, 2012 as follows :

Kas dan Setara Kas 8.072.410 Cash and Cash Equivalents

Piutang Usaha kepada Pihak Ketiga 28.676.116 Trade Receivables to Third Parties

Piutang Lain-lain 49.707 Other Receivables

Uang Jaminan 55.842 Guarantee Deposits

J u m l a h 36.854.075 T o t a l

Risiko Nilai Tukar Mata Uang Asing Risiko nilai tukar mata uang asing adalah risiko dimana nilai wajar atau arus kas masa mendatang dari suatu instrumen keuangan akan berfluktuasi akibat perubahan nilai tukar mata uang asing. Untuk pembayaran dalam mata uang uang asing, Perusahaan mempunyai fasilitas treasury line dimana Perusahaan dapat melakukan penukaran dari satu jenis mata uang ke mata uang lainnya sehingga tidak ada risiko nilai tukar mata uang asing yang terpusat secara signifikan. Pada tanggal 31 Desember 2012 dan 2011, aset dan liabilitas moneter bersih Perusahaan dan Entitas Anak terutama diatribusikan dari Rupiah (Catatan 20). Pada tanggal 31 Desember 2012, apabila Rupiah menguat/melemah 10% terhadap US Dolar dengan asumsi variable lainnya tidak mengalami perubahan, maka laba sebelum pajak penghasilan akan turun/naik sekitar sebesar USD 273.467 diakibatkan kerugian/keuntungan selisih kurs yang dicatat di laba rugi.

Foreign Exchange Rate Risk Foreign exchange rate risk is the risk that the fair value of future cash flows of a financial instrument will fluctuate because of changes in foreign exchange rate. For foreign currency payments, the Company has treasury line facilities in which the Company can do the exchange from one type of currency to another currency so there is no risk of foreign currency exchange rates significantly concentrated. As of December 31, 2012 and 2011, the net monetary assets and liabilities of the Company and Subsidiary were primarily attributable to Indonesian Rupiah (Note 20). As of December 31, 2012, if the Rupiah strengthened/weakened by 10% against USD with all other variables held constant, the profit before tax would decrease/increase by USD 273,467 arising from foreign exchange gains/losses taken to profit or loss.

Page 224: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

65

22. MANAJEMEN RISIKO KEUANGAN (Lanjutan)

Risiko Tingkat Suku Bunga Risiko tingkat suku bunga adalah risiko dimana nilai wajar atau arus kas masa datang dari suatu instrumen keuangan akan berfluktuasi akibat perubahan suku bunga pasar. Perusahaan terpengaruh risiko perubahan suku bunga pasar secara langsung yaitu saldo-saldo yang tersimpan di bank, simpanan dalam deposito berjangka 1 bulan dan sehubungan dengan perolehan kredit modal kerja dengan tingkat suku bunga yang dapat berubah sesuai dengan ketentuan yang berlaku. Dengan adanya risiko suku bunga tersebut, maka Perusahaan tetap menjaga hubungan kerja yang baik dengan bank lainnya untuk mempermudah akses pemberian kredit jika Perusahaan membutuhkannya. Pada tanggal 31 Desember 2012, tidak terdapat liabilitas yang dikenakan bunga, sehingga Perusahaan dan Entitas Anak tidak terekspos risiko tingkat suku bunga pada tanggal akhir periode pelaporan tersebut. Risiko Likuiditas Manajemen risiko likuiditas yang hati-hati berarti mempertahankan kas dan setara kas memadai untuk mendukung kegiatan bisnis Perusahan dan Entitas Anak secara tepat waktu. Dalam mengantisipasi risiko pengelolaan dana, Perusahaan dan Entitas Anak telah melakukan prediksi dana untuk jangka pendek dan menengah dalam mendukung kebutuhan operasionalnya dan memastikan tersedianya pendanaan berdasarkan kecukupan fasilitas kredit yang mengikat. Seluruh liabilitas keuangan Perusahaan dan Entitas Anak per 31 Desember 2012 adalah liabilitas jangka pendek yang jatuh tempo dalam satu tahun, dengan rincian sebagai berikut :

22. FINANCIAL RISK MANAGEMENT (Continued) Interest Rate Risk Interest rate risk is the risk where the fair value of

future cash flows of a financial instrument will fluctuate due to changes in interest rates. The Company is affected by the market interest rate risk directly related to the bank account balances, one-month time deposits and working capital credit with interest rates subject to change in accordance with the prevailing conditions. Due to the interest rate risk, the Company maintains a good relationship with other banks to facilitate access to credits if needed.

As of December 31, 2012, there were no

liabilities so the Company and Subsidiary were not exposed to interest rate risk at the reporting period-end date.

Liquidity Risk Prudent liquidity risk management requires the

Company and Subsidiary to maintain sufficient cash and cash equivalents to support the Company and Subsidiary’s business activities in a timely manner. To anticipate fund management risk, the Company and Subsidiary have estimated short and medium-term funds to support their operational needs and and ensure the fund availability based on the sufficiency of binding credit facilities.

The Company and Subsidiary’s entire financial

liabilities as of December 31, 2012 is a short-term liabilities due for the year, with the following details :

Hutang Usaha kepada Pihak Ketiga 33.864.958 Trade Payables to Third Parties

Hutang Lain-lain 1.346.913 Other Payables

Beban Masih Harus Dibayar 722.841 Accrued Expenses

J u m l a h 35.934.712 T o t a l

Page 225: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

66

22. MANAJEMEN RISIKO KEUANGAN (Lanjutan) Pengelolaan Modal Tujuan Perusahaan dan Entitas Anak ketika mengelola modal adalah untuk mempertahankan kelangsungan usaha Perusahaan dan Entitas Anak serta memaksimalkan manfaat bagi pemegang saham dan pemangku kepentingan lainnya. Perusahaan dan Entitas Anak secara aktif dan rutin menelaah dan mengelola struktur permodalan untuk memastikan struktur modal dan hasil pengembalian ke pemegang saham yang optimal, dengan mempertimbangkan kebutuhan modal masa depan dan efisiensi modal Perusahaan dan Entitas Anak, profitabilitas saat ini dan yang akan datang, proyeksi arus kas operasi, proyeksi belanja modal dan proyeksi peluang investasi yang strategis. Dalam rangka mempertahankan atau menyesuaikan struktur modal, Perusahaan dan Entitas Anak dapat menyesuaikan jumlah dividen yang dibayarkan kepada para pemegang saham, mengeluarkan saham baru atau menjual aset untuk mengurangi hutang. Perusahaan dan Entitas Anak memonitor berdasarkan rasio gearing konsolidasi. Rasio gearing dihitung dengan membagi hutang bersih dengan total ekuitas. Hutang bersih dihitung dengan mengurangkan jumlah pinjaman dengan kas dan setara kas. Pada tanggal 31 Desember 2012 dan 2011 tidak terdapat saldo pinjaman.

22. FINANCIAL RISK MANAGEMENT (Continued)

Capital Management The Company and Subsidiary’s objectives when managing capital are to safeguard the Company and Subsidiary’s ability to continue as a going concern whilst seeking to maximize benefits to shareholders and other stakeholders. The Company and Subsidiary actively and regularly review and manage their capital structure and stockholder return, taking into consideration the future capital requirements and capital efficiency of the Company and Subsidiary, prevailing and projected profitability, projected operating cash flows, projected capital expenditure and projected strategic investment opportunities. In order to maintain or adjust the capital structure, the Company and Subsidiary may adjust the amount of dividends paid to stockholders, issue new shares or sell assets to reduce debt. The Company and Subsidiary monitor capital on the basis of the Company and Subsidiary’s consolidated gearing ratio. The gearing ratio is calculated as net debt divided by total equity. Net debt is calculated as total borrowings less cash and cash equivalents. As of December 31, 2012 and 2011 there was no outstanding loan.

Page 226: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

67

22. MANAJEMEN RISIKO KEUANGAN (Lanjutan)

Aset dan Liabilitas Keuangan Tabel berikut menyajikan nilai tercatat dan estimasi nilai wajar dari instrumen keuangan Perusahaan pada tanggal 31 Desember 2012 dan 2011 :

22. FINANCIAL RISK MANAGEMENT (Continued) Financial Assets and Liabilities The following table presents the carrying amounts and the estimated fair values of the Company’s financial instruments as of December 31, 2012 and 2011 :

Nilai Wajar/ Nilai Tercatat/ Nilai Wajar/ Nilai Tercatat/

Fair Values Carrying Amounts Fair Values Carrying Amounts

Aset Keuangan - Pinjaman Financial Assets - Loans and

yang Diberikan dan Piutang Receivables

Kas dan Setara Kas 8.072.410 8.072.410 731.401 731.401 Cash and Cash Equivalents

Piutang Usaha 28.676.116 28.676.116 22.269.919 22.269.919 Trade Receivables

Piutang Lain-lain 49.707 49.707 17.125 17.125 Other Receivables

Uang Jaminan 55.842 55.842 58.254 58.254 Guarantee Deposits

Jumlah Aset Keuangan 36.854.075 36.854.075 23.076.699 23.076.699 Total Financial Assets

Liabilitas Keuangan - Liabilitas Financial Liabilities - Financial

Keuangan pada Biaya Perolehan Liabilities Measured at Amortized

Diamortisasi Cost

Hutang Usaha 33.864.958 33.864.958 27.436.763 27.436.763 Trade Payables

Hutang Lain-lain 1.346.913 1.346.913 2.626.687 2.626.687 Other Payables

Beban Masih Harus Dibayar 722.841 722.841 343.974 343.974 Accrued Expenses

Jumlah Liabilitas Keuangan 35.934.712 35.934.712 30.407.424 30.407.424 Total Financial Liabilities

2 0 1 2 (Disajikan Kembali)/(Restated)

2 0 1 1

Nilai wajar adalah suatu jumlah dimana aset dapat diukur, atau liabilitas dapat diselesaikan dengan dasar transaksi yang wajar (arm’s-length transactions). Nilai wajar aset keuangan dan liabilitas keuangan ditentukan dengan menggunakan teknik penilaian dan asumsi sebagai berikut :

- Nilai wajar kas dan setara kas, piutang usaha,

piutang lain-lain, hutang usaha, hutang lain-lain, dan beban masih harus dibayar mendekati nilai tercatatnya karena jangka waktu jatuh tempo yang singkat atas instrumen keuangan tersebut.

- Nilai wajar uang jaminan tidak disajikan

karena nilai wajarnya tidak dapat diukur secara andal dimana aset keuangan tersebut tidak memiliki jangka waktu pengembalian secara kontraktual.

Fair value is an amount where assets can be measured, or liabilities can be settled using arm’s-length transactions. The fair values of financial assets and liabilities are determined by using valuation methods and assumptions as follows : - The fair values of cash and cash equivalents,

trade receivables, other receivables, trade payables, other payables, and accrued expenses were reasonable approximation of their carrying values, due to their short-term nature.

- The fair value of guarantee deposits is not

presented since the fair value cannot be measured reliably in which the financial assets do not have a contractual maturity schedule.

Page 227: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

68

23. PERIKATAN DAN KOMITMEN

a. Pada tanggal 1 Januari 2009, Perusahaan mengadakan Perjanjian Pemasaran (Marketing Agreement) dengan Forward Semiconductor (S) Pte. Ltd (Forward), dimana Forward menyediakan jasa dalam pemasaran bisnis Perusahaan dan memperoleh transaksi bisnis baru khususnya sektor elektronik di pasar luar negeri. Jasa pemasaran tersebut adalah sebesar 1 % dari total penjualan yang diperoleh dari jasa Forward dengan persetujuan Perusahaan terlebih dahulu. Perjanjian ini berlaku efektif sejak ditandatangani dan berakhir dalam 2 bulan berdasarkan persetujuan kedua pihak.

b. Perusahaan memperoleh fasilitas kredit dari

PT Bank Mandiri (Persero) Tbk (Catatan 11). Pada tanggal 31 Desember 2012, seluruh fasilitas kredit tersebut tidak digunakan oleh Perusahaan, tetapi tersedia jika Perusahaan membutuhkannya.

23. ENGAGEMENT AND COMMITMENT

a. On January 1, 2009, the Company entered into a marketing agreement with Forward Semiconductor (S) Pte. Ltd (Forward), whereby Forward agreed to provide services for marketing the Company’s business and obtaining new business transactions especially for the electronic section in overseas markets. The marketing fee shall be at 1% of the total Forward’s sales initially approved by the Company. The agreement shall be effective since the signing and ends in two months based on both parties’ agreement.

b. The Company obtained credit facilities from

PT Bank Mandiri (Persero) Tbk (Note 11). As of December 31, 2012, all the credit facilities were not used by the Company, however, they are available if the Company needs them.

24. RENCANA MANAJEMEN Pada tahun 2013, dalam meningkatan pendapatan dan laba Perusahaan, manajemen mengambil langkah-langkah sebagai berikut : 1. Pematangan rencana produksi agar dapat

mengidentifikasi masalah teknis dan mengkaji ulang syarat dan ketentuan kontrak terhadap barang-barang reject.

2. Menerapkan strategi pemasaran yang lebih fleksible guna memperluas jaringan pemasaran dan mempertahankan daya saing dan hubungan jangka panjang dengan pelanggan.

3. Melakukan efisiensi dalam proses produksi dan terhadap biaya-biaya yang tidak memberikan kontribusi terhadap Perusahaan.

4. Diverifikasi produk dan peningkatan produktifitas.

24. MANAGEMENT’S PLANS In 2013, to increase the Company’s revenue and

income, the management has taken the following measures :

1. Develop a complete production plan to be

able to identify technical problems and to reevaluate toward contract terms and conditions on reject products.

2. Implement a more flexible marketing strategy to expand the marketing network and to maintain the Company’s competitiveness and long-term customer relationship.

3. Conduct efficiency in the production process and indirect costs.

4. Diversify products and increase

productivity.

Page 228: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

69

24. RENCANA MANAJEMEN (Lanjutan)

5. Berupaya keras untuk menjajaki segmen bisnis lainnya yang bersinergi dengan core business Perusahaan dan melakukan ekspansi fasilitas produksi dalam mendukung bisnis integrasi atau pelayanan satu atap yang lebih komplit mencakupi Surface Mount Technology, Plastic Molding, Metal Stamping dan Final Assembly.

6. Penerapan target profitabilitas serta penggencaran program kerja yang lebih komprehensif pada setiap departemen baik produksi maupun administrasi umum.

7. Perbaikan infrastruktur teknologi informasi dalam menunjang penyempurnaan sistem kerja yang lebih terkendali dan terukur sehingga dapat meningkatkan marjin Perusahaan.

8. Penggencaran upaya untuk menjajaki bisnis full turn key (pembelian material secara langsung) yang akan memberikan kontribusi pada marjin Perusahaan.

9. Membentuk tim khusus dalam memonitor pergerakan harga bahan baku, bahan penolong dan bahan pengepakan lainnya untuk meminimalisir pengaruh dari volatilitas harga pasar yang berpotensi menekan profitabilitas Perusahaan.

10. Melakukan pelatihan dan peningkatan pengetahuan serta kapabilitas pekerja untuk mendukung regenerasi pemimpinan yang baik di produksi maupun di administrasi umum agar kelangsungan sistem manajemen Perusahaan dapat dipertahankan secara terus menerus.

11. Bekerja sama dengan berbagai pihak di luar Pulau Batam khususnya di pulau Jawa dalam hal perluasan penjajakan pekerja yang lebih kompeten agar rekruitmen pada pekerja yang berkualitas dapat ditingkatkan.

12. Pendekatan dengan pelanggan untuk meninjau ulang harga jual seiring dengan peningkatan upah minimum kerja yang telah mengalami kenaikan 53,58% sejak Januari 2013.

24. MANAGEMENT’S PLANS (Continued) 5. Try hard to explore other business

segments synergistic with the Company’s core business and expand production facilities in support business integration or one stop complete service covering surface mount technology, plastic molding, metal stamping and final assembly.

6. Implement a profitability target and conduct

a more comprehensive work program in both production and general administration departments.

7. Improve the information tercnology infrastructure in establishing a more controllable and measurable working system to increase the Company’s margin.

8. Try hard to explore the full turn key

business (direct materials purchases) which will contribute to the Company’s margin.

9. Form a special team to monitor the price movements of raw materials, indirect materials and other packaging materials to minimize the impact of market price volatility potentially reducing the Company’s profit.

10. Conduct training and improve employee’s knowledge and capabilities to support a good regeneration of leadership in the production and general administration to establish the Company’s sustainable management system.

11. Cooperate with various parties outside the

Batam Island especially on the Java Island in expanding the assessment of more competent employees to increase its qualified recruitment.

12. Approach the customers to review selling prices due to the 53.58 % increase in the minimum wage since January 2013.

Page 229: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

70

24. RENCANA MANAJEMEN (Lanjutan)

13. Memperluas basis vendor agar tidak terpusat pada Negara Asia Tenggara saja dengan menjajaki berbagai vendor di China yang sangat terkenal dengan bahan baku dan bahan pembantu yang murah dalam menunjang industry elektroniknya. Langkah tersebut diharapkan dapat memperbesar kontribusi marjin Perusahaan khususnya untuk bahan baku serta bahan pembantu lainnya.

14. Terus berinovasi dalam pembuatan semi automation dan penyempurnaan proses integrasi vertical dengan memperbaharui fasilitas produksi, meningkatkan control pada kualitas produk, ketepatan waktu pengiriman barang serta penekanan biaya produksi sehingga dapat memberikan nilai tambah kepada pelanggan serta mempertahankan hubungan kerjasama yang baik dengan pelanggan.

15. Mengajukan pengurangan harga atau diskon dari vendor dengan memperpendek jangka waktu pembayaran dengan selalu mempertimbangkan efek ekonomis terhadap keuntungan Perusahaan.

16. Memperluas potensi marjin Perusahaan dengan melakukan ekspansi kapabilitas engineering melalui pelayanan kebutuhan internal seperti men-fabrikasi jig dan tools yang digunakan dalam proses produksi serta menjajaki pangsa pasar diluar Perusahaan.

17. Mengkaji kemungkinan penggunaan jenis bahan penolong yang lebih efisien dan murah dengan tetap memperhatikan kualitas produk yang dihasilkan serta mendapatkan persetujuan pelanggan sebelum perubahan tersebut dilakukan.

18. Menjajaki kerjasama dengan perusahaan design sebagai terobosan dalam pemberian pelayanan terintegrasi ke pelanggan. Penambahan pelayanan design produk kepada pelanggan tersebut akan lebih meningkatkan ketergantungan pelanggan pada Perusahaan sehingga keberlangsungan bisnis dapat lebih terjamin.

24. MANAGEMENT’S PLANS (Continued) 13. Expand its vendor basis not to focus on the

Southeast Asean Countries only by engaging various vendors in China that is well-known for its cheap raw materials and indirect materials to support its electronic industy. This step is expected to increase the Company’s contribution margin especially for raw materials and other indirect materials.

14. Keep innovating in the semi-automatic

manufacturing and perfecting the vertical integration process by renewing production facilities, increasing product quality control and timely delivery of goods and minimizing production costs to add value to customers and maintain a good cooperation with customers.

15. Ask for price reduction or discounts from

vendors by shortening the payment period by always considering the economic effects for the Company’s profits.

16. Expand the Company’s margin potential by

expanding engineering capabilities through internal needs services such as fabricating jigs and tools used in the production process and exploration market segments outside the Company.

17. Review the possibility of using more efficient and cheaper indirect materials by still considering the products outcome quality and obtaining the customers’ approval before implementing such a change.

18. Explore a cooperation with design companies as a breakthrough by providing integrated services to customers. Such additional product design services to customers will increase the customers’ dependence to the Company, leading to a more secure business continuity.

Page 230: annual report 2012 laporan tahunan 1

PT SAT NUSAPERSADA Tbk DAN ENTITAS ANAK / AND SUBSIDIARY

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASI UNTUK TAHUN YANG BERAKHIR PADA TANGGAL-TANGGAL 31 DESEMBER 2012 DAN 2011 (Dinyatakan dalam Dolar Amerika Serikat, kecuali Dinyatakan Lain)

NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS

FOR THE YEARS ENDED DECEMBER 31, 2012 AND 2011

(Expressed in United States Dollar, except

Otherwise Stated)

71

25. REKLASIFIKASI AKUN Akun berikut ini dalam Laporan Keuangan

Konsolidasi tahun 2011 telah direklasifikasi agar sesuai dengan penyajian Laporan Keuangan Konsolidasi tahun 2012 :

25. RECLASSIFICATION OF ACCOUNTS The following accounts in the 2011 Consolidated

Financial Statements have been reclassified to conform with the presentation of the 2012 Consolidated Financial Statements:

Sebelum Setelah

Reklasifikasi Reklasifikasi

(Disajikan Kembali)/ (Disajikan Kembali)/

Before After

Reclassifications Reklasifikasi/ Reclassifications

(Restated) Reclassifications (Restated)

Beban Pokok Penjualan (226.327.405) (633.281) (226.960.686) Cost of Sales

Penghasilan (Beban) Lain-lain - Other Income (Charges) -

Laba (Rugi) Penjualan Sisa Gain (Loss) on Sale of Waster

Produk (394.552) 633.281 238.729 Products

26. AKTIVITAS NON KAS

Informasi tambahan atas Laporan Arus Kas Konsolidasi terkait aktivitas non kas adalah sebagai berikut :

26. NON CASH ACTIVITY Additional information on cash flows related to

non cash activity is as follows :

2 0 1 2 2 0 1 1

Pengungkapan Tambahan Additional Disclosure

Reklasifikasi Aset Lain-lain ke Reclassification of Other Assets

Aset Tetap 57.058 - to Fixed Assets

27. KEJADIAN SETELAH TANGGAL LAPORAN

POSISI KEUANGAN (NERACA) Sampai dengan tanggal Laporan Keuangan ini diselesaikan oleh manajemen Perusahaan, tidak ada peristiwa setelah tanggal Laporan Posisi Keuangan (Neraca) yang signifikan.

27. SUBSEQUENT EVENTS Up to the date the Consolidated Financial

Statements were completed by the Company’s management, there has been no significant event.

Page 231: annual report 2012 laporan tahunan 1

annual report 2012 laporan tahunan 148