of 35 /35
DIREKTORAT BUDIDAYA TERNAK 2013 Hari Gini Masih apa kata K O R U P SI DUNIAAAAAAA W K B KEMENTERIAN PERTANIAN Informasi lebih lanjut hubungi DIREKTORAT BUDIDAYA TERNAK Kantor Pusat Kementerian Pertanian Gedung C Lantai 9 Wing A Jl. Harsono RM No. 3 Ps. Minggu - Jakarta Selatan Telp./Fax. : 021 - 7815782 Website : http;//www.ditjennak.go.id e-mail : [email protected] KEMENTERIAN PERTANIAN DIREKTORAT JENDERAL PETERNAKAN DAN KESEHATAN HEWAN PEDOMAN PELAKSANAAN PENGEMBANGAN BUDIDAYA KELINCI PEDOMAN PELAKSANAAN PENGEMBANGAN BUDIDAYA KELINCI

PEDUM KELINCI 2013

Embed Size (px)

DESCRIPTION

kelinci

Citation preview

DIREKTORAT BUDIDAYA TERNAK2013

Hari Gini Masih

apa kata

K O R U P SI

DUNIAAAAAAA

W KBKEMENTERIAN PERTANIAN

Informasi lebih lanjut hubungiDIREKTORAT BUDIDAYA TERNAK

Kantor Pusat Kementerian Pertanian Gedung C Lantai 9 Wing AJl. Harsono RM No. 3 Ps. Minggu - Jakarta Selatan

Telp./Fax. : 021 - 7815782 Website : http;//www.ditjennak.go.ide-mail : [email protected]

KEMENTERIAN PERTANIAN

DIREKTORAT JENDERAL PETERNAKAN

DAN KESEHATAN HEWAN

PEDOMAN PELAKSANAANPENGEMBANGAN

BUDIDAYA KELINCI

PEDOMAN PELAKSANAANPENGEMBANGAN

BUDIDAYA KELINCI

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 i

KEMENTERIAN PERTANIANDIREKTORAT JENDERAL PETERNAKAN

DAN KESEHATAN HEWAN

DIREKTORAT BUDIDAYA TERNAK2013

PEDOMAN PELAKSANAANPENGEMBANGAN

BUDIDAYA KELINCI

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 ii

KATA PENGANTAR

Pembangunan sub sektor peternakan sebagai bagian dari upaya-upaya operasionalisasi keberpihakan Pemerintah kepada masyarakat peternak diwujudkan dengan penerapan Program Pengembangan Aneka Ternak dan Monogastrik dalam rangka promosi substitusi daging melalui fasilitasi sarana produksi ternak bagi kelompok. Pada dasarnya penerapan pola ini adalah untuk memberdayakan petani peternak.

Pengembangan Budidaya Kelinci merupakan salah satu upaya yang dilakukan pemerintah dalam mengembangkan usaha peternakan kelinci yang memiliki nilai potensial sebagai penghasil daging yang sehat dan aman. Program ini disamping dapat meningkatkan produksi dan populasi kelinci, juga diharapkan dapat mengatasi kerawanan gizi pada masyarakat dan meningkatkan pendapatan dan kesejahteraan peternak kelinci.

Pedoman Pelaksanaan ini merupakan acuan kegiatan guna mendukung kelancaran operasionalisasi di daerah. Hal ini penting dicermati agar tujuan dan sasaran pengembangan kelinci dapat tercapai. Oleh karena itu diperlukan optimalisasi peran pendamping dari daerah termasuk kompetensi dan dedikasi para pendamping agar masyarakat dilokasi kegiatan dapat menerima manfaat dari adanya fasilitasi pemerintah.

Jakarta, 14 Januari 2013

Direktur Jenderal Peternakan

dan Kesehatan Hewan

Ir. Syukur Iwantoro MS, MBA

NIP. 19590530 198403 1 001

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 iii

DAFTAR ISI

KATA PENGANTAR ................................................................................. ii DAFTAR ISI .............................................................................................. iiiDAFTAR TABEL ...................................................................................... ivDAFTAR LAMPIRAN ............................................................................... vI. PENDAHULUAN ............................................................................ 1 A. Latar Belakang ......................................................................... 1 B. Tujuan dan Sasaran ................................................................ 2 C. Ruang Lingkup ......................................................................... 2 D. Dasar Pelaksanaan Kegiatan .................................................. 2 E. Jadwal Pelaksanaan ................................................................ 3 F. Pengertian ............................................................................... 3

II. ORGANISASI PELAKSANA ......................................................... 5 A. Direktorat Jenderal Peternakan dan Kesehatan Hewan .......... 5 B. Dinas Peternakan dan Kesehatan Hewan Provinsi ................ 5 C. Dinas Peternakan dan Kesehatan Kab./Kota .......................... 6 D. Kelompok ................................................................................. 7 III. PELAKSANAAN ............................................................................ 8 A. Sosialisasi ............................................................................... 8 B Seleksi ..................................................................................... 8 1. Kriteria Lokasi ...................................................................... 8 2. Kriteria Kelompok ................................................................ 9 3.Seleksi,VerifikasidanPenetapanKelompok ...................... 9 C. Pengembangan Budidaya Babi Ramah Lingkungan ............... 10

IV. PENGADAAN SARANA PRODUKSI ............................................ 12 A. Sarana Produksi Pengembangan Kelinci ................................ 12 B. Proses Pengadaan .................................................................. 13 C. Serah Terima/Distribusi Sapronak ........................................... 15

V. PEMBINAAN .................................................................................. 16VI. INDIKATOR KEBERHASILAN ...................................................... 17 VII. MONITORING DAN EVALUASI .................................................... 19 A. Monitoring dan Evaluasi .......................................................... 19 B. Pelaporan ................................................................................ 20

VIII. PENUTUP ...................................................................................... 21IX. LAMPIRAN .................................................................................... 22

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 iv

DAFTAR TABEL

Halaman

Tabel 1 Jadwal pelaksanaan kegiatan .............................................. 3

Tabel 2 Proporsi penggunaan dana Pengembangan Budidaya Kelinci .................................................................................. 12

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 v

DAFTAR LAMPIRANHalaman

Lampiran 1 Surat Perjanjian Kerjasama ......................................... 22 Lampiran 2 Berita Acara Penitipan Barang ..................................... 27 Lampiran 3 Berita Acara Serah Terima Barang ............................... 28Lampiran 4 Laporan Perkembangan Kegiatan ............................... 29

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 1

BAB IPENDAHULUAN

A. Latar BelakangPembangunan peternakan merupakan bagian dari suatu totalitas kinerja agribisnis, khususnya sub sistem usaha tani ternak dengan keluaran berupa produksi primer ternak. Subsistem ini akan menjadi suatu kesatuan kinerja yang tidak terpisahkan dari subsistem agribisnis hulu (kegiatan ekonomi input, produksi peternakan, informasi, dan teknologi) dan subsistem agribisnis hilir (perdagangan, pengolahan, dan jasa agribisnis).

Usaha agribisnis berbasis peternakan pada dasarnya secara operasional memerlukan keterkaitan lintas sub sektor maupun dengan sektor lainnya sehingga diperoleh sinergi yang proporsional antara pelaku agribisnis peternakan baik pada segmen hulu, budidaya dan hilir.

Dalam rangka mendukung program pengembangan agribisnis peternakan, komoditi kelinci khususnya dalam hal diversifikasipemenuhan protein hewani mempunyai peran penting sebagai alternatif sumber penyediaan daging disamping juga sebagai hewan kesayangan. Usaha budidaya ternak kelinci dapat meningkatkan pendapatan peternak karena kelinci merupakan ternak yang tumbuh dan ber reproduksi cepat (bersifatprolific)sertadapatmeningkatkannilaitambahdenganadanyapengolahan hasil, sehingga pada sisi lain dapat menyerap tenaga kerja yang membantu dan membina pengembangan wilayah di pedesaan.

Dengan maraknya wabah Flu Burung terhadap ternak unggas, salah satu alternatif pengganti unggas adalah melalui pengembangan ternak kelinci di pedesaan guna peningkatan gizi masyarakat, peningkatan pendapatan serta sumber pakan dapat memanfaatkan limbah tanaman hortikultura (wortel, labu, ketimun, kentang, kangkung dll) serta kotoran

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 2

dan urinenya dapat dimanfaatkan sebagai pupuk kandang untuk lahan tanaman sayur-sayuran.

Selanjutnya, dalam upaya memfasilitasi pelaksanaan pengembangan budidaya non unggas (aneka ternak) khususnya pengembangan usaha budidaya kelinci, Direktorat Budidaya Ternak pada tahun 2013 perlu melaksanakan kegiatan Pengembangan Budidaya Kelinci.

B. Tujuan

1. Tujuan pemberdayaan kelompok peternak kelinci antara lain untuk : a. Meningkatkan populasi, produksi dan produktivitas serta

pendapatan peternak secara berkelanjutan;b. Meningkatkan kemandirian dan kerjasama kelompok.

2. Sasaran kegiatan, antara lain :a. Meningkatnya populasi dan produksi ternak kelinci;b. Meningkatnya kemampuan kelompok peternak secara manajerial

dan teknis dalam mengembangkan usaha kelompoknya;c. Meningkatnya kemandirian dan kerjasama kelompok.

C. Ruang Lingkup

Ruang lingkup Petunjuk pelaksanaan pengembangan budidaya kelinci ini meliputi : Organisasi Pelaksana, Pelaksanaan kegiatan, Pengadaan sarana produksi, Pembinaan, Indikator keberhasilan, Monitoring, Evaluasi dan Pelaporan.

D. Dasar Pelaksanaan

a. Renstra Direktorat Jenderal Peternakan dan Kesehatan Hewan Tahun 2011 – 2014.

b. Daftar Isian Pelaksanaan Anggaran Satuan Kerja Direktorat Jenderal Peternakan Kementerian Pertanian Tahun 2013.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 3

E. Jadwal Pelaksanaan

Pelaksanaan kegiatan Pengembangan Budidaya Kelinci Tahun 2013, sebagai berikut:

Tabel -1: Jadwal pelaksanaan kegiatan

NO KEGIATAN BULANJ F M A M J J A S O N D

1 Persiapan

2Koordinasi dan Sosialisai

3 Pelaksanaan CP/CL

4Penetapan Kelompok Terpilih

5 Pengadaan Barang

6Monitoring dan Pembinaan

7 Pelaporan

F. Pengertian

Dalam pedoman ini yang dimaksud dengan:a. Pakan : Adalah campuran dari beberapa bahan pakan, baik yang sudah

maupun yang masih akan dilengkapi, yang disusun secara khusus untuk dapat dipergunakan sesuai dengan jenis dan umur ternak.

b. Kelompok Usaha : Adalah kumpulan beberapa orang yang mempunyai usaha sejenis

untuk mencapai tujuan yang sama.c. Pemberdayaan : Adalah suatu proses dimana masyarakat, khususnya mereka yang

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 4

kurang memiliki akses kepada sumberdaya pembangunan, didorong untuk menjadi mandiri melalui usaha-usaha yang dilakukan sendiri dengan potensi dan kemampuan sendiri dan difasilitasi pihak luar untuk menciptakan kondisi yang kondusif.

d. Pendampingan : Adalah salah satu bentuk fasilitasi Pemerintah atau pihak lain

kepada masyarakat dalam menjalankan usaha budidaya yang lebih baik (better farming) untuk meningkatkan taraf kehidupannya (better living).

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 5

BAB IIORGANISASI PELAKSANA

Untuk kelancaran pelaksanaan kegiatan fasilitasi dan pemberdayaan kelompok dengan komoditi yang dikembangkan ternak kelinci, dibentuk Tim Pelaksana baik di Direktorat Jenderal Peternakan dan Kesehatan Hewan Kementerian Pertanian maupun di masing-masing Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi dan Kabupaten/Kota, dengan tugas dan peran masing-masing sebagai berikut:

A. Direktorat Jenderal Peternakan dan Kesehatan HewanTugas dan Peran sebagai berikut:1. Menyusun Pedoman Pelaksanaan pengembangan budidaya kelinci;2. Melakukan koordinasi dan sosialisasi dengan Pemerintah Propinsi

dan Kabupaten/Kota dalam rangka efisiensi dan efektivitaspelaksanaan kegiatan.

3. Melakukan pembinaan, monitoring dan evaluasi serta membantu menyelesaikan permasalahan yang tidak mampu diselesaikan oleh Dinas yang membidangi fungsi peternakan dan kesehatan hewan Provinsi

4. Melaporkan kinerja pelaksanaan kegiatan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan.

B. Dinas Membidangi Peternakan dan Kesehatan Hewan Propinsi

Tugas dan peran sebagai berikut:1. Pedoman Pelaksanaan kegiatan Pengembangan Budidaya Kelinci

selanjutnya dapat dijabarkan kedalam petunjuk peleksanaan untuk mengakomodir aspek-aspek di daerah.

2. Melakukan koordinasi dan sosialisasi dengan Kabupaten/Kota dalamrangkaefisiensidanefektivitaspelaksanaankegiatandengan instansi terkait di tingkat Provinsi dan Kabupaten/Kota;

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 6

3. Melaksanakanverifikasikelompoksasaran;4. Menetapkan kelompok pelaksana kegiatan melalui SK Kepala

Dinas; 5. Menetapkan kriteria/persyaratan teknis ;6. Membentuk tim pembina kegiatan, tim pegadaan dan tim penerima

barang7. Melakukan pembinaan, monitoring dan evaluasi serta membantu

menyelesaikan permasalahan yang tidak mampu diselesaikan oleh Dinas yang membidangi fungsi peternakan dan kesehatan hewan Kabupaten/Kota;

8. Menyampaikan laporan perkembangan pelaksanaan kegiatan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan.

C. Dinas Membidangi Peternakan Kabupaten/KotaTugas dan peran sebagai berikut :1. Memberikan rekomendasi terhadap usulan kelompok ternak calon

pelaksana kegiatan pengembangan kelinci ; 2. Melakukan seleksi kelompok sasaran (CP/CL) ;3. Mengusulkan calon kelompok ternak pelaksana kegiatan

pengembangan kelinci kepada Dinas Provinsi4. Melakukan pembinaan dan bimbingan kepada kelompok agar dapat

menjalankan usaha agribisnis peternakan kelinci dengan mengacu pada Good Farming Practices (GFP).

5. Melakukan monitoring dan evaluasi serta membantu menyelesaikan permasalahan yang timbul di lapangan;

6. Melaporkan perkembangan kegiatan kepada Dinas yang membidangi fungsi peternakan dan kesehatan hewan Provinsi dengan tembusan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan cq. Direktur Budidaya Ternak

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 7

D. KelompokTugas dan peran sebagai berikut:1. Mengajukan proposal permohonan kegiatan pengembangan kelinci

kepada Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi melalui Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota;

2. Melaksanakan kegiatan pengembagan kelinci sesuai dengan pedoman

3. Mengelola dan memanfaatkan sarana produksi untuk pengembangan kelinci;

4. Melaksanakan usaha budidaya ternak kelinci dengan mengacu pada good farming practices (GFP);

5. Meningkatkan kapasitas usaha dan kelembagaan kelompok melalui peningkatan populasi ternak kelinci;

6. Menerima saran/rekomendasi teknis, kewirausahaan dan manajemen usaha dari petugas pendamping, Penyuluh Pertanian, Tim Teknis Dinas yang membidangi fungsi Peternakan Kabupaten Kota, BPTP, Perguruan Tinggi dan pihak yang berkompeten lainnya

7. Melakukan pencatatan perkembangan usaha budidaya kelinci8. Melaporkan perkembangan pelaksanaan kegiatan budidaya kelinci

secara berkala kepada Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 8

BAB IIIPELAKSANAAN

Pelaksanaan kegiatan Pengembangan kelinci sebagai berikut :

A. Sosialisasi

Sosialisasi kegiatan pengembangan budidaya kelinci dilakukan dengan tujuanuntukmeningkatkanpopulasi,produksidanproduktifitas ternakkelinci sehingga meningkatkan minat dan motivasi kelompok dalam pengembangan usaha termasuk sanksi bagi pihak yang melanggar ketentuan dan aturan yang berlaku.

Kegiatan sosialisasi dilaksanakan oleh Tim pembina di tingkat Pusat dan Provinsi serta Tim Teknis Kabupaten/Kota.

B. Seleksi

Kelompok Tani Ternak yang mengajukan proposal dan mendapat rekomendasi dari kepala dinas yang membidangi fungsi peternakan dan kesehatan hewan kabupaten/kota dan memenuhi persyaratan lokasi dan kelompok dapat diproses untuk mengikuti seleksi.

1. Kriteria Lokasi a. Kondisi agroekosistem, sesuai untuk pengembangan ternak

kelinci; b. Merupakan lokasi yang diarahkan untuk pengembangan sentra

produksi ternak kelinci;c. Mempunyai potensi untuk dikembangkan, dilihat dari aspek

teknis, sosial dan ekonomi masyarakat setempat ;

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 9

2. Kriteria Kelompok a. Kelompok telah terdaftar dan merupakan binaan dari Dinas

yang membidangi fungsi peternakan dan kesehatan hewan di Kabupaten/Kota;

b. Kelompok telah mengembangkan usaha budidaya ternak kelinci atau kelompok baru yang memiliki sumber daya alam (SDA) maupun sumber daya manusia (SDM) untuk pengembangan usaha budidaya ternak kelinci. Khusus untuk kelompok baru harus sudah menyiapkan kandang;

c. Mempunyai lahan/sarana untuk pengembangan usaha budidaya ternak kelinci;

d. Mempunyai struktur organisasi yang jelas (Identitas kelompok, pengurus dan anggota);

e. Pengurus kelompok bukan berasal dari kerabat dekat terutama Ketua kelompok dan bendahara;

f. Pengurus dan anggota kelompok profesinya adalah petani peternak;

g. Mempunyai kelengkapan administrasi kelompok;h. Bersedia mengikuti aturan dan bimbingan yang ditetapkan

oleh Tim Teknis/Dinas yang membidangi fungsi peternakan Kabupaten/Kota;

i. Membuat proposal usaha pengembangan budidaya kelinci dan direkomendasi oleh Kepala Dinas Peternakan/Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota.

3.Seleksi,VerifikasidanPenetapanKelompoka. Berdasarkan proposal yang masuk dari kelompok ke Kabupaten/

Kota selanjutnya dilakukan seleksi melalui CP/CL oleh tim teknis Kabupaten/Kota. Hasil seleksi CP/CL direkomendasikan oleh kepala dinas yang membidangi fungsi peternakan dan kesehatan hewan Kabupaten/Kota ke Provinsi sebagai usulan

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 10

calon kelompok pelaksana kegiatan pengembangan kelinci.b. Berdasarkan usulan dari Kabupaten/Kota selanjutnya dinas

provinsimelakukanpenilaiandandilakukanverifikasi.c. Hasilverifikasilapanganolehtimpropinsiselanjutnyadiusulkan

kepada Kepala Dinas Provinsi untuk ditetapkan sebagai kelompok pelaksana kegiatan;

d. Penetapan kelompok dituangkan dalam Surat Keputusan Kepala Dinas yang membidangi fungsi peternakan dan kesehatan hewan Provinsi sebagai kelompok pelaksana kegiatan pengembangan kelinci tahun 2013.

C. Pengembangan Budidaya kelinci

Pengembangan budidaya kelinci yang dilaksanakan oleh kelompok-kelompok peternak diarahkan untuk menjadi unit usaha dalam rangka meningkatkan kesejahteraan peternak, disamping menumbuhkan dan memperkuat sentra-sentra kelinci. Sejalan dengan tujuan kegiatan pengembangan budidaya kelinci dilakukan dalam bentuk usaha budidaya yang produktif seperti pembesaran untuk menghasilkan produksi daging. Disamping itu kelompok juga harus mulai mempersiapkan sumber input khususnya ternak yaitu dengan melakukan pengembangbiakan kelinci yang berkualitas seperti kelinci Flamish Giant, New Zealand, Rex, Sati, Dutch dll.

Untuk mengembangkan usaha budidaya produktif baik untuk menghasilkan daging fasilitasi yang di berikan dapat berupa pengadaan ternak bibit atau pengadaan anakan lepas sapih untuk pembesaran, pakan ternak, vaksin dan obat-obatan, bahan dan peralatan biosekuriti.

Usaha pengembangbiakan dalam rangka meningkatkan populasi ternak milik kelompok dan menjadikan kelompok mandiri dari ketergantungan kepada pihak lain dalam pengadaan ternak disamping itu kegiatan ini

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 11

nantinya akan menghasilkan replacement stock ternak kelinci unggul berkualitas. Untuk itu fasilitasi ternak harus benar-benar ternak kelinci unggul dalam bentuk bibit atau anakan lepas sapih disamping pakan ternak, vaksin dan obat-obatan, bahan dan peralatan biosekuriti. Rincian alokasi penggunaan dana dapat dilihat pada tabel 2.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 12

BAB IVPENGADAAN SARANA PRODUKSI

Pada tahun 2013 Direktorat Jenderal Peternakan dan Kesehatan Hewan mengalokasikan kegiatan melalui APBN untuk pengembangan budidaya kelinci . Anggaran Tersebut dialokasikan melalui dana dekonsentrasi di dinas yang melaksanakan fungsi peternakan ditingkat Provinsi.

A. Sarana Produksi Pengembangan Kelinci

Dalam rangka memperkuat pengembangan usaha budidaya kelinci dilakukan melalui penguatan sarana usaha yang meliputi pengadaan ternak kelinci, bantuan sarana perbaikan kandang, peralatan kandang, pengadaan pakan, vaksin dan obat-obatan, bahan dan peralatan biosekuriti

Tabel – 2: Proporsi penggunaan dana pengembangan budidaya ternak kelinci

No. Komponen Kegiatan Proporsi (%)

1 2 3

1 Pengadaan Ternak 55

2 Pengadaan Peralatan Kandang 15

3 Pengadaan Pakan Konsentrat 20

4 Pengadaan Vaksin dan obat-obatan10

5 Pengadaan Bahan dan Peralatan Biosekuriti

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 13

B. Proses Pengadaan

Proses pengadaan sarana produksi tersebut dilakukan melalui proses lelang yang mengacu kepada Peraturan Presiden no. 70 tahun 2012. Tahapan proses pengadaan meliputi :

1. Persiapan Agar proses kegiatan berjalan dengan lancar,efektif dan efisien

pengadaan harus direncanakan dengan matang. Rencana pengadaan sarana produksi ini dituangkan dalam kerangka acuan kegiatan (KAK) yang di susun oleh tim teknis. Di dalam KAK di jelaskan tentang tujuan kegiatan, sasaran kegiatan, waktu pelaksanaan, sfesifikasi teknis Barang, besarnya total perkiraanbiaya pekerjaan.

2. Pembentukan Tim Pengadaan Mengacu kepada Peraturan Presiden No. 70 Tahun 2012 bahwa

pengadaan barang dilaksanakan oleh tim yang di bentuk oleh pimpinan unit organisasi (KPA). Dalam proses pengadaan barang yang harus dibentuk meliputi : tim pengadaan dan tim penerima hasil pekerjaan/barang.a. Tim pengadaan. Pembentukkan tim pengadaan barang terdiri dari 3-5 orang

yang memenuhi persyaratan yaitu sudah memiliki sertifikatpengadaan barang dan jasa.

Tugas pokok dan kewenangan Kelompok Kerja ULP/Pejabat Pengadaan meliputi:1) Menyusun rencana pemilihan penyedia barang;2) Menetapkan Dokumen pengadaan;3) Menetapkan besaran nominal jaminan penawaran;4) Mengumumkan pelaksanaan pengadaan barang di

website Kementerian / Lembaga / Pemerintah Daerah/

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 14

Institusi masing-masing dan papan pengumuman resmi untuk masyarakat serta menyampaikan ke LPSE untuk diumumkan dalam Portal Pengadaan Nasional;

5) Menilai kualifikasi penyedia barang melalui prakualifikasiataupascakualifikasi;

6) Melakukan evaluasi administrasi, teknis dan harga terhadap penawaran yang masuk.

b. Tim Penerima Hasil Pekerjaan Pembentukkan tim disesuaikan dengan kebutuhan dan volume

pekerjaan dengan diutamakan petugas yang menangani penata usaha barang disamping unsur teknis.

Tugas tim penerima barang 1) Melakukan pemeriksaan hasil pekerjaan pengadaan barang

sesuai dengan ketentuan yang tercantum dalam kontrak;2) Menerima hasil pengadaan barang setelah melalui

pemeriksaan/pengujian;3) Membuat dan menandatangani Berita Acara Serah Terima

Hasil Pekerjaan.

3. Proses Pengadaan Proses pangadaan barang dilakukan melalui sistem pengadaan

secara elektronik (LPSE)/e-procurement. Tahapan pengadaan barang berdasarkan sistem LPSE sebagai

berikut:a. Penyusunan Rencana Kerja dan Syarat (RKS)b. Pengumuman lelangc. Pemasukkan dokumen penawarand. Evaluasi dan penilaian dokumene. Penetapan dan pengumuman pemenang

Dalam proses pengadaan, khsususnya untuk pengadaan pakan konsentrat yang relatif mudah berubah kualitasnya jika disimpan

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 15

terlalu lama, maka perlu direncanakan dengan baik jadwal waktu pengadaannya disesuaikan dengan kebutuhan agar tetap diperoleh kualitas pakan konsentrat yang tetap terjaga kualitasnya.

C. Serah Terima/Distribusi Sapronak

Pemberdayaan terhadap kelompok peternak terpilih dilakukan melalui fasilitasi dalam bentuk natura (sarana produksi peternakan) yang diserahkan kepada kelompok untuk selanjutnya dikembangkan. Sarana produksi sebelum diserahkan kepada kelompok harus sudah diterima oleh tim penerima sesuai dengan spesifikasi yang dibuktikan dalamBerita Acara Serah Terima (BAST).

Penyerahan barang dalam rangka pengembangan ternak kelinci dilakukan oleh PPK atas nama pemerintah kepada kelompok peternak terpilih sebagai pelaksana kegiatan yang dituangkan dalam bentuk Surat Perjanjian Kerjasama (SPK). Di dalam SPK di jelaskan tentang : para pihak yang melakukan perjanjian, waktu dan tempat, dasar pelaksanaan, lingkup pekerjaan, pelaksanaan kegiatan, jumlah dan jenis barang, pengembangan usaha, sanksi, perselisihan, force major, dan lain-lain.Setelah penyerahan barang/sarana produksi peternakan, dalam waktu sesegera mungkin atau selambat-lambatnya 6 (enam) bukan sejak BAST harus dilakukan penghibahan dari Dinas Provinsi kepada kelompok penerima bantuan sesuai dengan peraturan perundangan yang berlaku.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 16

BAB VPEMBINAAN

Pembinaan bertujuan untuk meningkatkan populasi, produksi dan produktivitas ternak kelinci. Pembinaan teknis meliputi pengembangan budidaya ternak kelinci yang dapat dilakukan dalam bentuk usaha pembesaran, pengembangbiakan, atau kombinasi diantaranya, dan dapat dikembangkan sebagai usaha khusus maupun terintegrasi dengan usaha subsektor/ sektor lain.

Untuk meningkatkan efisiensi dan efektifitas kegiatan dapat dilakukankerjasama dengan peternak maju, baik dalam hal pengadaan, tatalaksana, maupun pemasaran.

Pembinaan usaha oleh pemerintah difokuskan kepada pengembangan usaha budidaya ternak kelinci. Jenis-jenis usaha yang dikembangkan oleh kelompok peternak budidaya ternak kelinci searah dengan program pengembangan sentra usaha peternakan yang telah ditetapkan.

Pengembangan usaha budidaya ternak kelinci di daerah akan berhasil secara optimal apabila pemerintah daerah, swasta dan masyarakat memberikan dukungan sepenuhnya. Pemerintah daerah harus mampu membuka peluang usaha bagi masyarakat peternakan melalui peraturan dan kebijakan daerah, penyediaan sarana dan prasarana pendukung seperti jalan, saluran irigasi, pasar, listrik, serta alokasi dana yang memadai bagi kegiatan pendampingan kelompok. Kegiatan pendampingan harus dilakukan secara berkelanjutan. Disamping itu pemerintah daerah juga bertanggung jawab dalam pembinaan lanjutan bagi kelompok peternak sasaran dalam bentuk supervisi, pemantauan, evaluasi dan pelaporan.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 17

BAB VI INDIKATOR KEBERHASILAN

Evaluasi keberhasilan terhadap implementasi kegiatan perlu dilakukan sebagai umpan balik penyempurnaan kegiatan dan akuntabilitas publik. Penilaian kegiatan ini dapat dilihat dari beberapa aspek, antara lain :

1. Aspek teknisa. Optimalisasi pemanfaatan sumberdaya alam sekitar lokasi

kelompok, seperti: bibit ternak, limbah tanaman untuk pakan ternak, bahan pakan lokal;

b. Rekayasa teknologi produksi yang diaplikasikan secara efektif dan efisienseperti:IB,obat-obatan,alatdanmesindsb;

c. Perkembangan jumlah populasi dan kepemilikan ternak;d. Peningkatan produksi dan produktivitas ternak melalui peningkatan

populasi dan berkurangnya resiko kematian terhadap populasi ternak di kelompok tersebut.

2. Aspek Kelembagaana. Perkembangan jumlah anggota atau kelompok yang menerima

manfaat;b. Perkembangan partisipasi kelompok/anggota dalam pengambilan

keputusan;c. Mengakomodasi aspirasi anggota kelompok serta masyarakat

sekitarnya;d. Meningkatnya kerjasama dengan stakeholder, seperti dalam

pengadaan pakan dan lain-lain;e. Tidak ada lagi pendampingan secara rutin dari pemeritah (kelompok

mandiri);f. Mengukuhkan dan memperkuat sistem dan usaha kelompok.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 18

3. Aspek Usahaa. Perkembangan permodalan kelompok, baik interal (dari usaha yang

dilakukan oleh kelompok itu sendiri); b. Kemampuan kelompok untuk mengakses sumber pembiayaan

modal usaha maupun dari sumber eksternal (perbankan, investasi masyarakat dan kemitraan, dll);

c. Meningkatnya kapasitas usaha dan peran masyarakat di sekitar kelompok dalam mengembangkan usaha, memanfaatkan peluang usaha, seperti usaha jasa, usaha pupuk kandang, usaha simpan pinjam, dsb;

d. Meningkatnya keterlibatan kelompok/anggota dalam menanggulangi resiko usaha;

e. Kelompok mampu melakukan analisa, merencanakan dan memonitor sendiri kegiatan-kegiatan yang dilakukannya;

f. Perkembangan peningkatan pendapatan anggota kelompok;g. Perkembangan usaha dan peningkatan skala usaha kepemilikan

ternak;h. Perkembangan usaha agribisnis masyarakat di sekitar kelompok

tersebut.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 19

BAB VIIMONITORING, EVALUASI DAN PELAPORAN

A. Monitoring dan Evaluasi

Monitoring dan evaluasi pelaksanaan kegiatan pengembangan budidaya kelinci melalui penguatan sarana usaha, dimaksudkan untuk mengetahui secaraakuratrealisasifisikdankeuangan,sertaperkembanganusahadan kelembagaannya, serta mengetahui kendala yang dihadapi dalam pelaksanaan kegiatan penguatan sarana usaha, mulai dari pusat, provinsi, kabupaten/kota dan kelompok.

Monitoring dan Evaluasi dilakukan secara berkala dan berjenjang sesuai dengan tahapan pelaksanaan kegiatan, dengan tujuan untuk mengidentifikasidanmemberikansolusipemecahanpermasalahanyangdihadapi pada masing-masing jenjang (pusat, provinsi, kabupaten/kota dan kelompok)

Monitoring dan evaluasi dilakukan secara terkoordinasi oleh Direktorat Jenderal Peternakan dan Kesehatan Hewan, Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Propinsi dan Kabupaten/Kota untuk memantau perkembangan pelaksanaan kegiatan. Sasaran pembinaan, monitoring dan evaluasi yang dilakukan secara berjenjang tersebut meliputi :

1. Kemajuan pelaksanaan kegiatan sesuai indikator kinerja 2. Permasalahan/potensi masalah yang dihadapi di tingkat kelompok,

kabupaten/kota dan provinsi.3. Memberikan solusi dan pemecahan masalah dalam pelaksanaan

kegiatan pengembangan budidaya kelinci

Hasil monitoring dan evaluasi diformulasikan dalam bentuk laporan, merupakan data dan informasi untuk bahan koreksi pelaksanaan kegiatan,

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 20

dan untuk perbaikan sistem pelaksanaan fasilitasi dan pemberdayaan kelompok di masa yang akan datang.

B. Pelaporan

Pelaporan sangat diperlukan untuk mengetahui kemajuan pengembangan kinerja usaha kelompok di lapangan. Untuk itu perlu ditetapkan mekanisme sistem pelaporan sebagai berikut :

1. Kelompok wajib melaporkan perkembangan pelaksanaan kegiatan setiap bulan kepada Dinas yang membidangi fungsi peternakan Kabupaten/Kota dengan tembusan kepada Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi;

2. Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota melakukan rekapitulasi seluruh laporan perkembangan yang diterima dari kelompok pelaksana kegiatan untuk disampaikan ke Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi setiap bulan dengan ditembuskan ke Direktur Jenderal Peternakan dan Kesehatan Hewan cq. Direktur Budidaya Ternak;

3. Dinas yang membidangi fungsi peternakan Propinsi melakukan rekapitulasi seluruh laporan perkembangan yang diterima dari Kabupaten/Kota dan selanjutnya setiap triwulan menyampaikan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan cq. Direktur Budidaya Ternak.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 21

BAB VIIIPENUTUP

Pedoman Pelaksanaan Pengembangan Budidaya ternak kelinci disusun untuk dipedomani oleh pelaksana baik ditingkat pusat maupun daerah dalam rangka mendukung kelancaran pelaksanaan di lapangan. Petunjuk pelaksana ini dapat di jabarkan lebih lanjut dalam bentuk petunjuk teknis oleh dinas provinsi.

Diharapkan dengan adanya Pedoman pelaksanaan ini, semua pelaksana kegiatan di tingkat pusat, provinsi, kabupaten/kota, kelompok pelaksana serta stakeholder terkait dapat melaksanakan seluruh tahapan kegiatan secara baik dan benar menuju tercapainya sasaran yang telah ditetapkan dengan mengacu pada ketentuan-ketentuan yang berlaku.

DIREKTORAT JENDERAL PETERNAKAN DAN KESEHATAN HEWAN

LENOVO
Highlight
pelaksanaan

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 22

Lampiran - 1

SURAT PERJANJIAN KERJASAMANOMOR : ....................................

ANTARA

PEJABAT PEMBUAT KOMITMENDINAS........ PROVINSI/KAB/KOTA

DENGAN

KELOMPOK TANI TERNAK ............................DESA ....................., KECAMATAN ..................., KABUPATEN ..................

PROVINSI .......................................................................

TENTANG

PENGEMBANGAN BUDIDAYA KELINCI TAHUN 2013

Pada hari ini ............... tanggal ................. bulan ..................... tahun dua ribu tiga belas bertempat di Kantor Dinas....Prov/Kab/Kota, Jalan ..........No. Prov...Kab/Kota...... kami yang bertanda tangan di bawah ini :

1. ...................... : Pejabat Pembuat Komitmen Dinas ......Prov/Kab/kota berdasarkan Keputusan No.................yang berkedudukan di Jalan ........... yang untuk selanjutnya disebut sebagai PIHAK PERTAMA.

2. ……………… : Ketua Kelompok Tani Ternak…..dalam hal ini bertindak untuk dan atas nama Kelompok Ternak…….yang berkedudukan di Desa/Kel…………………Kecamatan……………Kabupaten/ Kota… Provinsi……..….yang selanjutnya disebut sebagai PIHAK KEDUA.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 23

Kedua belah pihak sepakat untuk mengadakan Perjanjian Kerjasama yang mengikat dan berakibat hukum bagi kedua belah pihak untuk melaksanakan Pengembangan Budidaya Kelinci Tahun 2013 kepada Kelompok, dengan ketentuan sebagai berikut :

Pasal 1DASAR PELAKSANAAN

1. Keputusan Presiden No. 42 Tahun 2002, tentang Pedoman Pelaksanaan Anggaran Pendapatan dan Belanja Negara (Lembaran Negara Republik Indonesia Tahun 2002 Nomor 73, Tambahan Lembaran Negara Republik Indonesia Nomor 4212) sebagaimana telah diubah dengan Keputusan Presiden No. 72 Tahun 2004 (Lembaran Negara Republik Indonesia Tahun 2004 Nomor 92, Tambahan Lembaran Negara Republik Indonesia Nomor 4418);

2. Daftar Isian Pelaksanaan Anggaran (DIPA) Tahun Anggaran 2013 Nomor: 018-06.1.238776 tanggal 5 Desember 2012

3. Pedoman Pelaksanaan Pengembangan Budidaya Kelinci tahun 2013

4. Keputusan Kepala Dinas….Prov/Kab/Kota Nomor…….tanggal……. 2012 tentang Penetapan Nama Kelompok dan lokasi Penerima Dana Pengembangan Budidaya Kelinci Tahun 2013.

Pasal 2LINGKUP PEKERJAAN

PIHAK PERTAMA menyerahkan kepada PIHAK KEDUA dan PIHAK KEDUA telah setuju untuk menerima dan memanfaatkan sarana produksi Pengembangan Budidaya Kelinci Tahun 2013 sebagaimana terlampir dan merupakan bagian yang tak terpisahkan dari Surat Perjanjian Kerjasama ini.

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 24

Pasal 3PELAKSANAAN KEGIATAN

1. PIHAK KEDUA bertanggung jawab atas pelaksanaan kegiatan dengan mengerahkan segala kemampuan, pengetahuan dan pengalamannya;

2. PIHAK PERTAMA berwenang mengadakan pemantauan, pengawasan dan evaluasi pelaksanaan kegiatan yang dilakukan oleh PIHAK KEDUA;

3. PIHAK KEDUA wajib menyampaikan laporan perkembangan pelaksanaan kegiatan pengembangan budidaya Kelinci kepada PIHAK PERTAMA, setiap bulan;

4. Dalam melaksanakan kegiatannya PIHAK KEDUA berkewajiban mengembangkan usahanya sesuai petunjuk pelaksanaan dan peraturan yang berlaku.

Pasal 4SANKSI

Apabila PIHAK KEDUA tidak dapat melaksanakan kegiatan dan pemanfaatan sarana produksi Pengembangan Budidaya Kelinci sebagaimana dimaksud dengan Pasal 2, maka PIHAK PERTAMA berhak mengalihkan sarana produksi yang diterima PIHAK KEDUA yang mengakibatkan Surat Perjanjian Kerjasama batal.

Pasal 5PERSELISIHAN

1. Apabila terjadi perselisihan antara PIHAK PERTAMA dan PIHAK KEDUA sehubungan dengan surat perjanjian kerjasama ini, maka akan diselesaikan secara musyawarah untuk memperoleh mufakat;

2. Apabila dengan cara musyawarah belum dapat dicapai suatu penyelesaian, maka kedua belah pihak sepakat untuk menyerahkan penyelesaiannya Kepada Pengadilan Negeri setempat, sesuai dengan peraturan perundangan yang berlaku;

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 25

3. Keputusan Pengadilan Negeri yang telah mempunyai kekuatan hukum adalah mengikat kedua belah pihak.

Pasal 6FORCE MAJEURE

1. Jika timbul keadaan memaksa (force majeure) yaitu hal-hal yang diluar kekuasaan PIHAK KEDUA sehingga mengakibatkan tertundanya pelaksanaan kegiatan, maka PIHAK KEDUA harus memberitahukan secara tertulis kepada kepada PIHAK PERTAMA dengan tembusan kepada Dinas……Kab/Kota……Provinsi…….dalam waktu 4 X 24 jam;

2. Keadaan memaksa (force majeure) yang dimaksud pasal 8 ayat (1) adalah :a. Bencana alam seperti gempa bumi, angin topan, banjir besar,

kebakaran yang bukan disebabkan kelalaian PIHAK KEDUA;b. Peperangan;c. Perubahan kebijakan moneter berdasarkan Peraturan Pemerintah.

Pasal 7LAIN-LAIN

1. Bea materai yang timbul akibat pembuatan surat perjanjian kerjasama ini menjadi beban PIHAK KEDUA;

2. Segala lampiran yang melengkapi surat perjanjian kerjasama ini merupakan bagian yang tak terpisahkan dan mempunyai kekuatan hukum yang sama;

3. Perubahan atas surat perjanjian kerjasama ini tidak berlaku kecuali terlebih dahulu telah mendapatkan persetujuan kedua belah pihak.

Pasal 8PENUTUP

Surat perjanjian kerjasama ini ditandatangani oleh kedua belah pihak dengan penuh kesadaran dan tanggungjawab tanpa adanya paksaan dari manapun

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 26

dan dibuat rangkap 2 (dua) yang kesemuanya mempunyai kekuatan hukum yang sama untuk digunakan sebagaimana mestinya.

PIHAK PERTAMAPejabat Pembuat KomitmenDinas.......Prop/Kab/Kota......

.........................................NIP...................................

PIHAK KEDUA Ketua Kelompok

..........................................

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 27

Lampiran -2

BERITA ACARA PENITIPAN BARANG

Pada hari ini ………..tanggal ………..bulan ……… tahun Dua Ribu Tiga Belas, bertempat ………………….. telah dilakukan penitipan barang ………………….. antara :

1. N a m a : ………………(Pimpinan Perusahaan Penyedia Barang)Jabatan : ........................Alamat : ………………………………………………………

Yang selanjutnya disebut PIHAK PERTAMA

2. N a m a : ……………………….Jabatan : Ketua Kelompok………………….Alamat : ……………………………………………………

Yang selanjutnya disebut PIHAK KEDUA

Dengan ini menyatakan bahwa PIHAK PERTAMA telah menyerahkan sarana produksi .........................................(rincian terlampir) sesuai dengan SPK No. …………. tanggal ………………………….. kepada PIHAK KEDUA dan PIHAK KEDUA telah menerima dari PIHAK PERTAMA sarana produksi dimaksud dengan baik.

Demikian berita acara penitipan barang ini dibuat untuk dapat dipergunakan sebagaimana mestinya.

PIHAK PERTAMA

………………………………(nama)Jabatan………………………….

PIHAK KEDUA

………………………………(nama).......................................(ketua klp)

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 28

Lampiran -3BERITA ACARA SERAH TERIMA BARANGNomor : ………………………………………..

Pekerjaan : Pengadaan Sarana Produksi....................................

Pada hari ini ………..tanggal ………..bulan ……… tahun Dua Ribu Tiga Belas, bertempat ………………….. telah dilakukan serah terima ………………….. antara :

1. N a m a : …………………… (Pimpinan Perusahaan penyedia barang)Jabatan : .............................Alamat : ………………………………………………………

Yang selanjutnya disebut PIHAK PERTAMA

2. N a m a : …………….....….....… (Pejabat Penerima Hasil Pekerjaan)Jabatan : …………………Alamat : ……………………………………………………

Yang selanjutnya disebut PIHAK KEDUADengan ini menyatakan bahwa PIHAK PERTAMA telah menyerahkan sarana produksi .........................................(rincian terlampir) sesuai dengan SPK No. …………. tanggal ………………………….. kepada PIHAK KEDUA dan PIHAK KEDUA telah menerima dari PIHAK PERTAMA sarana produksi dimaksud dengan baik.

Demikian berita acara serah terima pekerjaan ini dibuat untuk dapat dipergunakan sebagaimana mestinya.PIHAK PERTAMA

………………………………(nama)........................................(jabatan)

PIHAK KEDUA

………………………………(nama)NIP.................................................

Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 29

Lam

pira

n 4

Nam

a  Kelom

pok

:Kab/Ko

ta, Provinsi

:Lapo

ran Triwulan

 : I / II / III / IV

No.

Nam

a Anggota 

Kelompo

kAwal 

Lahir

Mati

Jual

Akhir

Pupu

k Organik

Prod

uk Olahan

12

34

56

78

910

11

LAP

OR

AN

KE

GIA

TAN

PE

NG

EM

BA

NG

AN

BU

DID

AY

A K

ELI

NC

I20

13

          Perkembangan

 Ternak (ekor)

Diversifikasi U

saha

Per

mas

alah

anKe

terangan

…………………………………………………., tgl………………………………

Pembina

 Teknis Ke

lompo

kKe

tua Ke

lompo

k

………………………………………………………………..

……………………………………………………………………………………

Em

ail :

bud

iday

ater

naku

ngga

s@ya

hoo.

co.id