of 35/35
DIREKTORAT BUDIDAYA TERNAK 2013 Hari Gini Masih apa kata K O R U P SI DUNIAAAAAAA W K B KEMENTERIAN PERTANIAN Informasi lebih lanjut hubungi DIREKTORAT BUDIDAYA TERNAK Kantor Pusat Kementerian Pertanian Gedung C Lantai 9 Wing A Jl. Harsono RM No. 3 Ps. Minggu - Jakarta Selatan Telp./Fax. : 021 - 7815782 Website : http;//www.ditjennak.go.id e-mail : [email protected] KEMENTERIAN PERTANIAN DIREKTORAT JENDERAL PETERNAKAN DAN KESEHATAN HEWAN PEDOMAN PELAKSANAAN PENGEMBANGAN BUDIDAYA KELINCI PEDOMAN PELAKSANAAN PENGEMBANGAN BUDIDAYA KELINCI

PEDUM KELINCI 2013

  • View
    32

  • Download
    6

Embed Size (px)

DESCRIPTION

kelinci

Text of PEDUM KELINCI 2013

  • DIREKTORAT BUDIDAYA TERNAK2013

    Hari Gini Masih

    apa kata

    K O R U P SI

    DUNIAAAAAAA

    W KBKEMENTERIAN PERTANIAN

    Informasi lebih lanjut hubungiDIREKTORAT BUDIDAYA TERNAK

    Kantor Pusat Kementerian Pertanian Gedung C Lantai 9 Wing AJl. Harsono RM No. 3 Ps. Minggu - Jakarta Selatan

    Telp./Fax. : 021 - 7815782 Website : http;//www.ditjennak.go.ide-mail : [email protected]

    KEMENTERIAN PERTANIAN

    DIREKTORAT JENDERAL PETERNAKAN

    DAN KESEHATAN HEWAN

    PEDOMAN PELAKSANAANPENGEMBANGAN

    BUDIDAYA KELINCI

    PEDOMAN PELAKSANAANPENGEMBANGAN

    BUDIDAYA KELINCI

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 i

    KEMENTERIAN PERTANIANDIREKTORAT JENDERAL PETERNAKAN

    DAN KESEHATAN HEWAN

    DIREKTORAT BUDIDAYA TERNAK2013

    PEDOMAN PELAKSANAANPENGEMBANGAN

    BUDIDAYA KELINCI

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 ii

    KATA PENGANTAR

    Pembangunan sub sektor peternakan sebagai bagian dari upaya-upaya operasionalisasi keberpihakan Pemerintah kepada masyarakat peternak diwujudkan dengan penerapan Program Pengembangan Aneka Ternak dan Monogastrik dalam rangka promosi substitusi daging melalui fasilitasi sarana produksi ternak bagi kelompok. Pada dasarnya penerapan pola ini adalah untuk memberdayakan petani peternak.

    Pengembangan Budidaya Kelinci merupakan salah satu upaya yang dilakukan pemerintah dalam mengembangkan usaha peternakan kelinci yang memiliki nilai potensial sebagai penghasil daging yang sehat dan aman. Program ini disamping dapat meningkatkan produksi dan populasi kelinci, juga diharapkan dapat mengatasi kerawanan gizi pada masyarakat dan meningkatkan pendapatan dan kesejahteraan peternak kelinci.

    Pedoman Pelaksanaan ini merupakan acuan kegiatan guna mendukung kelancaran operasionalisasi di daerah. Hal ini penting dicermati agar tujuan dan sasaran pengembangan kelinci dapat tercapai. Oleh karena itu diperlukan optimalisasi peran pendamping dari daerah termasuk kompetensi dan dedikasi para pendamping agar masyarakat dilokasi kegiatan dapat menerima manfaat dari adanya fasilitasi pemerintah.

    Jakarta, 14 Januari 2013

    Direktur Jenderal Peternakan

    dan Kesehatan Hewan

    Ir. Syukur Iwantoro MS, MBA

    NIP. 19590530 198403 1 001

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 iii

    DAFTAR ISI

    KATA PENGANTAR ................................................................................. ii DAFTAR ISI .............................................................................................. iiiDAFTAR TABEL ...................................................................................... ivDAFTAR LAMPIRAN ............................................................................... vI. PENDAHULUAN ............................................................................ 1 A. Latar Belakang ......................................................................... 1 B. Tujuan dan Sasaran ................................................................ 2 C. Ruang Lingkup ......................................................................... 2 D. Dasar Pelaksanaan Kegiatan .................................................. 2 E. Jadwal Pelaksanaan ................................................................ 3 F. Pengertian ............................................................................... 3

    II. ORGANISASI PELAKSANA ......................................................... 5 A. Direktorat Jenderal Peternakan dan Kesehatan Hewan .......... 5 B. Dinas Peternakan dan Kesehatan Hewan Provinsi ................ 5 C. Dinas Peternakan dan Kesehatan Kab./Kota .......................... 6 D. Kelompok ................................................................................. 7 III. PELAKSANAAN ............................................................................ 8 A. Sosialisasi ............................................................................... 8 B Seleksi ..................................................................................... 8 1. Kriteria Lokasi ...................................................................... 8 2. Kriteria Kelompok ................................................................ 9 3.Seleksi,VerifikasidanPenetapanKelompok ...................... 9 C. Pengembangan Budidaya Babi Ramah Lingkungan ............... 10

    IV. PENGADAAN SARANA PRODUKSI ............................................ 12 A. Sarana Produksi Pengembangan Kelinci ................................ 12 B. Proses Pengadaan .................................................................. 13 C. Serah Terima/Distribusi Sapronak ........................................... 15

    V. PEMBINAAN .................................................................................. 16VI. INDIKATOR KEBERHASILAN ...................................................... 17 VII. MONITORING DAN EVALUASI .................................................... 19 A. Monitoring dan Evaluasi .......................................................... 19 B. Pelaporan ................................................................................ 20

    VIII. PENUTUP ...................................................................................... 21IX. LAMPIRAN .................................................................................... 22

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 iv

    DAFTAR TABEL

    Halaman

    Tabel 1 Jadwal pelaksanaan kegiatan .............................................. 3

    Tabel 2 Proporsi penggunaan dana Pengembangan Budidaya Kelinci .................................................................................. 12

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 v

    DAFTAR LAMPIRANHalaman

    Lampiran 1 Surat Perjanjian Kerjasama ......................................... 22 Lampiran 2 Berita Acara Penitipan Barang ..................................... 27 Lampiran 3 Berita Acara Serah Terima Barang ............................... 28Lampiran 4 Laporan Perkembangan Kegiatan ............................... 29

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 1

    BAB IPENDAHULUAN

    A. Latar BelakangPembangunan peternakan merupakan bagian dari suatu totalitas kinerja agribisnis, khususnya sub sistem usaha tani ternak dengan keluaran berupa produksi primer ternak. Subsistem ini akan menjadi suatu kesatuan kinerja yang tidak terpisahkan dari subsistem agribisnis hulu (kegiatan ekonomi input, produksi peternakan, informasi, dan teknologi) dan subsistem agribisnis hilir (perdagangan, pengolahan, dan jasa agribisnis).

    Usaha agribisnis berbasis peternakan pada dasarnya secara operasional memerlukan keterkaitan lintas sub sektor maupun dengan sektor lainnya sehingga diperoleh sinergi yang proporsional antara pelaku agribisnis peternakan baik pada segmen hulu, budidaya dan hilir.

    Dalam rangka mendukung program pengembangan agribisnis peternakan, komoditi kelinci khususnya dalam hal diversifikasipemenuhan protein hewani mempunyai peran penting sebagai alternatif sumber penyediaan daging disamping juga sebagai hewan kesayangan. Usaha budidaya ternak kelinci dapat meningkatkan pendapatan peternak karena kelinci merupakan ternak yang tumbuh dan ber reproduksi cepat (bersifatprolific)sertadapatmeningkatkannilaitambahdenganadanyapengolahan hasil, sehingga pada sisi lain dapat menyerap tenaga kerja yang membantu dan membina pengembangan wilayah di pedesaan.

    Dengan maraknya wabah Flu Burung terhadap ternak unggas, salah satu alternatif pengganti unggas adalah melalui pengembangan ternak kelinci di pedesaan guna peningkatan gizi masyarakat, peningkatan pendapatan serta sumber pakan dapat memanfaatkan limbah tanaman hortikultura (wortel, labu, ketimun, kentang, kangkung dll) serta kotoran

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 2

    dan urinenya dapat dimanfaatkan sebagai pupuk kandang untuk lahan tanaman sayur-sayuran.

    Selanjutnya, dalam upaya memfasilitasi pelaksanaan pengembangan budidaya non unggas (aneka ternak) khususnya pengembangan usaha budidaya kelinci, Direktorat Budidaya Ternak pada tahun 2013 perlu melaksanakan kegiatan Pengembangan Budidaya Kelinci.

    B. Tujuan

    1. Tujuan pemberdayaan kelompok peternak kelinci antara lain untuk : a. Meningkatkan populasi, produksi dan produktivitas serta

    pendapatan peternak secara berkelanjutan;b. Meningkatkan kemandirian dan kerjasama kelompok.

    2. Sasaran kegiatan, antara lain :a. Meningkatnya populasi dan produksi ternak kelinci;b. Meningkatnya kemampuan kelompok peternak secara manajerial

    dan teknis dalam mengembangkan usaha kelompoknya;c. Meningkatnya kemandirian dan kerjasama kelompok.

    C. Ruang Lingkup

    Ruang lingkup Petunjuk pelaksanaan pengembangan budidaya kelinci ini meliputi : Organisasi Pelaksana, Pelaksanaan kegiatan, Pengadaan sarana produksi, Pembinaan, Indikator keberhasilan, Monitoring, Evaluasi dan Pelaporan.

    D. Dasar Pelaksanaan

    a. Renstra Direktorat Jenderal Peternakan dan Kesehatan Hewan Tahun 2011 2014.

    b. Daftar Isian Pelaksanaan Anggaran Satuan Kerja Direktorat Jenderal Peternakan Kementerian Pertanian Tahun 2013.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 3

    E. Jadwal Pelaksanaan

    Pelaksanaan kegiatan Pengembangan Budidaya Kelinci Tahun 2013, sebagai berikut:

    Tabel -1: Jadwal pelaksanaan kegiatan

    NO KEGIATAN BULANJ F M A M J J A S O N D

    1 Persiapan

    2Koordinasi dan Sosialisai

    3 Pelaksanaan CP/CL

    4Penetapan Kelompok Terpilih

    5 Pengadaan Barang

    6Monitoring dan Pembinaan

    7 Pelaporan

    F. Pengertian

    Dalam pedoman ini yang dimaksud dengan:a. Pakan : Adalah campuran dari beberapa bahan pakan, baik yang sudah

    maupun yang masih akan dilengkapi, yang disusun secara khusus untuk dapat dipergunakan sesuai dengan jenis dan umur ternak.

    b. Kelompok Usaha : Adalah kumpulan beberapa orang yang mempunyai usaha sejenis

    untuk mencapai tujuan yang sama.c. Pemberdayaan : Adalah suatu proses dimana masyarakat, khususnya mereka yang

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 4

    kurang memiliki akses kepada sumberdaya pembangunan, didorong untuk menjadi mandiri melalui usaha-usaha yang dilakukan sendiri dengan potensi dan kemampuan sendiri dan difasilitasi pihak luar untuk menciptakan kondisi yang kondusif.

    d. Pendampingan : Adalah salah satu bentuk fasilitasi Pemerintah atau pihak lain

    kepada masyarakat dalam menjalankan usaha budidaya yang lebih baik (better farming) untuk meningkatkan taraf kehidupannya (better living).

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 5

    BAB IIORGANISASI PELAKSANA

    Untuk kelancaran pelaksanaan kegiatan fasilitasi dan pemberdayaan kelompok dengan komoditi yang dikembangkan ternak kelinci, dibentuk Tim Pelaksana baik di Direktorat Jenderal Peternakan dan Kesehatan Hewan Kementerian Pertanian maupun di masing-masing Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi dan Kabupaten/Kota, dengan tugas dan peran masing-masing sebagai berikut:

    A. Direktorat Jenderal Peternakan dan Kesehatan HewanTugas dan Peran sebagai berikut:1. Menyusun Pedoman Pelaksanaan pengembangan budidaya kelinci;2. Melakukan koordinasi dan sosialisasi dengan Pemerintah Propinsi

    dan Kabupaten/Kota dalam rangka efisiensi dan efektivitaspelaksanaan kegiatan.

    3. Melakukan pembinaan, monitoring dan evaluasi serta membantu menyelesaikan permasalahan yang tidak mampu diselesaikan oleh Dinas yang membidangi fungsi peternakan dan kesehatan hewan Provinsi

    4. Melaporkan kinerja pelaksanaan kegiatan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan.

    B. Dinas Membidangi Peternakan dan Kesehatan Hewan Propinsi

    Tugas dan peran sebagai berikut:1. Pedoman Pelaksanaan kegiatan Pengembangan Budidaya Kelinci

    selanjutnya dapat dijabarkan kedalam petunjuk peleksanaan untuk mengakomodir aspek-aspek di daerah.

    2. Melakukan koordinasi dan sosialisasi dengan Kabupaten/Kota dalamrangkaefisiensidanefektivitaspelaksanaankegiatandengan instansi terkait di tingkat Provinsi dan Kabupaten/Kota;

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 6

    3. Melaksanakanverifikasikelompoksasaran;4. Menetapkan kelompok pelaksana kegiatan melalui SK Kepala

    Dinas; 5. Menetapkan kriteria/persyaratan teknis ;6. Membentuk tim pembina kegiatan, tim pegadaan dan tim penerima

    barang7. Melakukan pembinaan, monitoring dan evaluasi serta membantu

    menyelesaikan permasalahan yang tidak mampu diselesaikan oleh Dinas yang membidangi fungsi peternakan dan kesehatan hewan Kabupaten/Kota;

    8. Menyampaikan laporan perkembangan pelaksanaan kegiatan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan.

    C. Dinas Membidangi Peternakan Kabupaten/KotaTugas dan peran sebagai berikut :1. Memberikan rekomendasi terhadap usulan kelompok ternak calon

    pelaksana kegiatan pengembangan kelinci ; 2. Melakukan seleksi kelompok sasaran (CP/CL) ;3. Mengusulkan calon kelompok ternak pelaksana kegiatan

    pengembangan kelinci kepada Dinas Provinsi4. Melakukan pembinaan dan bimbingan kepada kelompok agar dapat

    menjalankan usaha agribisnis peternakan kelinci dengan mengacu pada Good Farming Practices (GFP).

    5. Melakukan monitoring dan evaluasi serta membantu menyelesaikan permasalahan yang timbul di lapangan;

    6. Melaporkan perkembangan kegiatan kepada Dinas yang membidangi fungsi peternakan dan kesehatan hewan Provinsi dengan tembusan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan cq. Direktur Budidaya Ternak

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 7

    D. KelompokTugas dan peran sebagai berikut:1. Mengajukan proposal permohonan kegiatan pengembangan kelinci

    kepada Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi melalui Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota;

    2. Melaksanakan kegiatan pengembagan kelinci sesuai dengan pedoman

    3. Mengelola dan memanfaatkan sarana produksi untuk pengembangan kelinci;

    4. Melaksanakan usaha budidaya ternak kelinci dengan mengacu pada good farming practices (GFP);

    5. Meningkatkan kapasitas usaha dan kelembagaan kelompok melalui peningkatan populasi ternak kelinci;

    6. Menerima saran/rekomendasi teknis, kewirausahaan dan manajemen usaha dari petugas pendamping, Penyuluh Pertanian, Tim Teknis Dinas yang membidangi fungsi Peternakan Kabupaten Kota, BPTP, Perguruan Tinggi dan pihak yang berkompeten lainnya

    7. Melakukan pencatatan perkembangan usaha budidaya kelinci8. Melaporkan perkembangan pelaksanaan kegiatan budidaya kelinci

    secara berkala kepada Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 8

    BAB IIIPELAKSANAAN

    Pelaksanaan kegiatan Pengembangan kelinci sebagai berikut :

    A. Sosialisasi

    Sosialisasi kegiatan pengembangan budidaya kelinci dilakukan dengan tujuanuntukmeningkatkanpopulasi,produksidanproduktifitas ternakkelinci sehingga meningkatkan minat dan motivasi kelompok dalam pengembangan usaha termasuk sanksi bagi pihak yang melanggar ketentuan dan aturan yang berlaku.

    Kegiatan sosialisasi dilaksanakan oleh Tim pembina di tingkat Pusat dan Provinsi serta Tim Teknis Kabupaten/Kota.

    B. Seleksi

    Kelompok Tani Ternak yang mengajukan proposal dan mendapat rekomendasi dari kepala dinas yang membidangi fungsi peternakan dan kesehatan hewan kabupaten/kota dan memenuhi persyaratan lokasi dan kelompok dapat diproses untuk mengikuti seleksi.

    1. Kriteria Lokasi a. Kondisi agroekosistem, sesuai untuk pengembangan ternak

    kelinci; b. Merupakan lokasi yang diarahkan untuk pengembangan sentra

    produksi ternak kelinci;c. Mempunyai potensi untuk dikembangkan, dilihat dari aspek

    teknis, sosial dan ekonomi masyarakat setempat ;

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 9

    2. Kriteria Kelompok a. Kelompok telah terdaftar dan merupakan binaan dari Dinas

    yang membidangi fungsi peternakan dan kesehatan hewan di Kabupaten/Kota;

    b. Kelompok telah mengembangkan usaha budidaya ternak kelinci atau kelompok baru yang memiliki sumber daya alam (SDA) maupun sumber daya manusia (SDM) untuk pengembangan usaha budidaya ternak kelinci. Khusus untuk kelompok baru harus sudah menyiapkan kandang;

    c. Mempunyai lahan/sarana untuk pengembangan usaha budidaya ternak kelinci;

    d. Mempunyai struktur organisasi yang jelas (Identitas kelompok, pengurus dan anggota);

    e. Pengurus kelompok bukan berasal dari kerabat dekat terutama Ketua kelompok dan bendahara;

    f. Pengurus dan anggota kelompok profesinya adalah petani peternak;

    g. Mempunyai kelengkapan administrasi kelompok;h. Bersedia mengikuti aturan dan bimbingan yang ditetapkan

    oleh Tim Teknis/Dinas yang membidangi fungsi peternakan Kabupaten/Kota;

    i. Membuat proposal usaha pengembangan budidaya kelinci dan direkomendasi oleh Kepala Dinas Peternakan/Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota.

    3.Seleksi,VerifikasidanPenetapanKelompoka. Berdasarkan proposal yang masuk dari kelompok ke Kabupaten/

    Kota selanjutnya dilakukan seleksi melalui CP/CL oleh tim teknis Kabupaten/Kota. Hasil seleksi CP/CL direkomendasikan oleh kepala dinas yang membidangi fungsi peternakan dan kesehatan hewan Kabupaten/Kota ke Provinsi sebagai usulan

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 10

    calon kelompok pelaksana kegiatan pengembangan kelinci.b. Berdasarkan usulan dari Kabupaten/Kota selanjutnya dinas

    provinsimelakukanpenilaiandandilakukanverifikasi.c. Hasilverifikasilapanganolehtimpropinsiselanjutnyadiusulkan

    kepada Kepala Dinas Provinsi untuk ditetapkan sebagai kelompok pelaksana kegiatan;

    d. Penetapan kelompok dituangkan dalam Surat Keputusan Kepala Dinas yang membidangi fungsi peternakan dan kesehatan hewan Provinsi sebagai kelompok pelaksana kegiatan pengembangan kelinci tahun 2013.

    C. Pengembangan Budidaya kelinci

    Pengembangan budidaya kelinci yang dilaksanakan oleh kelompok-kelompok peternak diarahkan untuk menjadi unit usaha dalam rangka meningkatkan kesejahteraan peternak, disamping menumbuhkan dan memperkuat sentra-sentra kelinci. Sejalan dengan tujuan kegiatan pengembangan budidaya kelinci dilakukan dalam bentuk usaha budidaya yang produktif seperti pembesaran untuk menghasilkan produksi daging. Disamping itu kelompok juga harus mulai mempersiapkan sumber input khususnya ternak yaitu dengan melakukan pengembangbiakan kelinci yang berkualitas seperti kelinci Flamish Giant, New Zealand, Rex, Sati, Dutch dll.

    Untuk mengembangkan usaha budidaya produktif baik untuk menghasilkan daging fasilitasi yang di berikan dapat berupa pengadaan ternak bibit atau pengadaan anakan lepas sapih untuk pembesaran, pakan ternak, vaksin dan obat-obatan, bahan dan peralatan biosekuriti.

    Usaha pengembangbiakan dalam rangka meningkatkan populasi ternak milik kelompok dan menjadikan kelompok mandiri dari ketergantungan kepada pihak lain dalam pengadaan ternak disamping itu kegiatan ini

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 11

    nantinya akan menghasilkan replacement stock ternak kelinci unggul berkualitas. Untuk itu fasilitasi ternak harus benar-benar ternak kelinci unggul dalam bentuk bibit atau anakan lepas sapih disamping pakan ternak, vaksin dan obat-obatan, bahan dan peralatan biosekuriti. Rincian alokasi penggunaan dana dapat dilihat pada tabel 2.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 12

    BAB IVPENGADAAN SARANA PRODUKSI

    Pada tahun 2013 Direktorat Jenderal Peternakan dan Kesehatan Hewan mengalokasikan kegiatan melalui APBN untuk pengembangan budidaya kelinci . Anggaran Tersebut dialokasikan melalui dana dekonsentrasi di dinas yang melaksanakan fungsi peternakan ditingkat Provinsi.

    A. Sarana Produksi Pengembangan Kelinci

    Dalam rangka memperkuat pengembangan usaha budidaya kelinci dilakukan melalui penguatan sarana usaha yang meliputi pengadaan ternak kelinci, bantuan sarana perbaikan kandang, peralatan kandang, pengadaan pakan, vaksin dan obat-obatan, bahan dan peralatan biosekuriti

    Tabel 2: Proporsi penggunaan dana pengembangan budidaya ternak kelinci

    No. Komponen Kegiatan Proporsi (%)

    1 2 3

    1 Pengadaan Ternak 55

    2 Pengadaan Peralatan Kandang 15

    3 Pengadaan Pakan Konsentrat 20

    4 Pengadaan Vaksin dan obat-obatan10

    5 Pengadaan Bahan dan Peralatan Biosekuriti

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 13

    B. Proses Pengadaan

    Proses pengadaan sarana produksi tersebut dilakukan melalui proses lelang yang mengacu kepada Peraturan Presiden no. 70 tahun 2012. Tahapan proses pengadaan meliputi :

    1. Persiapan Agar proses kegiatan berjalan dengan lancar,efektif dan efisien

    pengadaan harus direncanakan dengan matang. Rencana pengadaan sarana produksi ini dituangkan dalam kerangka acuan kegiatan (KAK) yang di susun oleh tim teknis. Di dalam KAK di jelaskan tentang tujuan kegiatan, sasaran kegiatan, waktu pelaksanaan, sfesifikasi teknis Barang, besarnya total perkiraanbiaya pekerjaan.

    2. Pembentukan Tim Pengadaan Mengacu kepada Peraturan Presiden No. 70 Tahun 2012 bahwa

    pengadaan barang dilaksanakan oleh tim yang di bentuk oleh pimpinan unit organisasi (KPA). Dalam proses pengadaan barang yang harus dibentuk meliputi : tim pengadaan dan tim penerima hasil pekerjaan/barang.a. Tim pengadaan. Pembentukkan tim pengadaan barang terdiri dari 3-5 orang

    yang memenuhi persyaratan yaitu sudah memiliki sertifikatpengadaan barang dan jasa.

    Tugas pokok dan kewenangan Kelompok Kerja ULP/Pejabat Pengadaan meliputi:1) Menyusun rencana pemilihan penyedia barang;2) Menetapkan Dokumen pengadaan;3) Menetapkan besaran nominal jaminan penawaran;4) Mengumumkan pelaksanaan pengadaan barang di

    website Kementerian / Lembaga / Pemerintah Daerah/

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 14

    Institusi masing-masing dan papan pengumuman resmi untuk masyarakat serta menyampaikan ke LPSE untuk diumumkan dalam Portal Pengadaan Nasional;

    5) Menilai kualifikasi penyedia barang melalui prakualifikasiataupascakualifikasi;

    6) Melakukan evaluasi administrasi, teknis dan harga terhadap penawaran yang masuk.

    b. Tim Penerima Hasil Pekerjaan Pembentukkan tim disesuaikan dengan kebutuhan dan volume

    pekerjaan dengan diutamakan petugas yang menangani penata usaha barang disamping unsur teknis.

    Tugas tim penerima barang 1) Melakukan pemeriksaan hasil pekerjaan pengadaan barang

    sesuai dengan ketentuan yang tercantum dalam kontrak;2) Menerima hasil pengadaan barang setelah melalui

    pemeriksaan/pengujian;3) Membuat dan menandatangani Berita Acara Serah Terima

    Hasil Pekerjaan.

    3. Proses Pengadaan Proses pangadaan barang dilakukan melalui sistem pengadaan

    secara elektronik (LPSE)/e-procurement. Tahapan pengadaan barang berdasarkan sistem LPSE sebagai

    berikut:a. Penyusunan Rencana Kerja dan Syarat (RKS)b. Pengumuman lelangc. Pemasukkan dokumen penawarand. Evaluasi dan penilaian dokumene. Penetapan dan pengumuman pemenang

    Dalam proses pengadaan, khsususnya untuk pengadaan pakan konsentrat yang relatif mudah berubah kualitasnya jika disimpan

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 15

    terlalu lama, maka perlu direncanakan dengan baik jadwal waktu pengadaannya disesuaikan dengan kebutuhan agar tetap diperoleh kualitas pakan konsentrat yang tetap terjaga kualitasnya.

    C. Serah Terima/Distribusi Sapronak

    Pemberdayaan terhadap kelompok peternak terpilih dilakukan melalui fasilitasi dalam bentuk natura (sarana produksi peternakan) yang diserahkan kepada kelompok untuk selanjutnya dikembangkan. Sarana produksi sebelum diserahkan kepada kelompok harus sudah diterima oleh tim penerima sesuai dengan spesifikasi yang dibuktikan dalamBerita Acara Serah Terima (BAST).

    Penyerahan barang dalam rangka pengembangan ternak kelinci dilakukan oleh PPK atas nama pemerintah kepada kelompok peternak terpilih sebagai pelaksana kegiatan yang dituangkan dalam bentuk Surat Perjanjian Kerjasama (SPK). Di dalam SPK di jelaskan tentang : para pihak yang melakukan perjanjian, waktu dan tempat, dasar pelaksanaan, lingkup pekerjaan, pelaksanaan kegiatan, jumlah dan jenis barang, pengembangan usaha, sanksi, perselisihan, force major, dan lain-lain.Setelah penyerahan barang/sarana produksi peternakan, dalam waktu sesegera mungkin atau selambat-lambatnya 6 (enam) bukan sejak BAST harus dilakukan penghibahan dari Dinas Provinsi kepada kelompok penerima bantuan sesuai dengan peraturan perundangan yang berlaku.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 16

    BAB VPEMBINAAN

    Pembinaan bertujuan untuk meningkatkan populasi, produksi dan produktivitas ternak kelinci. Pembinaan teknis meliputi pengembangan budidaya ternak kelinci yang dapat dilakukan dalam bentuk usaha pembesaran, pengembangbiakan, atau kombinasi diantaranya, dan dapat dikembangkan sebagai usaha khusus maupun terintegrasi dengan usaha subsektor/ sektor lain.

    Untuk meningkatkan efisiensi dan efektifitas kegiatan dapat dilakukankerjasama dengan peternak maju, baik dalam hal pengadaan, tatalaksana, maupun pemasaran.

    Pembinaan usaha oleh pemerintah difokuskan kepada pengembangan usaha budidaya ternak kelinci. Jenis-jenis usaha yang dikembangkan oleh kelompok peternak budidaya ternak kelinci searah dengan program pengembangan sentra usaha peternakan yang telah ditetapkan.

    Pengembangan usaha budidaya ternak kelinci di daerah akan berhasil secara optimal apabila pemerintah daerah, swasta dan masyarakat memberikan dukungan sepenuhnya. Pemerintah daerah harus mampu membuka peluang usaha bagi masyarakat peternakan melalui peraturan dan kebijakan daerah, penyediaan sarana dan prasarana pendukung seperti jalan, saluran irigasi, pasar, listrik, serta alokasi dana yang memadai bagi kegiatan pendampingan kelompok. Kegiatan pendampingan harus dilakukan secara berkelanjutan. Disamping itu pemerintah daerah juga bertanggung jawab dalam pembinaan lanjutan bagi kelompok peternak sasaran dalam bentuk supervisi, pemantauan, evaluasi dan pelaporan.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 17

    BAB VI INDIKATOR KEBERHASILAN

    Evaluasi keberhasilan terhadap implementasi kegiatan perlu dilakukan sebagai umpan balik penyempurnaan kegiatan dan akuntabilitas publik. Penilaian kegiatan ini dapat dilihat dari beberapa aspek, antara lain :

    1. Aspek teknisa. Optimalisasi pemanfaatan sumberdaya alam sekitar lokasi

    kelompok, seperti: bibit ternak, limbah tanaman untuk pakan ternak, bahan pakan lokal;

    b. Rekayasa teknologi produksi yang diaplikasikan secara efektif dan efisienseperti:IB,obat-obatan,alatdanmesindsb;

    c. Perkembangan jumlah populasi dan kepemilikan ternak;d. Peningkatan produksi dan produktivitas ternak melalui peningkatan

    populasi dan berkurangnya resiko kematian terhadap populasi ternak di kelompok tersebut.

    2. Aspek Kelembagaana. Perkembangan jumlah anggota atau kelompok yang menerima

    manfaat;b. Perkembangan partisipasi kelompok/anggota dalam pengambilan

    keputusan;c. Mengakomodasi aspirasi anggota kelompok serta masyarakat

    sekitarnya;d. Meningkatnya kerjasama dengan stakeholder, seperti dalam

    pengadaan pakan dan lain-lain;e. Tidak ada lagi pendampingan secara rutin dari pemeritah (kelompok

    mandiri);f. Mengukuhkan dan memperkuat sistem dan usaha kelompok.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 18

    3. Aspek Usahaa. Perkembangan permodalan kelompok, baik interal (dari usaha yang

    dilakukan oleh kelompok itu sendiri); b. Kemampuan kelompok untuk mengakses sumber pembiayaan

    modal usaha maupun dari sumber eksternal (perbankan, investasi masyarakat dan kemitraan, dll);

    c. Meningkatnya kapasitas usaha dan peran masyarakat di sekitar kelompok dalam mengembangkan usaha, memanfaatkan peluang usaha, seperti usaha jasa, usaha pupuk kandang, usaha simpan pinjam, dsb;

    d. Meningkatnya keterlibatan kelompok/anggota dalam menanggulangi resiko usaha;

    e. Kelompok mampu melakukan analisa, merencanakan dan memonitor sendiri kegiatan-kegiatan yang dilakukannya;

    f. Perkembangan peningkatan pendapatan anggota kelompok;g. Perkembangan usaha dan peningkatan skala usaha kepemilikan

    ternak;h. Perkembangan usaha agribisnis masyarakat di sekitar kelompok

    tersebut.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 19

    BAB VIIMONITORING, EVALUASI DAN PELAPORAN

    A. Monitoring dan Evaluasi

    Monitoring dan evaluasi pelaksanaan kegiatan pengembangan budidaya kelinci melalui penguatan sarana usaha, dimaksudkan untuk mengetahui secaraakuratrealisasifisikdankeuangan,sertaperkembanganusahadan kelembagaannya, serta mengetahui kendala yang dihadapi dalam pelaksanaan kegiatan penguatan sarana usaha, mulai dari pusat, provinsi, kabupaten/kota dan kelompok.

    Monitoring dan Evaluasi dilakukan secara berkala dan berjenjang sesuai dengan tahapan pelaksanaan kegiatan, dengan tujuan untuk mengidentifikasidanmemberikansolusipemecahanpermasalahanyangdihadapi pada masing-masing jenjang (pusat, provinsi, kabupaten/kota dan kelompok)

    Monitoring dan evaluasi dilakukan secara terkoordinasi oleh Direktorat Jenderal Peternakan dan Kesehatan Hewan, Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Propinsi dan Kabupaten/Kota untuk memantau perkembangan pelaksanaan kegiatan. Sasaran pembinaan, monitoring dan evaluasi yang dilakukan secara berjenjang tersebut meliputi :

    1. Kemajuan pelaksanaan kegiatan sesuai indikator kinerja 2. Permasalahan/potensi masalah yang dihadapi di tingkat kelompok,

    kabupaten/kota dan provinsi.3. Memberikan solusi dan pemecahan masalah dalam pelaksanaan

    kegiatan pengembangan budidaya kelinci

    Hasil monitoring dan evaluasi diformulasikan dalam bentuk laporan, merupakan data dan informasi untuk bahan koreksi pelaksanaan kegiatan,

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 20

    dan untuk perbaikan sistem pelaksanaan fasilitasi dan pemberdayaan kelompok di masa yang akan datang.

    B. Pelaporan

    Pelaporan sangat diperlukan untuk mengetahui kemajuan pengembangan kinerja usaha kelompok di lapangan. Untuk itu perlu ditetapkan mekanisme sistem pelaporan sebagai berikut :

    1. Kelompok wajib melaporkan perkembangan pelaksanaan kegiatan setiap bulan kepada Dinas yang membidangi fungsi peternakan Kabupaten/Kota dengan tembusan kepada Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi;

    2. Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Kabupaten/Kota melakukan rekapitulasi seluruh laporan perkembangan yang diterima dari kelompok pelaksana kegiatan untuk disampaikan ke Dinas yang membidangi fungsi Peternakan dan Kesehatan Hewan Provinsi setiap bulan dengan ditembuskan ke Direktur Jenderal Peternakan dan Kesehatan Hewan cq. Direktur Budidaya Ternak;

    3. Dinas yang membidangi fungsi peternakan Propinsi melakukan rekapitulasi seluruh laporan perkembangan yang diterima dari Kabupaten/Kota dan selanjutnya setiap triwulan menyampaikan kepada Direktur Jenderal Peternakan dan Kesehatan Hewan cq. Direktur Budidaya Ternak.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 21

    BAB VIIIPENUTUP

    Pedoman Pelaksanaan Pengembangan Budidaya ternak kelinci disusun untuk dipedomani oleh pelaksana baik ditingkat pusat maupun daerah dalam rangka mendukung kelancaran pelaksanaan di lapangan. Petunjuk pelaksana ini dapat di jabarkan lebih lanjut dalam bentuk petunjuk teknis oleh dinas provinsi.

    Diharapkan dengan adanya Pedoman pelaksanaan ini, semua pelaksana kegiatan di tingkat pusat, provinsi, kabupaten/kota, kelompok pelaksana serta stakeholder terkait dapat melaksanakan seluruh tahapan kegiatan secara baik dan benar menuju tercapainya sasaran yang telah ditetapkan dengan mengacu pada ketentuan-ketentuan yang berlaku.

    DIREKTORAT JENDERAL PETERNAKAN DAN KESEHATAN HEWAN

    LENOVOHighlightpelaksanaan

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 22

    Lampiran - 1

    SURAT PERJANJIAN KERJASAMANOMOR : ....................................

    ANTARA

    PEJABAT PEMBUAT KOMITMENDINAS........ PROVINSI/KAB/KOTA

    DENGAN

    KELOMPOK TANI TERNAK ............................DESA ....................., KECAMATAN ..................., KABUPATEN ..................

    PROVINSI .......................................................................

    TENTANG

    PENGEMBANGAN BUDIDAYA KELINCI TAHUN 2013

    Pada hari ini ............... tanggal ................. bulan ..................... tahun dua ribu tiga belas bertempat di Kantor Dinas....Prov/Kab/Kota, Jalan ..........No. Prov...Kab/Kota...... kami yang bertanda tangan di bawah ini :

    1. ...................... : Pejabat Pembuat Komitmen Dinas ......Prov/Kab/kota berdasarkan Keputusan No.................yang berkedudukan di Jalan ........... yang untuk selanjutnya disebut sebagai PIHAK PERTAMA.

    2. : Ketua Kelompok Tani Ternak..dalam hal ini bertindak untuk dan atas nama Kelompok Ternak.yang berkedudukan di Desa/KelKecamatanKabupaten/ Kota Provinsi...yang selanjutnya disebut sebagai PIHAK KEDUA.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 23

    Kedua belah pihak sepakat untuk mengadakan Perjanjian Kerjasama yang mengikat dan berakibat hukum bagi kedua belah pihak untuk melaksanakan Pengembangan Budidaya Kelinci Tahun 2013 kepada Kelompok, dengan ketentuan sebagai berikut :

    Pasal 1DASAR PELAKSANAAN

    1. Keputusan Presiden No. 42 Tahun 2002, tentang Pedoman Pelaksanaan Anggaran Pendapatan dan Belanja Negara (Lembaran Negara Republik Indonesia Tahun 2002 Nomor 73, Tambahan Lembaran Negara Republik Indonesia Nomor 4212) sebagaimana telah diubah dengan Keputusan Presiden No. 72 Tahun 2004 (Lembaran Negara Republik Indonesia Tahun 2004 Nomor 92, Tambahan Lembaran Negara Republik Indonesia Nomor 4418);

    2. Daftar Isian Pelaksanaan Anggaran (DIPA) Tahun Anggaran 2013 Nomor: 018-06.1.238776 tanggal 5 Desember 2012

    3. Pedoman Pelaksanaan Pengembangan Budidaya Kelinci tahun 2013

    4. Keputusan Kepala Dinas.Prov/Kab/Kota Nomor.tanggal. 2012 tentang Penetapan Nama Kelompok dan lokasi Penerima Dana Pengembangan Budidaya Kelinci Tahun 2013.

    Pasal 2LINGKUP PEKERJAAN

    PIHAK PERTAMA menyerahkan kepada PIHAK KEDUA dan PIHAK KEDUA telah setuju untuk menerima dan memanfaatkan sarana produksi Pengembangan Budidaya Kelinci Tahun 2013 sebagaimana terlampir dan merupakan bagian yang tak terpisahkan dari Surat Perjanjian Kerjasama ini.

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 24

    Pasal 3PELAKSANAAN KEGIATAN

    1. PIHAK KEDUA bertanggung jawab atas pelaksanaan kegiatan dengan mengerahkan segala kemampuan, pengetahuan dan pengalamannya;

    2. PIHAK PERTAMA berwenang mengadakan pemantauan, pengawasan dan evaluasi pelaksanaan kegiatan yang dilakukan oleh PIHAK KEDUA;

    3. PIHAK KEDUA wajib menyampaikan laporan perkembangan pelaksanaan kegiatan pengembangan budidaya Kelinci kepada PIHAK PERTAMA, setiap bulan;

    4. Dalam melaksanakan kegiatannya PIHAK KEDUA berkewajiban mengembangkan usahanya sesuai petunjuk pelaksanaan dan peraturan yang berlaku.

    Pasal 4SANKSI

    Apabila PIHAK KEDUA tidak dapat melaksanakan kegiatan dan pemanfaatan sarana produksi Pengembangan Budidaya Kelinci sebagaimana dimaksud dengan Pasal 2, maka PIHAK PERTAMA berhak mengalihkan sarana produksi yang diterima PIHAK KEDUA yang mengakibatkan Surat Perjanjian Kerjasama batal.

    Pasal 5PERSELISIHAN

    1. Apabila terjadi perselisihan antara PIHAK PERTAMA dan PIHAK KEDUA sehubungan dengan surat perjanjian kerjasama ini, maka akan diselesaikan secara musyawarah untuk memperoleh mufakat;

    2. Apabila dengan cara musyawarah belum dapat dicapai suatu penyelesaian, maka kedua belah pihak sepakat untuk menyerahkan penyelesaiannya Kepada Pengadilan Negeri setempat, sesuai dengan peraturan perundangan yang berlaku;

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 25

    3. Keputusan Pengadilan Negeri yang telah mempunyai kekuatan hukum adalah mengikat kedua belah pihak.

    Pasal 6FORCE MAJEURE

    1. Jika timbul keadaan memaksa (force majeure) yaitu hal-hal yang diluar kekuasaan PIHAK KEDUA sehingga mengakibatkan tertundanya pelaksanaan kegiatan, maka PIHAK KEDUA harus memberitahukan secara tertulis kepada kepada PIHAK PERTAMA dengan tembusan kepada DinasKab/KotaProvinsi.dalam waktu 4 X 24 jam;

    2. Keadaan memaksa (force majeure) yang dimaksud pasal 8 ayat (1) adalah :a. Bencana alam seperti gempa bumi, angin topan, banjir besar,

    kebakaran yang bukan disebabkan kelalaian PIHAK KEDUA;b. Peperangan;c. Perubahan kebijakan moneter berdasarkan Peraturan Pemerintah.

    Pasal 7LAIN-LAIN

    1. Bea materai yang timbul akibat pembuatan surat perjanjian kerjasama ini menjadi beban PIHAK KEDUA;

    2. Segala lampiran yang melengkapi surat perjanjian kerjasama ini merupakan bagian yang tak terpisahkan dan mempunyai kekuatan hukum yang sama;

    3. Perubahan atas surat perjanjian kerjasama ini tidak berlaku kecuali terlebih dahulu telah mendapatkan persetujuan kedua belah pihak.

    Pasal 8PENUTUP

    Surat perjanjian kerjasama ini ditandatangani oleh kedua belah pihak dengan penuh kesadaran dan tanggungjawab tanpa adanya paksaan dari manapun

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 26

    dan dibuat rangkap 2 (dua) yang kesemuanya mempunyai kekuatan hukum yang sama untuk digunakan sebagaimana mestinya.

    PIHAK PERTAMAPejabat Pembuat KomitmenDinas.......Prop/Kab/Kota......

    .........................................NIP...................................

    PIHAK KEDUA Ketua Kelompok

    ..........................................

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 27

    Lampiran -2

    BERITA ACARA PENITIPAN BARANG

    Pada hari ini ..tanggal ..bulan tahun Dua Ribu Tiga Belas, bertempat .. telah dilakukan penitipan barang .. antara :

    1. N a m a : (Pimpinan Perusahaan Penyedia Barang)Jabatan : ........................Alamat :

    Yang selanjutnya disebut PIHAK PERTAMA

    2. N a m a : .Jabatan : Ketua Kelompok.Alamat :

    Yang selanjutnya disebut PIHAK KEDUA

    Dengan ini menyatakan bahwa PIHAK PERTAMA telah menyerahkan sarana produksi .........................................(rincian terlampir) sesuai dengan SPK No. . tanggal .. kepada PIHAK KEDUA dan PIHAK KEDUA telah menerima dari PIHAK PERTAMA sarana produksi dimaksud dengan baik.

    Demikian berita acara penitipan barang ini dibuat untuk dapat dipergunakan sebagaimana mestinya.

    PIHAK PERTAMA

    (nama)Jabatan.

    PIHAK KEDUA

    (nama).......................................(ketua klp)

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 28

    Lampiran -3BERITA ACARA SERAH TERIMA BARANGNomor : ..

    Pekerjaan : Pengadaan Sarana Produksi....................................

    Pada hari ini ..tanggal ..bulan tahun Dua Ribu Tiga Belas, bertempat .. telah dilakukan serah terima .. antara :

    1. N a m a : (Pimpinan Perusahaan penyedia barang)Jabatan : .............................Alamat :

    Yang selanjutnya disebut PIHAK PERTAMA

    2. N a m a : .......... (Pejabat Penerima Hasil Pekerjaan)Jabatan : Alamat :

    Yang selanjutnya disebut PIHAK KEDUADengan ini menyatakan bahwa PIHAK PERTAMA telah menyerahkan sarana produksi .........................................(rincian terlampir) sesuai dengan SPK No. . tanggal .. kepada PIHAK KEDUA dan PIHAK KEDUA telah menerima dari PIHAK PERTAMA sarana produksi dimaksud dengan baik.

    Demikian berita acara serah terima pekerjaan ini dibuat untuk dapat dipergunakan sebagaimana mestinya.PIHAK PERTAMA

    (nama)........................................(jabatan)

    PIHAK KEDUA

    (nama)NIP.................................................

  • Pedoman Pelaksanaan Pengembangan Budidaya Kelinci Tahun 2013 29

    Lam

    pira

    n 4

    Nam

    aKelom

    pok

    :Kab/Ko

    ta,Provinsi

    :Lapo

    ranTriwulan

    :I

    /II

    /III/

    IV

    No.

    Nam

    aAnggota

    Ke

    lompo

    kAwal

    Lahir

    Mati

    Jual

    Akhir

    Pupu

    kOrganik

    Prod

    ukOlahan

    12

    34

    56

    78

    910

    11

    LAP

    OR

    AN

    KE

    GIA

    TAN

    PE

    NG

    EM

    BA

    NG

    AN

    BU

    DID

    AY

    A K

    ELI

    NC

    I20

    13

    Perkembangan

    Ternak(ekor)

    DiversifikasiU

    saha

    Per

    mas

    alah

    anKe

    terangan

    .,tgl

    Pembina

    TeknisKe

    lompo

    kKe

    tuaKe

    lompo

    k

    ..

    Em

    ail :

    bud

    iday

    ater

    naku

    ngga

    [email protected]

    hoo.

    co.id

    COVER.pdfPage 3

    COVER.pdfPage 1