protap anestesi oke

  • Upload
    anisa

  • View
    7

  • Download
    0

Embed Size (px)

DESCRIPTION

wow

Citation preview

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 1/23

    blogdetik.comDaftarBlogAyoMoveOnkeNewBlogdetik!

    Rejeki++bloggerdetik

    semuanyabolehtahumariberbagimariberbagi

    6Juli2008

    protapanestesi

    Diarsipkandibawah:protapalamanda@15:48and

    PROSEDURTETAP

    PELAYANANANESTESIDANREANIMASI

    RSUDr.SOEROTO

    NGAWI

    DISUSUNOLEH

    Dr.BAMBANGTRIYONO,SpAn.MsiMed

    INSTALASIANESTESIDANREANIMASI

    RSUDr.SOEROTO

    NGAWI

    TAHUN2008

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSU

    Dr.

    TINDAKANANESTESI,TUGASDOKTER/PERAWATANESTESI

    DANPELIMPAHANTUGAS/WEWENANG

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 2/23

    SoerotoNgawi

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    PengertianTujuan

    Kebijakan

    Tindakananestesiadalahtindakanmedisyangdilakukanolehdokterspesialisanestesidanatauperawatanestesidikamaroperasipadapasienyangakanmenjalanipembedahan

    1.Memberikankenyamanandankeamananpadapasienyangsedangmenjalanipembedahan

    2.Memberikankenyamanankepadadokterbedahdalammelakukantindakanpembedahan

    3.Mengembalikanfungsifisiologispasiensetelahmenjalanipembedahansepertisaatsebelummenjalanipembedahan.

    Dokterspesialisanestesibertugas:

    1.Melakukanpemeriksaanpadapasiensebelummenjalaniprogrampembedahanmelaluikunjunganpreoperasiataukonsultasiyangdilakukanolehdokterspesialisanestesi

    2.Melakukantindakanperbaikanataukonsultasikebagianlainjikaditemukanhalyangdianggapbelumlayakpadapasienuntukmenjalanipembedahan

    3.Menentukantehnikanestesiyangterpilihpadapasienyangakanmenjalanipembedahandenganmengutamakankeamanandankenyamananpadapasien

    4.Melakukantindakananestesisesuaidenganprosedurtetap

    5.Memberikanpengawasandanbimbingankepadaperawatanestesisecaraberkesinambungan.

    6.Senantiasamenambahdanmengembangkankeilmuananestesimelaluipertemuanilmiahsecaraberkaladanberkesinambungan.

    PELIMPAHANWEWENANG

    Perawatanestesibertugas:

    1.Melakukanpersiapanalatdanobatobatanyangakandipergunakanuntuktindakananestesipadapasienyangakanmenjalanipembedahandikamaroperasi

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 3/23

    PengertianTujuan

    Kebijakan

    2.Melakukantindakananestesisesuaiprosedurtetapataspetunjukyangdiberikanolehdokterspesialisanestesi

    3.Melakukanpengawasanataumonitoringpasienselamamenjalanitindakanpembedahan

    4.Melakukanupayaresusitasidanpengelolaanapabiladiperlukanselamapasienmenjalanipembedahandanpemulihan.

    5.Melakukankonsultasikepadadokterspesialisanestesisetiapakanmelakukantindakananestesi

    6.Membuatmedicalreport/pelaporanpadapasienselamamenjalanipembedahan.

    7.Menambahdanmengembangkanpengetahuanilmuanestesiyanguptodatemelaluikegiatanataupertemuanilmiah

    Merupakanwewenangdantanggungjawabdokteranaesthesiyangdibantuolehperawatanestesisesuaidenganbidangnya.AdapunpelayanananestesidanreanimasiyangdilakukanolehperawatanestesiadalahmerupakanpelimpahanwewenangdaridokteranestesiAdanyakesepakatandalammelaksanakantindakanmedis,keperawatansesuaidenganhakdankewajibannya

    1.Melakukantindakananaesthesiologipadapasienyangakandilakukanoperasibaikdiruanginstalasibedahsentralataupunemergency.

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 4/23

    2.Tindakanperawatandaripersiapanhinggamelakukanpengawasanselamapasienbelumsadarsecarapenuh.

    3.Memberikanobatobatananestesibiladiperlukanbaikdalampersiapan,selamamaupunpascapembedahansesuaiperintahdokteranestesi.

    Prosedur 1.Jikaadadokterspesialisanestesiologi,makadapatdimintakaninstruksitertulissertaberikutparafnya.

    2.Jikadokterspesialisanestesiologitidakadaditempattetapimasihdapatdijangkau,makadapatdimintakaninstruksisecaralisanyangkemudiandapatdikonfirmasikantertulisberikutparaf.

    3.Jikatidakadadokterspesialisanestesiologi,makaperawatanestesimengerjakansesuaidenganprosedurtetapyangtelahdisepakatisebelumnyaatasperintahtertulisdaridokteryangmelakukanpembedahan.Tanggungjawabberadapada

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 5/23

    dokteryangmelakukanpembedahan

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.Soeroto

    Ngawi

    5.Riwayatoperasidananestesiyangpernahdialamipadawaktuyanglalu,berapakalidanselangwaktu.Apakahsaatitumengalamikomplikasi,seperti:lamapulihsadar,memerlukanperawatanintensifpascabedah,dll.

    6.Kebiasaanburukseharihariyangmungkindapatmempengaruhijalannyaanestesi,seperti:merokok,minumminumanberalkohol,pemakainarkoba.

    B.PEMERIKSAANFISIK

    Pemeriksaanfisikrutinmeliputi:keadaanumum,kesadaran,anemis/tidak,BB,TB,suhu,tekanandarah,denyutnadi,poladanfrekuensipernafasan.

    Dilakukanpenilaiankondisijalannafasyangdapatmenimbulkankesulitanintubasi

    C.PEMERIKSAANLABORATORIUM

    Darah:Hb,Ht,hitungjenislekosit,golongandarah,waktupembekuandanperdarahan

    Urine:protein,reduksi,sedimen

    Fotothorak:terutamauntukbedahmayor

    EKG:rutinuntukumur>40tahun

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 6/23

    Elekrolit(Natrium,Kalium,Chlorida)

    Dilakukanpemeriksaankhususbilaadaindikasi,misal:

    EKG:padaanakdandewasa

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 7/23

    vMidazolamdosis0,070,1mg/kgBBiv

    vPadaanakSA0,010,015mg/kgBB+midazolam0,1mg/kgBB+ketamin35mg/kgBBimatausecaraintravenaSA0,01mg/kgBB+midazolam0,07mg/kgBB

    5.Sebelumdilakukaninduksidiberikanoksigen6liter/menitdenganmasker(preoksigenasi)selama5menit.

    6.Obatinduksiyangdigunakansecaraintravena:

    1.Ketamin(dosis12mg/kgBB)

    2.Penthotal(dosis45mg/kgBB)

    3.Propofol(dosis12mg/kgBB)

    7.Padapenderitabayiatauanakyangbelumterpasangaksesintravena,induksidilakukandenganinhalasimemakaiagentinhalasiyangtidakiritasiataumerangsangjalannafassepertihalothaneatausevoflurane.

    8.Selamainduksidilakukanmonitortandavital(tekanandarah,nadimaupunsaturasioksigen)

    9.Padakasusoperasiyangmemerlukanpemeliharanjalannafas,dilakukanintubasiendotrachealtube.

    10.Pemeliharaananestesidilakukandenganmenggunakanasastriasanestesia(balanceanaesthesia)yaitu:sedasi,analgesi,danrelaksasi

    11.Pemeliharaananestesidapatmenggunakanagentvolatile(halothane,enflurane,maupunisoflurane)atauTIVA(TotalIntravenaAnestesia)denganmenggunakanketaminataupropofol.

    12.Padapembedahanyangmemerlukanrelaksasiototdiberikanpemeliharaandenganobatpelumpuhototnondepolarisasi.

    13.Ekstubasidilakukansetelahpenderitasadar.

    14.Setelahoperasipenderitadirawatdandilakukanpengawasantandavitalsecaraketatdiruangpemulihan.

    15.Penderitadipindahkandariruangpemulihankebangsalsetelahmemenuhikriteria(Aldretescore>8untukpenderitadewasaatauStewartScore>5untukpenderitabayi/anak)

    16.Apabilapostoperasidiperlukanpengawasanhemodinamiksecaraketatmakadilakukandiruangintensif(ICU).

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 8/23

    II.OPERASIDARURAT(EMERGENCY)

    1.Dilakukanperbaikankeadaanumumseoptimalmungkinsepanjangtersediawaktu.

    2.Dilakukanpemeriksaanlaboratoriumstandardataupemeriksaanpenunjangyangmasihmungkindapatdilakukan.

    3.Padaoperasidarurat,dimanatidakdimungkinkanuntukmenunggusekianlama,makapengosonganlambungdilakukanlebihaktifdengancaramerangsangmuntahdenganapomorfinataumemasangpipanasogastrik.

    4.Dilakukaninduksidenganmetoderapidsquenceinductionmenggunakansuksinilkolindengandosis12mg/kgBB.

    5.Pemeliharaananestesidanmonitoringanestesiyanglainnyasesuaidenganoperasielektif.

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSU

    Dr.SoerotoNgawi

    Prosedur KONTRAINDIKASI:

    1.Penderitamenolak

    2.Infeksipadatempatpenyuntikan

    3.Gangguanfungsihepar

    4.Kerusakansyaraf

    5.Gangguankoagulasi

    6.Tekananintracranialtinggi

    7.Sepsis

    8.Penggunaobatantikoagulan

    9.Pemakaipacemaker

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 9/23

    10.Penggunaobattricyclicantidepresant,MAOinhibitor

    11.Allergiobatanestesilokal

    12.Hipertensitakterkontrol

    1.Dilakukanolehdokterspesialisanestesi

    2.Dilakukanloadingcairankoloid500ccuntukmencegahterjadinyahipotensi

    3.Dilakukanpengukuranulangtandavital(tekanandarah,nadidansaturasioksigen)

    4.Tarikgarislurusmelaluikeduacristailiaca,garisiniakanmemotongvertebralumbalsetinggiL4atauL4L5interspace

    5.Posisipenderitadudukatautidurmiringuntukibuhamildianjurkandalamposisileftlateraldecubitus.

    6.Dilakukaninfiltrasidengananestesilokalpadadaerahpuncture.

    7.DilakukanpuncturepadaL23,L34atauL45interspace.

    8.Tehnikpuncturedapatdenganmidlineapproachatauparamedianapproach

    9.Obatanestesilokalyangdigunakanlidokain5%hiperbarik(lidodexR)ataubupivakain0,5%hiperbarik(bunascan0,5%,decain0,5%ataumarcain0,5%hiperbarik)untukanestesispinalsedangkanuntukanestesiepiduralmenggunakanbupivacainisobarik(marcain0,5%isobarik)ataulevobupivacainisobarik(chirocainisobarik)

    10.Untukmemperpanjangkerjaobatanestesilokaldapatditambahkanadrenalinataucatapres.

    Monitoring

    Komplikasi

    Pengobatankomplikasi

    Dilakukanmonitoringtandatandavital:tekanandarah,nadidansaturasisecarakontinyutiap3menit.

    1.Dini:hipotensi,mualmuntah,prekardialdiscomfort,menggigil,depresinafas,totalspinal,anafilaktik,hematom.

    2.Lambat:sakitkepala,sakitpunggung,retensiurine,meningitis,sequelaeneurology,chronicadhesivearachnoiditis.

    3.Bloktidakadekuat

    1.Hipotensi:efedrin15mgivataupreventifpadam.deltoideus1520mgim

    2.Menggigil:pethidine25mgivataulargactil1015mgiv

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 10/23

    3.Kejang:pentotal23mg/kgBBivataudiazepam0,2mg/kgBBiv

    4.Kesadaranmenurun:bebaskanjalannafas,infuskristaloid,beriO2

    5.Sakitkepala:tidurterlentang,cairan,analgetik,epiduralbloodpatch(520cc),pengikatperut/stagen.

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.SoerotoNgawi

    PENATALAKSANAANANESTHESIPADA

    PENDERITADIABETESMELLITUS(DM)

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    PengertianKriteriadiagnosis

    Persiapanoperasi

    Diabetesmelitusadalahketidakmampuanmetabolismekarbohidratkarenadefisiensiaktifitasinsulinditandaidenganhiperglikemiadanglikosuria

    1.Kadarglukosadarahsewaktu(plasmavena)>200mg/dlatau

    2.Kadarglukosadarahpuasa(plasmavena)>126md/dlatau

    3.Kadarglukosaplasma>200mg/dlpada2jamsesudahpembebananglukosa75grampadaTTGO

    DMterkontrol:guladarah100200mg%

    DMtakterkontrol:guladarah300mg%

    PemeriksaanguladarahberkalasebelumMRS

    Penilaiankeadaanmetabolik,jantung,ginjal(elektrolit,guladarah,kreatinin,BUN,proteinurine,bendaketon,EKG,faalhepar)

    DiabetesmelitusterkendalidenganOAD/diet,pembedahankecil/sedang

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 11/23

    yangdiperkirakandapatintakeperoralpascabedah,tidakperlukonversiOADkeinsulin.

    Kadarguladarahprabedahdipertahankanantara120180mg/dl(sampeldarahWBatau140mg/dl(puasa)dan200mg/dl(2jamPP)bilayangdiperiksaplasma.

    Untukpasiendenganregimeninsulin:

    PadaharipembedahaninfusD5%dengankecepatan100150ml/jam

    Diberikaninsulinsampai2/3dosisyangbiasadigunakansubkutan

    Kadarguladarahdiperiksaberkalasetiap4jamselamapembedahandanpascabedah

    Pascabedahdinidiberikaninsulinsampai1/3dosisseharihari.

    Monitor Tambahaninsulindapatdiberikansetiap46jambergantungpadahasilpemeriksaankadarguladarah.

    Guladarah200250mg/dl:Insulin23unitsubkutan(RI)

    Guladarah250300mg/dl:Insulin34unitsubkutan(RI)

    Guladarah300400mg/dl:Insulin58unit,periksaguladarahsetelah12jam

    Guladarah>400mg/dl:Insulin10unit,periksaguladarahsetiap1jam

    Premedikasidenganhistaminantagonisataumetokloperamide10mgterutamapadapasiengastroparesis,1,5jamsebeluminduksi.

    Tentukanurgensioperasi:

    DMtidakterkontrol:

    Elektif:tunda,terapidulu

    Emergensi:segeraterapi:

    Hipoglikemia:Dextrosa5%

    Hiperglikemia:

    Ketonuria+2insulinloadingdose0,3U/kgiv,lanjutkandrips:0,1U/kg/jam

    K+20meq/jam

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 12/23

    Atauslidingscale:tiapurine+1beriregulerinsulin4U

    DMterkontrol:dapatdilakukanoperasi

    Rehidrasi

    Tekanandarah,Nadi,EKG,SaturasiO2,Guladarah,UrineOutput

    TehnikAnestesi

    Komplikasipascaanestesi

    1.RegionalAnestesi

    2.GeneralAnestesi:

    Premedikasi:atropine(kecualiIHD)danbenzodiasepin

    Induksi:Penthotaldanatracurium

    Maintenance:N2O,O2,atracuriumdanisoflurane

    Hipo/hiperglikemia

    Iskemi/infarkmiokard

    Comapersisten

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.SoerotoNgawi

    PENATALAKSANAANANESTHESIPADA

    PENDERITAPREEKLAMPSIA&EKLAMPSIA

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    Kriteriadiagnose

    Problem

    Preeklampsia

    Kehamilan>20minggu

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 13/23

    Tehnikanestesi

    Monitor

    1.Regionalanestesi:terpilihepiduralanestesimemperbaikirenaldanuteroplacentalbloodflow,kontroltekanandarahibulebihmudah,membantustabilitascardiacoutput

    2.Generalanestesi:Rapidinduction

    Indikasi:eklampsiadengankejangtakterkontrol

    Premedikasi:atropine0,01mg/kg

    Induksi:penthotal3mg/kgiv,succinilkolin11,5mg/kgiv

    Maitenance:N2O,O2,enflurane,danatracurium

    PersiapanOperasi Tekanandistolik>110mmHgpadawanitadengantekanandarahyangnormalsebelumnya

    Proteinuria

    Oedema

    Preeklampsiaberat

    Tekanandarahsistolik>160mmHgataudiastolik>110mmHgsaatistirahatatausistolik>140mmHgataudiastolik>90mmHgyangdisertaikeadaansebagaiberikut:

    Proteinuria>5g/24jamatauurinedipstick3+/4+

    Oliguria:70torrdansaturasi>94%

    4.Perbaikisirkulasiorganvital

    5.Koreksi:hipoalbumin,elektrolit,asidosis

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 14/23

    CVA,DIC,gagalginjal,gagaljantung

    Postoperasidilakukanobservasidiruangperawatanintensif(ICU)

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.SoerotoNgawi

    PENATALAKSANAANANESTESIPADA

    PENDERITAHIPERTENSI

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    Kriteriadiagnose

    Prosedur

    PersiapanOperasi

    Tehnikanestesi

    DerajathipertensimenurutstandartWHO

    1.Ringan:diastole90105mmHg

    2.Sedang:diastole105115mmHg

    3.Berat:diastole>115mmHg

    4.Hipertensimaligna:diastole>130mmHg

    SebelumoperasitentukanUrgencyoperasi:

    1. Elektif:tunda,terapidulusampaitensi

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 15/23

    2.Rehidrasi,bilaterdapatdehidrasi

    3.Koreksibilaadagangguan:elektrolit,asambasa,ureum,kreatinin

    4.Atasikomplikasi

    5.Periksa:EKG,fotothorak,Laboratorium(elektrolit,asambasa,ureum,kreatinin,guladarah,kolesterol)

    Premedikasi:

    Midazolam0,07mg/kgimsetengahjamsebelumoperasiataudenganneurolepanalgesia:droperidol0,10,15mg/kgiv+pethidin1mg/kgivataufentanil12ug/kgiv.

    Monitor

    Komplikasipascaanestesi

    1.Generalanestesi:

    Induksi:pentotal45mg/kgivataupropofol22,5mg/kgiv

    Pelumpuhotot:suksinilkolin11,5mg/kgiv,atrakurium0,5mg/kgiv,vecuronium0,1mg/kgivataurokuronium0,6mg/kgiv

    Lidokain2%1,5mg/kgivataufentanil12ug/kgiv

    Rumatananestesi:N2O,O2,isoflurane/sevoflurane,atrakurium/vecuronium

    2.RegionalAnestesi:

    Dapatdilakukansebelumnyadiloadingcairandahulu1015cc/kgbb.HindarispinalanestesidapatterjadiherniasiotakkarenakebocoranLCSakibatpeningkatanTIK

    Tekanandarah,Nadi,EKG,produksiurine,danperdarahan

    1.Kardiovaskuler:CAD,LVH,CHF,Dysritmia

    2.Renovaskuler:Renalinsuffisiensi

    3.Neurovaskuler:gangguanneurologis,stroke

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturPENATALAKSANAAN

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 16/23

    ANESTHESIPADAPENDERITA

    GANGGUANFUNGSIHATI

    RSUDr.SoerotoNgawi

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    Persiapanpreoperasi

    PersiapanOperasi

    Pemeriksaanpreoperasi:

    1.EKG

    2.Fotothorak

    3.BGA

    4.Laboratorium:

    Homeostasisglukosa:guladarah

    Metabolismebilirubin:bilirubin

    Sintesaprotein:Albumin

    Sintesaprotrombine:jumlahprotrombindanprotrombintime

    Liverfunctiontest:SGOT,SGPT,LDH,alkaliphospatase

    Darah:Hb,lekosit,diffcount,CT,BT

    Autoantigen:HbSAg

    Fungsiginjal:Ureum,creatinin,danelektrolit

    Koreksibilaterdapat:

    Hipoglikemia:beridextrose5%

    Hiperbilirubinemia:bila>20mg%berikanmanitol20%:0,251g/kgperdripssampaidiuresis>50ml/jam

    Hipoalbuminemia:bila

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 17/23

    Ureumcreatininmeninggi:dialisa

    Tehnikanestesi

    Monitor

    Komplikasi

    Atasi:

    Ascites:diuretikaatauparasintesis

    PerdarahanGITbagianatas:endoskopi

    Anemia:transfusi

    Terapikortikosteroid:berikanhidrokortison

    1.Regionalanestesi:Jikatidakterdapatgangguankoagulasi

    2.Generalanestesi:

    Hindari:obatdepresiHBF(hepaticbloodflow)hepatotoksik,obatyangdimetabolismedanekskresiolehhepar

    Hindari:succinilkolin,karenadefisiensikolinesterase

    Hindari:Halotanhepatotoksik

    Premedikasi:atropin,benzodiasepin

    Induksi:Ketamine1mg/kgivdanatracurium0,5mg/kgiv

    Maintenance:Ketamindrips,O2,atracurium

    Tekanandarah,Nadi,EKG,danurineoutput

    Hepatorenalsyndrome,enchepalopati,hipoglikemia

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.SoerotoNgawi

    PENATALAKSANAANANESTESIPADA

    PENDERITADENGANLAMBUNGPENUH

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 18/23

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    Problem

    Persiapanpreoperasi

    Tehnikanestesi

    1.Aspirasiisilambung

    2.DapatterjadiMendelsonssyndrome:pH0,4ml/kg

    3.Particulatematerialdapatmenyebabkanobstruksijalannafas

    1.Pasangnasogastrictube

    2.BerikanH2antagonis:simetidin300mgiv

    1.Regionalanestesi

    2.Generalanestesi:Rapidinductionatauawakeintubation.Ekstubasiharussadarpenuh

    Tehnikrapidinduction:

    1. Preoksigenasi:35menit,flow7liter/mnt2. Prekurarisasi:dengannondepolarisasimusclerelaksan3. Induksi:setelahtertidurlakukancricoidpressure(sellicksmanuver

    )4. Suksinilkolin11,5mg/kgivdanjangandiinflasi5. Intubasi,setelahterpasangETTcricoidpressuredihentikan.

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.SoerotoNgawi

    PENATALAKSANAANANESTESIPADA

    PENDERITAHYPERTHYROID

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 19/23

    Problem

    Persiapanpreoperasi

    Thyroidkrisisakibat:

    1.Pembedahan:insisi,manipulasi

    2.Medikal:stresspsikis,agentanestesivolatil,ketoasidosis,toksemia.

    Gejalakrisistiroid:

    1.Hipermetabolik:suhu>390C,keringatberlebihan

    2.Cardiovaskuler:takikardi,disritmia

    3.Respirasi:hiperventilasi

    4.Neurologi:gelisah,kejang

    5.Gastrointestinal:mual,muntah,diare

    ELEKTIF

    1.Tundadanterapisampaieuthyroiddengan:

    PTU:initialdose75200mgperostiap8jam,kemudian30100mgtiap68jam

    Lugol:26tetes4kalisehariperos

    Propanolol:1060mg3kalisehariperos

    EMERGENCY

    Segeraterapidengan:

    Naiodida:12gramivdrips,hambatsekresihormon

    Reserpin:2,5mgim,kurangiefekhormonterhadaptargetorgan/simpatolitik

    Hidrokortison:100300mgiv,dapatdiulangsampaitotal0,1mg/kgsampaiHR

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 20/23

    3.Fotoontgenleher

    4.Thyroidfunctiontest:T3,T4danTSH

    Operasinonthyroid:

    RegionalatauDeepGETA

    OperasiThyroid:

    Premedikasi:cegahtakikardi

    Induksi:penthotal

    Maintanance:N2O,O2,Atracurium,Isoflurane

    Tekanandarah,nadi,EKG,saturasiO2,temperatur

    1.Nervuslaringealterputustrakeomalasiaperlutrakeostomi

    2.GlandulaparathyroidterangkathipokalsemiaterapiCaglukonas10%1030ml

    3.Krisistiroid

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.SoerotoNgawi

    PENATALAKSANAANANESTESIPADA

    SECTIOCAESARIA

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    Monitor

    Komplikasi

    1.Monitortekanandarahsetiap3menit

    2.Respirasidannadi

    3.Tinggiblok

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 21/23

    Komplikasiyangseringterjadi:

    1.Totalblokspinaldilakukanmonitoringtinggibloksecarabaik

    2.Blokgagal/parsialdilanjutkanataudikombinasidengangeneralanestesi

    3.Nyerikepalahebat(PDPH)dilakukanpenyuntikanbloodpatch

    ANESTESIUMUM:

    1.Prosedursamasepertipenatalaksanaananestesiumumdenganmempertimbangkanduakehidupanyangharusdiselamatkan

    2.Pemberianobatyangcenderungmempengaruhijanindiberikansetelahbayilahir.

    RSU

    Dr.SOEROTO

    NGAWI

    INSTALASI

    ANESTESIDisahkanoleh:

    DirekturRSUDr.SoerotoNgawi

    PENATALAKSANAANANESTESIPADA

    TINDAKANKURET/LAPARASKOPIPADA

    MOW

    Prosedurtetap

    No.Dokumen

    Tanggalterbit

    Revisike

    JadilahorangpertamayangmenyukaitulisaniniApakahandamenyukaitulisanini?

    Sukatulisanini

    &Komentar

    1. qihufohak

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 22/23

    StoegerArmsCorpBlackPowderGuns

    qihufohak25Agustus2009@02:24

    2. imuvugyluh

    pekapoopekepoomississippi

    imuvugyluh25September2009@21:13

    RSSumpanuntukkomentarkomentardalamtulisanini.TrackBackURI

    Tinggalkankomentar

    Name(wajib)

    EMail(wajib)

    Website

    Abschicken

    Blogroll

    Arsip

    Kategoriprotap(3)

    Privacy&Terms

    Typethetext

  • 7/2/2015 semuanyabolehtahuprotapanestesi

    http://alamanda.blogdetik.com/index.php/2008/07/06/protapanestesi/ 23/23

    myprofil(0)lagu(0)icu(0)TakBerkategori(0)PPGD(1)

    Meta:

    LoginRSSRSSKomentarValidXHTMLXFNWP

    generiertin0,713Sekunden.|PoweredbyWordPress.