Estructura proteinas

  • View
    43

  • Download
    0

Embed Size (px)

Transcript

1. 14. Estructura deprotenas, 1 2. Niveles estructurales en las protenasEstructura primaria: Secuencia de aminocidosEstructura secundaria: Plegamiento bsico de la cadenadebido a enlaces de hidrgeno entre grupos -CO- y -NH-dela unin peptdica: hlices, lminas y girosEstructura terciaria: Estructura tridimensional de la protenaEstructura cuaternaria: Asociacin de distintas subunidades,siendo cada una un polipptido. 3. 5-AAGGGTACCCAACATTTAGTT-33-TTCCCATGGGTTGTAAATCAA-55-AAGGGUACCCAACAUUUAGUU-3N Lys.Gly.Ser.Gln.His.Leu.Val CDNARNAProtenaEstructura primaria 4. Estructura primaria de la insulinaS SGIVEQCCASVCSLYQLENYCNSSSSFVNQHLCGSHLVEALYLVCGERGFFYTPKA 5. Oxidacin de puentes disulfuroH OHCCCH2SSCH2CNN CHH OH OHCCCH2NSO3HSO3HCH2CN HCH OHCO3H 6. H OHCCCH2SSCH2CNN CHH OH OHCCCH2NDTT SHICH2 COOHSHCH2CN HCH OH OCCCH2NSCH2COO-HCOO-ReduccinCH2SCH2CN HCH Oy alquilacin de puentes disulfuro 7. O2NDeterminacin del N-trmino por la reaccin de SangerF + H 2N CNO2N CNR1OHR2OHR3OO2NHN CNO2N CNR1OHR2OHR3OO2NHNNO2R1COOHR2 COOHH2N COOHR3H2N+ + 8. Tripsina---.---.---.Lys.---.---.------.---.---.Arg.---.---.------.---.---.Phe.---.---.------.---.---.Tyr.---.---.------.---.---.Trp.---.---.------.---.---.Leu.---.---.---QuimotripsinaRotura enzimticade polipptidos 9. Rotura de un pptido por bromuro de ciangenoON CN CN CNCH2HROHROC CN CNN CHORHORHHROHROCH2SCH3NN CN CHORHORHOOCN CNROHROCN CHROHROBrCNH2N 10. Degradacin secuencial de EdmanN CN COHR4ON CCHOR2HOR1 R3N C S + H2NSN CN CN COHR4ON CCHOR2HOR1 R3HNN CN COHR4Ocido diludoH2N CHOR2R3NNHSOR1H+FeniltioisocianatoPTC-pptidoPTH-aminocidoPptido (n)Pptido (n-1) 11. Hoy da, la mayor parte de estructuras primarias de protenasse determina a partir de la secuencia de nucletidos en el genoma.Tcnicamente la secuenciacin de cidos nucleicos (en particular,la de DNA) es mucho ms sencilla y barata que la de protenas,estando al alcance de cualquier laboratorio. 12. 1 0 2 0 3 0 4 0 5 0 6 0| | | | | |P Y Q Y P A L T P E Q K K E L S D I A H R I V A P G K G I L A A D E S T G S I A K R L Q S I G T E N T E E N R R F Y R Q7 0 8 0 9 0 1 0 0 1 1 0 1 2 0| | | | | |L L L T A D D R V N P C I G G V I L F H E T L Y Q K A D D G R P F P Q V I K S K G G V V G I K V D K G V V P L A G T N G1 3 0 1 4 0 1 5 0 1 6 0 1 7 0 1 8 0| | | | | |E T T T Q G L D G L S E R C A Q Y K K D G A D F A K W R C V L K I G E H T P S A L A I M E N A N V L A R Y A S I C Q Q N1 9 0 2 0 0 2 1 0 2 2 0 2 3 0 2 4 0| | | | | |G I V P I V E P E I L P D G D H D L K R C Q Y V T E K V L A A V Y K A L S D H H I Y L E G T L L K P N M V T P G H A C T2 5 0 2 6 0 2 7 0 2 8 0 2 9 0 3 0 0| | | | | |Q K F S H E E I A M A T V T A L R R T V P P A V T G I T F L S G G Q S E E E A S I N L N A I N K C P L L K P W A L T F S3 1 0 3 2 0 3 3 0 3 4 0 3 5 0 3 6 0| | | | | |Y G R A L Q A S A L K A W G G K K E N L K A A Q E E Y V K R A L A N S L A C Q G K Y T P S G Q A G A A A S E S L F V S NH A Y Estructura primaria de la aldolasa A humanaSWISS-PROT http://www.expasy.ch 13. Clculos a partir de estructura primaria- Nmero, porcentaje y fraccin molar de aminocidos- Frmula molecular y peso molecular- pI (punto isoelctrico) terico- Absorbancia molar terica- Vida media terica- ndices de inestabilidad e hidrofobicidad 14. A m i n o a c i d c o m p o s i t i o n :A l a ( A ) 4 2 1 1 . 6 %A r g ( R ) 1 5 4 . 1 %A s n ( N ) 1 4 3 . 9 %A s p ( D ) 1 4 3 . 9 %C y s ( C ) 8 2 . 2 %G l n ( Q ) 1 7 4 . 7 %G l u ( E ) 2 4 6 . 6 %G l y ( G ) 3 0 8 . 3 %H i s ( H ) 9 2 . 5 %I l e ( I ) 2 0 5 . 5 %L e u ( L ) 3 4 9 . 4 %L y s ( K ) 2 6 7 . 2 %M e t ( M ) 3 0 . 8 %P h e ( F ) 8 2 . 2 %P r o ( P ) 1 9 5 . 2 %S e r ( S ) 2 0 5 . 5 %T h r ( T ) 2 2 6 . 1 %T r p ( W ) 3 0 . 8 %T y r ( Y ) 1 3 3 . 6 %V a l ( V ) 2 2 6 . 1 %A s x ( B ) 0 0 . 0 %G l x ( Z ) 0 0 . 0 %X a a ( X ) 0 0 . 0 %A t o m i c c o m p o s i t i o n :C a r b o n C 1 7 4 1H y d r o g e n H 2 7 8 0N i t r o g e n N 4 8 6O x y g e n O 5 2 6S u l f u r S 1 1F o r m u l a : C 1 7 4 1H 2 7 8 0 N 4 8 6O 5 2 6 S 1 1T o t a l n u m b e r o f a t o m s : 5 5 4 4M o l e c u l a r w e i g h t : 3 9 2 8 8 . 8ProtParam, 1http://www.expasy.ch 15. T o t a l n u m b e r o f n e g a t i v e l y c h a r g e d r e s i d u e s ( A s p + G l u ) : 3 8T o t a l n u m b e r o f p o s i t i v e l y c h a r g e d r e s i d u e s ( A r g + L y s ) : 4 1T h e o r e t i c a l p I : 8 . 3 9E x t i n c t i o n c o e f f i c i e n t s :C o n d i t i o n s : 6 . 0 M g u a n i d i u m h y d r o c h l o r i d e0 . 0 2 M p h o s p h a t e b u f f e rp H 6 . 5E x t i n c t i o n c o e f f i c i e n t s a r e i n u n i t s o f M - 1 c m - 1 .T h e f i r s t t a b l e l i s t s v a l u e s c o m p u t e d a s s u m i n g A L L C y sr e s i d u e s a p p e a r a s h a l f c y s t i n e s , w h e r e a s t h e s e c o n d t a b l ea s s u m e s t h a t N O N E d o .2 7 6 2 7 8 2 7 9 2 8 0 2 8 2n m n m n m n m n mE x t . c o e f f i c i e n t 3 5 6 3 0 3 5 5 0 8 3 4 9 4 5 3 4 1 9 0 3 2 8 8 0A b s 0 . 1 % ( = 1 g / l ) 0 . 9 0 7 0 . 9 0 4 0 . 8 8 9 0 . 8 7 0 0 . 8 3 72 7 6 2 7 8 2 7 9 2 8 0 2 8 2n m n m n m n m n mE x t . c o e f f i c i e n t 3 5 0 5 0 3 5 0 0 0 3 4 4 6 5 3 3 7 1 0 3 2 4 0 0A b s 0 . 1 % ( = 1 g / l ) 0 . 8 9 2 0 . 8 9 1 0 . 8 7 7 0 . 8 5 8 0 . 8 2 5ProtParam, 2http://www.expasy.ch 16. E s t i m a t e d h a l f - l i f e :T h e N - t e r m i n a l o f t h e s e q u e n c e c o n s i d e r e d i s P ( P r o ) .T h e e s t i m a t e d h a l f - l i f e i s : > 2 0 h o u r s ( m a m m a l i a n r e t i c u l o c y t e s , i n v i t r o ) .> 2 0 h o u r s ( y e a s t , i n v i v o ) .? ( E s c h e r i c h i a c o l i , i n v i v o ) .I n s t a b i l i t y i n d e x :T h e i n s t a b i l i t y i n d e x ( I I ) i s c o m p u t e d t o b e 3 4 . 8 2T h i s c l a s s i f i e s t h e p r o t e i n a s s t a b l e .A l i p h a t i c i n d e x : 8 7 . 1 6G r a n d a v e r a g e o f h y d r o p a t h i c i t y ( G R A V Y ) : - 0 . 2 6 8ProtParam, 3http://www.expasy.ch 17. Predicciones a partir de estructura primaria, 1- Hidrofobicidad- Estructura secundaria- Retencin cromatogrfica en HPLC- Residuos accesibles y ocultos- Mutabilidad 18. A l a : 1 . 8 0 0A r g : - 4 . 5 0 0A s n : - 3 . 5 0 0A s p : - 3 . 5 0 0C y s : 2 . 5 0 0G l n : - 3 . 5 0 0G l u : - 3 . 5 0 0G l y : - 0 . 4 0 0H i s : - 3 . 2 0 0I l e : 4 . 5 0 0L e u : 3 . 8 0 0L y s : - 3 . 9 0 0M e t : 1 . 9 0 0P h e : 2 . 8 0 0P r o : - 1 . 6 0 0S e r : - 0 . 8 0 0T h r : - 0 . 7 0 0T r p : - 0 . 9 0 0T y r : - 1 . 3 0 0V a l : 4 . 2 0 0PYQYPALTPEQKKELSDIAHValor de hidrofobicidad para laposicin n (en este caso, 8):n+4bi = -10.5Si = n-4Escala de hidrofobicidad(segn Kyte y Doolittle) 19. Clculo predictivo de hidrofobicidad (Kyte & Doolittle) 20. Predicciones a partir de estructura primaria, 2: Homologas( C G 5 4 3 2 ) C G 5 4 3 2 P R O T E I N . [ D r o s o p h i l a m e l a n o g a s t e r ]3 7 6 A AS c o r e = 3 9 8 b i t s ( 1 0 1 1 ) , E x p e c t = e - 1 1 0I d e n t i t i e s = 1 9 7 / 3 5 5 ( 5 5 % ) , P o s i t i v e s = 2 4 5 / 3 5 5 ( 6 8 % ) , G a p s = 2 / 3 5 5 ( 0 % )Q u e r y : 2 Y Q Y P A L T P E Q K K E L S D I A H R I V A P G K G I L A A D E S T G S I A K R L Q S I G T E N T E E N R R F Y R Q L 6 1+ Y P E + + E L I + + V A P G K G I L A A D E S + + K R Q I G E N T E E N R R Y R Q +S b j c t : 5 F Y Y P - - N K E L Q E E L I C I S K A L V A P G K G I L A A D E S S A V M G K R F Q L I G V E N T E E N R R L Y R Q M 6 2Q u e r y : 6 2 L L T A D D R V N P C I G G V I L F H E T L Y Q K A D D G R P F P Q X X X X X X X X X X X X X X X X X X P L A G T N G E 1 2 1L T D + + I G V I + H E T L + Q + D D G P F + P L G + ES b j c t : 6 3 L F T T D P K I A E N I S G V I F Y H E T L H Q R T D D G L P F V E A L R K K G I L T G I K V D K H F S P L F G S E D E 1 2 2Q u e r y : 1 2 2 T T T Q G L D G L S E R C A Q Y K K D G A D F A K W R C V L K I G E H T P S A L A I M E N A N V L A R Y A S I C Q Q N G 1 8 1T T Q G L D L + R C A Q Y K K + G F A K W R C + L K I + + T P S A I + E N A N V + A R Y A + I C QS b j c t : 1 2 3 F T T Q G L D D L A N R C A Q Y K K E G C S F A K W R C I L K I T K N T P S P Q A I L E N A N V M A R Y A A I C Q S Q R 1 8 2Q u e r y : 1 8 2 I V P I V E P E I L P D G D H D L K R C Q Y V T E K V L A A V Y K A L S D H H I Y L E G T L L K P N M V T P G H A C T Q 2 4 1+ V P I + P E + L G D H D L R C Q V E + L A V Y K A L S D H H + + L E G T L L + P + M V P G +S b j c t : 1 8 3 L V P I I S P E V L A T G D H D L D R C Q K V N E I L L A G V Y K A L S D H H V F L E G T L L Q P S M V M P G L Q S N K 2 4 2Q u e r y : 2 4 2 K F S H E E I A M A T V T A L R R T V P P A V T G I T F L S G G Q S E E E A S I N L N A I N K C P L L K P W A L T F S Y 3 0 1+ I + A T V A + R R + V P P A V G + F G Q S E E E A + + + L N A I N P L K P W A + T F + +S b j c t : 2 4 3 N H P P A D I G V A T V L A I R R S V P P A V M G V L F C G G A Q S E E E A T V H L N A I N N V P L C K P W A M T F A F 3 0 2Q u e r y : 3 0 2 G R A L Q A S A L K A W G G K K E N L K A A Q E E Y V K R A L A N S L A C Q G K Y T P S G Q A G A A A S E S L 3 5 6R A L Q S L + W G G K K E + A Q E + K R A N L A G K Y + A A + E LS b j c t : 3 0 3 D R A L Q T S I L R T W G G K K E Q I S H A Q N E L I K R C R A N G L A S I G K Y V I G S V E S S A A T E R L 3 5 7 21. Dependiendo del grado de homologa en su estructuraprimaria, las protenas se agrupan en:- Superfamilias: homologa en torno a 30 %- Familias: homologa superior a un 50 % yla misma funcin, por lo general.Adems, hay pequeos tractos de secuencias comunesa protenas muy diversas, y que corresponden a ciertosaspectos funcionales (como p.e. modificacinpostraduccional): son los motivos secuenciales 22. Algunos motivos secuenciales en las protenasN-Glicosilacin N-{P}-[ST]-{P}Unin a glicosaminoglicano S-G-x-GFosforilacin dependiente de cAMP [RK]-(2)-[ST]Fosforilacin, protein kinasa C [ST]-x(2)-[RK]Fosforilacin, tirosin kinasa [RK]-x(2)-[DE]-x(3)-YN-miristilacin G- {EDRKHPFYW}-x(2)-[STAGCN]-{P}Amidacin C-terminal x-G- [RK]-[RK]g-carboxilacin de cid