View
1
Download
0
Category
Preview:
Citation preview
Studies on the structure and functions
of the regulatory domain of the
N-methyl-D-aspartate receptor
(NMDA 受容体の調節領域の構造と機能の解析)
2009. 3
Han Xia
1
CONTENTS
INTRODUCTION………………………………………………………………..2
CHAPER 1
Merterials and Methods…………………………………………………..11
CHAPER 2
Binding of spermine and ifenprodil to a purified, soluble regulatory domain of the NMDA receptor
Introduction……………………………………………………...............20
Results…………………………………………………………………...21
Discussion……………………………………………………….............40
CHAPER 3
Modeling of NR1A and NR2B regulatory domain of the NMDA receptor
Introduction……………………………………………………………...45
Results…………………………………………………………………...46
Discussion…………………………………………………….................56
REFERENCES…………………………………………………………………...57
LIST OF PUBLICAIONS…………………………………………………….70
ACKNOWLEDGEMENTS………………………………………………….71
THESIS COMMITTEE……………………………………………………….72
2
INTRODUCTION The polyamines putrescine, spermidine and spermine are present in almost all
cells and have important roles in protein synthesis, cell division and cell growth (Fig. 1).
Putrescine is synthesized from L-ornithine in a reaction catalyzed by ornithine
decarboxylase, the rate-limiting enzyme in polyamine biosynthesis. Putrescine and
decarboxylated S-adenosyl methionine are substrates for the synthesis of spermidine,
which is a precursor of spermine. Polyamines are organic polycations that are
protonated at physiological pH and can potentially interact with a variety of cellular
targets including nucleic and proteins [1-4].
NH
NH
NHH2N
NNH2H2NN 2
NNH
NH2H2NN NH2
Putrescine
Spermidine
Spermine 2
Fig. 1 Structure of polyamines
The endogenous polyamines putrescine, spermidine and in particular,
spermine modulate a number of ion channel [5, 6]. Spermine and spermidine are present
in high concentration in the nervous system, and uptake and depolarization-induced
release of polyamines from brain slices has been reported [7, 8]. Extracellular spermine
3
has multiple effects at the NMDA subtype of glutamate receptor, including stimulation
that increases the size of NMDA receptor currents and voltage-dependent block [9-15].
Activation of NMDA receptors is associated with the induction of various
forms of synaptic plasticity, including some forms of long-term potentiation and
long-term depression, processes that may underlie learning and memory [16-18].
NMDA receptors are subtype of ligand-gated ionotropic glutamate receptors including
subtypes of AMPA and kainite receptors [19]. Although they share common structural
features, NMDA receptors have several characteristics different from the other two
subtypes of glutamate receptors; 1) Not only glutamate but also glycine are necessary
for activation of NMDA receptors; 2) NMDA receptors show high permeability to Ca2+;
and 3) NMDA receptor activity is blocked by Mg2+ at resting membrane potential and
the block is relieved by depolarization[19].
At native NMDA receptors expressed on cultured neurons, there is
considerable variability in the degree of stimulation by spermine of individual neurons
[11-14]. This may be due to the expression of multiple forms of the NMDA receptor
composed of different combinations of subunits. The NR1 family consists of eight
splice variants of the NR1 gene [20-23], eight of which were originally termed
NR1A-NR1H [24]. The NR2 family consists of NR2A, NR2B, NR2C and NR2D cDNA
isolated from rat brain [25-28]. High active NMDA receptor channel is formed in vitro
by co-expression of NR1 and NR2 subunits [25, 26, 29, 30], although the NR1 subunit
alone exhibits a very small response in the Xenopus oocyte expression system [21, 31].
In accord with this, most brain regions express both NR1 and NR2 subunits. The NR1
4
subunit mRNA is found ubiquitously in the brain during development. Mutant mice
defective in the NR1 subunit died shortly after birth and failed to develop
whisker-related neuronal patterns in the trigeminal nuclei [32, 33]. At the embryonic
stages, the NR2B subunit mRNA is expressed in the entire brain, and NR2D subunit
mRNA is expressed in the diencephalons and brainstem [34]. After birth the NR2A
subunit mRNA appears in the entire brain, and NR2C subunit mRNA mainly in the
cerebellum. After birth, expression of NR2B subunit mRNA becomes restricted to the
forebrain, and that of the NR2D subunit mRNA is strongly reduced. The NR2B subunit
knockout mice died within 1 day after birth [35]; disruption of NR2A subunit of the
mouse does not appreciably affect the growth and mating of the mice, but results in
reduction of hippocampal LTP and spatial learning [36]; the NR2D subunit mice grow
normally, but exhibit reduced spontaneous behavioral activity [37]; the deficiency of
either the NR2A or NR2C subunit causes no remarkable behavioral abnormality, but the
disruption of both NR2A and NR2C results in impairment of motor coordination[38].
Thus, multiple NR2 subunits are major determinants of the NMDA receptor channel
diversity, and the molecular compositions and functional properties of NMDA receptor
channel are different depending on the brain regions and developmental stages [39-41].
Each subunit consists of extracellular N-terminal regulatory (R) domain,
agonist binding (S) domain, channel forming domain and intracellular domain (Fig. 2).
There are four membrane (M1-M4) regions in the channel forming domain, and second
membrane segment (M2) is thought to form a re-entrant loop and contribute to the
narrowest constriction of the channel (Fig. 2)[19]. The NMDA receptors are probably
tetramers composed of two molecules each of NR1 and NR2 subunits [19, 42, 43 ].
5
Na+Ca2+
H2NNH2
NR2
Extracellular
Intracellular
HOOC
NR1
HOOC
3 214 32 1 4
2
2 2
2
NR1
NR2
NR1
NR2
Gly Glu
R-domainR-domain SPM
IFEN
SPM
IFEN
N
OH
OH
SPM
IFEN
NH2NH
NH
NH2
(NR1A-H) (NR2A-NR2D)
S-domainS-domain
Fig. 2 Structure of NMDA receptor.
Each NMDA receptor subunit contains two large extracellular regulatory domains
(R-domain) and the agonist binding domains (S-domain). The transmembrane domain is
comprised of M1-M3, and a re-entrant loop (M2). There is a intracellular C-terminal
domain of each subunit. The receptor is gated by the co-agonist glutamate (Glu) and
glycine (Gly). The NMDA receptor are probably heterotetramaers composed of two
molecules each of NR1 and NR2 subunits. It indicates that some compounds bound to
the R-domain of NMDA receptors.
6
The multiple effects of spermine on NMDA receptors are summarized in Fig. 3.
spermine potentiates NMDA currents in the presence of saturating concentrations of
glycine (glycine-independent stimulation; mechanism 1 in Fig.3), an effect that involves
an increase in the frequency of channel opening and a decrease in the desensitization of
NMDA receptors [12-14]. A second involves an increase in the desensitization of
NMDA receptors for glycine (glycine-dependent stimulation; mechanism 2 in Fig. 3)
[11-44].
In addition to stimulation, voltage-dependent inhibition by extracellular
spermine was seen at native NMDA receptors (in the absence of extracellular Mg2+)
possibly representing a direct block of the ion channel by sperimine (mechanism 3 in
Fig. 3) [11-13, 45, 46]. The strong voltage-dependent inhibition may be due to binding
of spermine within the ion channel pore at a site close to, or overlapping with, the
bingidng site for extracellular Mg2+. There is no evidence to suggest that intracellularly,
produces an incomplete block that probably reflects permeation of spermine through
NMDA channels (Fig. 3) [11, 47].
Stimulation by spermine is dependent on the type of NR1 splice variant and the
type of NR2 subunit present in NMDA receptors [10, 45, 48-51]. Only receptors
expressed from splice variants such as NR1A, that lack a 21 amino acid insert encoded
by exon 5 show glycine-independent stimulation by spremine [48, 49] Furthermore the
various effect of spermine are differentially manifested in heteromeric NR1A/NR2
receptors containing different NR2 subuints (Fig. 3)[10, 45, 51]. NMDA receptors are
inhibited by protons, with a tonic inhibition of about 50% at physiological pH (7.3-7.5)
7
[52, 53]. Sensitivity to protons, like sensitivity to stimulation by spermine, is influenced
by the presence of exon 5 in NR1. Variants that contain the insert (such as NR1B) are
less sensitive to protons than are variats that lack the insert [54]. The
glycine-independent form of spermine stimulation is influenced by extracellular pH.
Ifenprodil is a novel NMDA receptor antagonist that selectively inhibits
NR1/NR2 receptors containing the NR2B subunit [55, 56]. Ifenprodil acts as a
noncompetitive, partial, and voltage-independent antagonist [55, 57, 58]. Its potency
strongly depends on the extracellular pH and is only weakly affected by the insertion of
the NR1 exon 5 [59, 60]. Finally, ifenprodil displays use dependence such that binding
of glutamate increase biding of ifenprodil and vice versa [61, 62].
There are complex interaction between spermine, proton and ifenprodil at
NMDA receptors. Spermine stimulation may involve relief of protein inhibition [54],
whereas ifenprodil inhibition may involve an increase in proton inhibition [60]. Using
site-directed mutagenesis, identified that a cluster of acidic residues located neat the
exon 5 splice site influence senxitivity to spermine and pH, and also identified a several
redidues in the proximal part of the amino terminus of NR1A that appear to form part of
the ifenprodil binding site. This region, containing the biding sites for spermine and
ifenprodil, may influence the downstream agonist binding domain S1 and S2 that
constitue the glycine binding pocket.
8
4. Relative affinity for ifenprodil highlow low low
Effect of spermine1. Glycine-independent stimulation
3. Voltage-dependent inhibition
no
yes
yes
yes
no
no
no
no2. Glycine-dependent stimulation yes yes no no
Na+
in
Ca2+
out Spermine IfenprodilGly Glu
Spermine
NR1A/NR2A NR1A/NR2B NR1A/NR2C NR1A/NR2D
2
1 4
3
Fig.3 Modulation of NMDA receptors.
Diagram of NMDA receptor is showing effect of spermine ,and ifenprodil .Numbers
indicfate various mavroscopic effects of these modulators . Spermine has 3 macroscopic
effects that are differentially controlled by NR2 subunits.
Indeed, the structures of the agonist binding domains of several glutamate
receptor subunits, including GluR0, GluR2, GluR5, NR1 and NR2A have been
determined by X-ray crystallography, and these domains do indeed form bi-lobed
“clamshell” structures similar to bacterial periplasmic binding proteins [68, 84, 72, 43,
83] . The region of the amino terminus preceding S1 also has sequence similarity and a
predicted structure similar to bacterial periplasmic binding proteins, in particular the
leucine/isoleucine/valine binding protein (LIVBP) [64]. We have termed this region
9
the regulatory (R) domain. Mutations at a number of residues in this region of the
NR1 subunit affect spermine stimulation[64, 94]. This region has also been referred to
as the “amino terminal domain” (ATD or NTD) and the “LIVBP-like domain” [73, 88,
95]. We have suggested that a spermine binding site is located in or near the cleft of the
R domain of the NR1 subunit [64].
Ifenprodil is an atypical NMDA antagonist that binds outside the ion channel
pore and selectively inhibits NMDA receptors containing the NR2B subunit [55, 93]. .
Inhibition by ifenprodil is pH-dependent and, mechanistically, may involve an increase
in tonic proton inhibition [59, 60]. Although it was initially suggested that ifenprodil
is an antagonist at the stimulatory polyamine site, this does not seem to be the case.
There is evidence that spermine and ifenprodil act at discrete sites with an allosteric
interaction [77, 64]. Mutations at several residues in the R domain of NR1 greatly
influenced ifenprodil inhibition, and we have suggested that this region may form part
of the ifenprodil binding site [64]. It has also been reported that mutations at residues
in the R domain of NR2B strongly affect ifenprodil inhibition [89], and it was proposed
that the R domain of NR2B forms the ifenprodil binding site whereas the equivalent
region of NR2A forms a high-affinity Zn2+ binding site, involving several amino acid
residues equivalent to those found at the proposed ifenprodil site in NR2B [88, 89].
In this paper, we have studied binding of radiolabeled spermine and ifenprodil
to purified soluble R domains of NR1, NR2A, and NR2B, to determine whether these
ligands can bind to the isolated R domains and to determine the relationship between
binding to the R domains and the effects at intact, functional receptors. We found that
10
spermine binds to all three domains, but with the highest affinity at NR1-R. Ifenprodil
binds with high affinity to NR1-R and NR2B-R but not to NR2A-R. We also study the
spermine and ifenprodil binding site in NMDA receptor through homology modeling of
NR1A-R and NR2B-R. Through the simulation we found that there are two binding
sites of spermine in NR1A-R and one is into the cleft of the 3D model of NR1A-R the
other on the surface. But in the 3D model of NR2B-R there is only one spermine
binding site. Ifenprodil bound into the cleft of the 3D model of NR2B-R and bound to
surface of the3D model of NR 1A-R. The results suggest that the ligand which bound to
the cleft of the NR-R maybe regulate the NMDA receptor more than to the surface.
11
CHAPTER 1
Materials and methods
12
Plasmids
For production of COOH-terminal histidine-tagged R domain proteins, DNA
fragments encoding NR1(19-380), NR2A(23-389) and NR2B(27-390) (numbering is
from the initiator methionine, thus these constructs lack the signal peptide) were
amplified by polymerase chain reaction (PCR) using primer pairs of
(5’-TATACATATGCGCGCCGCCTGCCGACCC-3’ and
5’-GGTGCTCGAGGATGATCTTCCTGTCAT-3’) for NR1, (5’-TATACATATGCA-
GAACGCGGCGGCG-3’ and 5’-GGTGCTCGAGGATGATCTTCCTGTCAT-3’) for
NR2A and (5’-TAT-ACATATGCGTTCCCAAAAGAGC-3’ and 5’-CTCGAGTGC-
GGCCGCCACATAATACTTCATCTGCAG-3’) for NR2B. The rat NR1A clone,
which lacks the exon-5 insert [21], and rat NR2A and 2B clones [26] were used as
templates. The DNA fragments obtained by PCR were digested with NdeI and XhoI
for NR1 and NR2A, and with NdeI and NotI for NR2B, and inserted into the same
restriction sites of pET29b (Novagen) to construct plasmids pET29b-NR1(19-380),
pET29b-NR2A(23-389) and pET29b-NR2B(27-390). The PCR fragments were
sequenced over the entire length of each fragment, and the sequences correspond to
those in the NR subunit cDNAs.
Purification of R domain proteins
Escherichia coli BL21(DE3) (Novagen) cells carrying pET29b-NR1(19-380),
pET29b-NR1A(19-380, E181Q), pET29b-NR2A(23-389) or pET29b-NR2B(27-390)
were grown in 2 L of modified Luria-Bertani medium (10 g tryptone, 10 g yeast extract
and 5 g NaCl per liter) containing 50 µg/ml kanamycin at 37 ˚C until A600 reached 0.3.
Protein production was induced by 1 mM isopropyl-β-D-thiogalactopyranoside for 4 h.
13
Inclusion bodies were prepared using methods similar to those described by Chen and
Gouaux (1997). Cells were collected by centrifugation, washed once with 10 mM
Tris-HCl, pH 8.0, containing 1 mM MgCl2, and suspended in 100 ml of 20% sucrose
containing 30 mM Tris-HCl, pH 7.5, 10 mM EDTA and 0.1 mg/ml lysozyme. Cells
were kept on ice for 20 min, and spheroplasts were collected by centrifugation at 30,000
g for 30 min. Spheroplasts were resuspended in 200 ml of 50 mM Tris-HCl, pH 7.5,
0.01% Triton X-100, 1 mM dithiothreitol (DTT) and 100 mM KCl, and sonicated for 2
min using an Ultrasonic Disruptor UD201 (TOMY, Tokyo). After treatment of the cell
lysate with 20 µg/ml DNase I plus 10 mM MgCl2 (30 min on ice), inclusion bodies were
collected by centrifugation at 30,000 g for 15 min. Inclusion bodies were resuspended
in 50 ml of buffer (20 mM Tris-HCl, pH 7.5, 6 M guanidine-HCl, 500 mM NaCl, and 5
mM imidazole), kept on ice for 1 h, and centrifuged at 30,000 g for 15 min. The
supernatant contained about 70 mg protein, half of which (about 35 mg protein) was
applied to each of two 5 ml of Ni-NTA columns (Qiagen). After washing with buffer
(20 mM Tris-HCl, pH 7.5, 6 M guanidine-HCl, 500 mM NaCl, and 20 mM imidazole),
R domain proteins were eluted with an elution buffer (20 mM Tris-HCl, pH 7.5, 6 M
guanidine-HCl, 500 mM NaCl, and 100 mM imidazole).
Proteins (100 μg/ml) were refolded through gradual decrease in the
concentration of guanidine-HCl by stepwise dialysis against Buffer 1 [25 mM
Hepes-KOH, pH 7.5, 100 mM KCl, 0.1 mM EDTA, 1 mM dithiothreitol, 10 µM E-64-C,
a thiol protease inhibitor, 10 µM FUT-175, a serine protease inhibitor, 0.5 mM
phenylmethylsulfonyl fluoride (PMSF), 10% glycerol and 0.01% Brij-35] containing 1
M guanidine-HCl, Buffer 1 containing 0.5 M guanidine-HCl, Buffer 1 containing 0.2 M
14
guanidine-HCl, and Buffer 1 at 4 ˚C for at least 4 h each. R domain proteins were
concentrated to approximately 1 mg/ml by ultrafiltration using PM10 filter (Amicon),
and precipitates were removed by centrifugation. Protein concentration was
determined by the method of Lowry et al. (1951). About 20 mg of R domain protein
was obtained from a 2 liter culture. Monomers of the three R domain proteins (41.6
kDa of NR1-R, 42.3 kDa of NR2A-R and 42.7 kDa of NR2B-R) were isolated by gel
filtration using TSK gel G3000SW (2.15 x 67.5 cm) (TOSOH) and Buffer 2 containing
20 mM Tris-HCl, pH 7.5, 0.15 M NaCl, 1 mM dithiothreitol, and 0.01% Brij-35.
Monomers of R domains were eluted at an elution volume of 132 to 152 ml. The
protein was concentrated to approximately 2 mg/ml by ultrafiltration using PM10 filter
(Amicon), and used for the experiments. The percentage of monomer and dimer of
NR1-R, NR2A-R and NR2B-R during the assay was confirmed by gel filtration using
TSK gel G3000SW (0.75 x 30 cm) (TOSOH) and Buffer 2. As a molecular marker,
phosphorylase B (94 kDa), ovalbumin (45 kDa) and lysozyme (14.5 kDa) were used.
Binding of spermine and ifenprodil to R domain proteins
Binding assays were carried out as described previously [66]. The reaction
mixture (0.5 ml) containing 50 to 100 µg R-domain proteins, 10 mM Tris-HCl, pH 7.5,
and 50 mM KCl was preincubated at 30 ˚C for 10 min, and [14C]spermine (463
MBq/mmol, Amersham) or [3H]ifenprodil (15 GBq/mmol, PerkinElmer) was added at 5
to 250 µM for spermine and 0.05 to 0.8 µM for ifenprodil. After incubation at 30 ˚C
for 20 min, the reaction was stopped by addition of 2 ml cold Buffer (10 mM Tris-HCl,
pH 7.5, and 50 mM KCl) and the protein was collected on HAWP02400 filter (0.45 µm,
Millipore). After the filter was washed 2 times with 2 ml of cold Buffer, radioactivity
15
on the filter was measured by a liquid scintillation spectrometer. Blank value (the
level of [14C]spermine or [3H]ifenprodil bound to NR1-R, NR2A-R and NR2B-R in the
reaction mixture kept at 0 ºC) was subtracted from total radioactivity to obtain specific
binding. The dissociation constant (Kd) and maximum binding activity (Bmax) were
calculated from Scatchard plots as described previously [76]. The k1 and k-1 values were
calculated with GraphPad Prism V. 4 (GraphPad software).
Determination of the Kd values of spermine and ifenprodil for NR1-R, NR2A-R
and NR2B-R by CD (circular dichroism) measurements
The CD measurements were performed at 25 ºC using a J-820
spectropolarimeter (Jasco International Co) equipped with a 1.0-mm path-length cuvette.
The samples were scanned from 190 to 250 nm and accumulated 10 times at a
resolution of 0.1 nm with a scanning speed of 50 nm/min and sensitivity of 200 mdeg.
All of the CD data are expressed as molar ellipticity. The concentration of NR1-R,
NR2A-R and NR2B-R used was 0.3-, 0.5- and 0.5 mg/ml, respectively. The buffer
used was the same as that used for binding assay of spermine and ifenprodil.
Increasing amounts of spermine or ifenprodil were added in small aliquots from stock
solutions to 300 μl of protein solution and were allowed to bind for 5 min at room
temperature. The CD spectra of the protein in the absence and presence of increasing
concentrations of spermine (5 - 360 μM) or ifenprodil (0.05 - 2 μM) were recorded. In
this experiment, ifenprodil hemitartrate was used instead of ifenprodil to avoid the
precipitation of proteins. The final change of assay volume was < 3%. The Kd
values were determined according to the double-reciprocal equation plot shown in the
figure.
16
NMDA conloes and site-directed mutagenesis
The NR1 clone used in these studies is the NR1A variant [21], which lacks the
21-amino acid insert encoded by exon 5. This clone was gifts from Dr. S. Nakanishi
(Osaka Bioscience Institute, Osaka, Japan). The wild type mouse and rat NR2B
clones[26,29] were gifts from Drs. M. Mishina (Graduate School of medicine,
University of Tokyo, Tokyo, Japan) and P. H. Seeburg (Center for molecular biology,
University of Heidelberg, Heidelberg, Germany). The preparation of most other NR1
and NR2B mutats has been described previously [64, 65, 67,]. Site-directed mutagenesis
to construct new NR1 and NR2B mutant was carried out by the method of Ho et
al.(1987) using the polymerase chain reaction, with Pfu polymerase purchased from
Stratagene. Amino acids are numbered from the initiator methione in each subunit.
Mutations were confirmed by DNA sequending using a Seq 4´4 personal sequencing
system (Amersham Biosciences) over approximately 300 nuculeotides cotaining the
mutation. Amino acids are numbered from the initiator methione in NR1 and NR2B
clones.
Preparation of oocytes and voltage clamp recording
Adult female Xenopus laevis (Saitama Experimental Animals Supply Co. Ltd.,
Saitama, Japan) were chilled on ice, and the preparation and maintenance of oocytes
were carried out using the methods similar to those described previously [55]. Capped
cRNAs were prepared from linearized cDNA templates using mMessage mMachine kits
(Ambion). Oocytes were injected with NR1 and NR2 cRNAs in a ratio of 1:5 (0.2 - 4
ng of NR1 plus 1 - 20 ng of NR2). Macroscopic currents were recorded with a
17
two-electrode voltage-clamp using Dual Electrode Voltage Clamp Amplifier CEZ-1250
(Nihon Koden, Tokyo). Electrodes were filled with 3 M KCl. Oocytes were
continuously superfused (ca. 5 ml/min) with a Mg2+-free saline solution (96 mM NaCl,
2 mM KCl, 1.8 mM BaCl2, 10 mM HEPES, pH 7.5). This solution contained BaCl2
rather than CaCl2, and in most experiments oocytes were injected with
K+-1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid (BAPTA) (100 nl; 40
mM, pH 7.0) on the day of recording to eliminate Ca2+-activated Cl- currents [55].
Oocytes were voltage-clamped at a holding potential of –20 mV. Data were recorded
by using a Digidata 1322A interface with software pCLAMP8 for Windows (Axon
Instruments, USA). Receptors were activated by superfusion of glutamate and glycine
(10 mM).
Data analysis and cureve fitting were carried out using Axongraph (Molecular
Devices) or SigmaPlot (SPSS Inc., Chicago, IL).
Identification of heterodimer formation of R domain by immunoprecipitation and
Western blot analysis
The reaction mixture (0.3 ml) containing either 45 μg NR1-R, 30 μg NR2A-R,
30 μg NR2B-R, 45 μg NR1-R plus 30 μg NR2A-R or 45 μg NR1-R plus 30 μg NR2B-R,
10 mM Tris-HCl, pH 7.5, 50 mM KCl, and 2 μg of anti-NR1 (sc-9058, Santa Cruz) was
kept at 4 °C for 2 h. Then, antibody-coupled protein was precipitated by addition of 2
μl PANSORBIN® Cells (CALBIOCHEM) and incubation at 4 °C for 2 h. The
precipitate was collected by centrifugation at 30,000 g for 5 min, washed 3 times with
Buffer 3 [0.5 M Na-phosphate buffer, pH 7.5, 100 mM NaCl, 1% Triton-X100 and 0.1%
sodium dodecyl sulfate (SDS)], and boiled for 5 min in SDS-PAGE sample buffer.
18
Western blotting was performed by the method of Nielsen et al. (1982) using 3 μg
protein and ECL Western blotting reagents (GE Healthcare). NR1-R, NR2A-R and
NR2B-R were detected with anti-NR1, anti-NR2A (sc-9056, Santa Cruz), and
anti-NR2B (sc-9057, Santa Cruz). These commercially available antibodies were
raised against epitopes in the first 70 to 300 amino acids of the amino terminus (i.e., the
R domain) of each subunit.
Homology modeling of NR1 and NR2B regulatory domain of NMDA receptor and
docking of spermine and ifenprodil
Three dimensional structures of NR1A-R and NR2B-R were constructed by
homology modeling with the Amber99 force field in MOE (version 2007.09, CCG Inc.,
Montreal, Canada) based on the Brookhaven Protein Databank 1EWK. Furthermore, the
structure of the docking complex between NR1A-R and spermine, NR1A-R and
ifenprodil, NR2B-R and spermine, and NR2B-R and ifenprodil were predicted with
ASEDock of MOE. The resulting three-dimensional structure of each complex was
displayed using MolFeat (Ver. 3.6, FiatLux, Tokyo, Japan).
19
CHAPTER 2
Binding of spermine and ifenprodil to a purified,
soluble regulatory domain of the NMDA receptor
20
Introduction The binding of spermine and ifenprodil to the amino terminal regulatory (R)
domain of the N-methyl-D-aspartate receptor was studied using purified regulatory
domains of the NR1, NR2A and NR2B subunits, termed NR1-R, NR2A-R and NR2B-R.
The R domains were overexpressed in Escherichia coli and purified to near
homogeneity. The Kd values for binding of [14C]spermine to NR1-R, NR2A-R and
NR2B-R were 19, 140 and 33 µM, respectively. [3H]Ifenprodil bound to NR1-R (Kd,
0.18 µM) and NR2B-R (Kd, 0.21 µM), but not to NR2A-R at the concentrations tested
(i.e. 0.1 to 0.8 μM). These Kd values were confirmed by circular dichroism
measurements. The Kd values reflected their effective concentrations at intact
NR1/NR2A and NR1/NR2B receptors. The results suggest that effects of spermine
and ifenprodil on NMDA receptors occur through their binding to the regulatory
domains of the NR1, NR2A and NR2B subunits. The binding capacity of spermine or
ifenprodil to a mixture of NR1-R and NR2A-R or NR1-R and NR2B-R was additive
with that of each individual R domain. Binding of spermine to NR1-R and NR2B-R
was not inhibited by ifenprodil and vice versa, indicating that the binding sites for
spermine and ifenprodil on NR1-R and NR2B-R are distinct.
21
Results Purification of R domain proteins
The regulatory (R) domains of native NMDA receptor subunits are in the
extracellular environment, as is the S1-S2 agonist-binding domain (Fig. 4a), and we
reasoned that the R domains could be expressed and purified as soluble proteins, as has
been reported for S1-S2 fusion proteins from several glutamate receptors [69, 68, 84, 72,
43, 83]. The R domains of NR1, NR2A, and NR2B, comprising the first 360 to 370
amino acids after the signal peptide (Fig. 4b) were subcloned into pET29b with a
histidine tag at their COOH-terminus. These R domain proteins were expressed
separately in E. coli, purified from inclusion bodies using Ni-NTA column
chromatography, and refolded by dialysis. As shown in Fig. 4c, the soluble NR1-R,
NR2A-R and NR2B-R proteins were purified to near homogeneity. The molecular
mass of these proteins on SDS-PAGE is similar to that predicted based on their amino
acid sequences (41.6 kDa of NR1-R, 42.3 kDa of NR2A-R and 42.7 kDa of NR2B-R),
although the mobility of NR2A-R was slightly greater than that of NR1-R and NR2B-R.
In Fig. 4d, the molecular size of these purified R domains in solution is shown.
NR2A-R and NR2B-R mainly consisted of monomer and dimer forms, but NR1-R
contained a polymerized form together with monomers and dimers. The percentage of
the monomer form of NR1-R, NR2A-R and NR2B-R was 37, 73 and 71%, respectively.
The elution profile of NR1-R, NR2A-R and NR2B-R was not influenced by adding 0.1
mM spermine to the elution buffer, suggesting that spermine is not involved in
polymerization or dimerization of each regulatory domain (data not shown). These
preparations were used for subsequent binding assays.
22
kDa
94 -
68 -
45 -
32 -
18 -
14821 27
S1 S2NR2B-RSP M1 M2 M3 M4
390
14641 23
S1 S2NR2A-RSP M1 M2 M3 M4
389
S19381 19
SPS2NR1-R
M1 M2 M3 M4
380
(a)
(c) (d)
Elution Volume (ml) 4 5 6 7 8 9 10
A280
0
0.1
0.2
0.3
Elution Volume (ml) 4 5 6 7 8 9 10
A280
0
0.1
0.2
0.3
Elution Volume (ml) 4 5 6 7 8 9 10
NR2A-R
NR1-R
NR2B-R
A280
0
0.1
0.2
0.3
94k 45k 14.5k
(b)
M2
M3M4 M1
S1 S2agonist
N
C
R-domain NR1
NR2B
NR2A
Fig. 4 Structure and purity of R domain proteins. (a) Schematic of an NMDA receptor
subunit showing the extracellular R and S1-S2 domains, three membrane-spanning domains (M1,
M3, M4), a re-entrant loop (M2) and intracellular C terminus. (b) Schematics of NR1, NR2A, and
NR2B subunits showing the positions of the signal peptides (sp), the R domains used in this study,
the S1 and S2 domains, and the membrane spanning and re-entrant loops (M1-M4). Amino acids
are numbered (above each schematic) from the initiator methionine. (c) Sodium dodecyl
sulfate-polyacrylamide gel electrophoresis of purified R domains (NR1-R, NR2A-R and NR2B-R).
Each lane of the 12% acrylamide gel contained 2 µg protein, and the gel was stained with Coomassie
Brilliant Blue R250. Numbers on the left represent molecular mass in kDa. (d) Gel filtration of
purified R domain proteins used for radioligand binding assays. The pattern indicates the extent of
dimerization and polymerization after the isolation and concentration of the monomer fraction of R
domain proteins. Peaks corresponding to monomers are indicated by an arrow in each panel.
23
Binding of spermine and ifenprodil to R domain proteins
Binding of [14C]spermine to the soluble R domain proteins was determined.
The binding of spermine to NR1-R, NR2A-R and NR2B-R was saturable (Fig. 5, upper
panels), and the Kd values for spermine at these regulatory domains were 19, 140 and
33 µM, respectively (Fig. 5, lower panels). Thus, although spermine can bind to all
three R domains, it binds with highest affinity to NR1-R. Bmax values, which indicate
proportion of active protein, for NR1-R, NR2A-R, and NR2B-R were 6.3, 6.9 and 7.3
nmol/mg R domain protein, which were equivalent to 0.24, 0.29 and 0.32 mol/mol R
domain, respectively. Judging from the percentage of monomer and dimer (Fig. 4d)
and Bmax values for spermine binding (Fig. 5b), spermine may bind to both monomer
and dimer forms of NR1-R, NR2A-R and NR2B-R. The Hill coefficient of spermine
binding to these three R domains was almost 1.0, suggesting that spermine binding to
each R domain is independent, even though dimers can be formed. As a control,
binding of spermine was studied using an unrelated protein, ovalbumin, and a mutant of
NR1-R, E181Q, which drastically reduces spermine stimulation as studied in functional
assays [64]. There was little binding of spermine to ovalbumin, and binding to the
E181Q mutant was reduced compared to the wild-type NR1-R domain (Fig. 5). The
Kd value of spermine at the E181Q mutant was 74 μM compared with 19 μM for wild
type NR1-R. Such a decrease in spermine binding to the E181Q mutant was nearly
parallel with the decrease in spermine stimulation in functional assays [64]. This is
consistent with the proposal that residue E181 forms part of the spermine binding site
on NR1.
24
The Kd value for binding of spermine to the NR2B R domain was also
calculated by determining the association (k1) and dissociation (k-1) rate constants from
studies of the time course of association and dissociation of [14C]spermine (Fig. 6).
Values of k1 were obtained using spermine concentrations of 12.5–100 μM, and values
of k-1 were obtained from dissociation plots after addition of non-labeled 3 mM
spermine. Under these conditions, the association rate was not fully
concentration-dependent. The Kd value was calculated as the average using values of k1
and k-1 at concentrations of 12.5, 25, and 50 μM [14C]spermine. The values for k1 and k-1
were 8500 M-1 min-1 and 0.22 min-1, respectively. Accordingly, the Kd was determined
to be as 25.9 μM, which is similar to the Kd measured in the stauration binding analysis
shown in Fig. 5.
We then measured the effects of spermine on recombinant NMDA receptors
expressed in oocytes to compare the concentration of spermine required to potentiate
intact, functional NMDA receptors with the effects of spermine seen at isolated R
domains. Since spermine stimulation is seen at both NR1/NR2A and NR1/NR2B
receptors in the presence of 10 μM glutamate and 1 μM glycine at pH 7.5 [9], the EC50
values for spermine were measured under these conditions. To minimize
voltage-dependent block by spermine, oocytes were voltage-clamped at -20 mV. As
shown in Fig. 7, the EC50 values for spermine stimulation at NR1/N2A and NR1/NR2B
receptors were 278 µM and 78 µM, respectively. The ratio of EC50 values at NR2A
versus NR2B correlates well with the Kd values for spermine binding, although EC50
values are higher than Kd values.
25
Binding of [3H]ifenprodil to the purified R domain proteins was also studied.
Ifenprodil bound to NR1-R and NR2B-R, but there was no specific binding of 0.1 to 0.8
µM [3H]ifenprodil to NR2A-R. As shown in Fig. 8, binding of ifenprodil to NR1-R
and NR2B-R was saturable, with Kd values of 0.18 µM and 0.21 µM, respectively.
These values were close to the IC50 (0.34 μM) of ifenprodil at NR1/NR2B [55]. Bmax
values for both NR1-R and NR2B-R were 5.6 and 5.2 nmol/mg R domain protein,
which were equivalent to 0.24 and 0.21 mol/mol R domain protein, respectively.
These values were similar to the binding capacity for spermine at these proteins. Hill
coefficient for ifenprodil binding to NR1-R and NR2B-R was almost 1.0, suggesting
that ifenprodil binding on each R domain is independent, even though homodimers can
be formed, and that there is likely one binding site per R domain.
The binding of spermine and ifenprodil to R domain proteins was also
measured by CD. The CD spectra of R domain proteins were analyzed from 190 to
250 nm with increasing concentrations of spermine or ifenprodil, and the shifts of
magnitude at wavelength 208.6 nm reflecting a-helical structure were plotted. As
shown in Figs. 9 and 10, the Kd values of spermine for NR1-R, NR2A-R and NR2B-R
were 20, 133 and 35 μM, respectively, and those for ifenprodil at NR1-R and NR2B-R
were 0.14 and 0.17 μM, respectively. There was no change in the CD spectra of
NR2A-R by 2 μM ifenprodil. The results are similar to those seen in studies with
radiolabeled spermine and ifenprodil and confirm that their binding to NR1-R, NR2A-R
and NR2B-R is saturable and specific.
To determine whether the binding sites for spermine and ifenprodil on
26
individual NR1 and NR2 R domains are altered through an interaction with the R
domains of the other subunits, the binding of spermine and ifenprodil was compared
using NR1-R only, NR2-R only and a mixture of NR1-R and NR2-R. These
experiments were carried out using 20 µM spermine and 0.2 µM ifenprodil. As shown
in Fig. 11, the binding of spermine and ifenprodil was quantitative, being dependent on
the amount of R domain protein (50 to 100 µg). Furthermore, binding of either ligand
to NR1-R and NR2A-R or NR2B-R was simply additive. We also carried out
experiments to confirm that heterodimers of NR1-R + NR2A-R and NR1-R + NR2B-R
do indeed form in solution under these conditions. This was done by
immunoprecipitation with an anti-NR1-R antibody followed by Western blotting with
anti-NR1 or anti-NR2 antibodies (Fig. 12). Although NR2A-R and NR2B-R were not
immunoprecipitated by anti-NR1, these two R domains were coimmunoprecipitated
with NR1-R by anti-NR1, indicating that heterodimer formation between NR1-R and
NR2A-R or NR2B-R does indeed occur after the individual NR1 and NR2 R domains
are added together in solution. The percentage of heterodimer formation was
estimated to be 20 to 40%, which was similar to the percentage of homodimer formation
(see Fig. 4). The results suggest that spermine and ifenprodil bind independently to
each regulatory domain, even when dimer formation occurs. The results are in
accordance with the data showing Hill coefficients of unity for binding of spermine and
ifenprodil to NR1-R and NR2-R (Figs. 5 and 8).
27
0123456
012
345
Spe
rmin
e bo
und/
NR
2A-R
(nm
ol/m
g pr
otei
n)
Spermine (mM)
Spe
rmin
e bo
und/
NR
2B-R
(nm
ol/m
g pr
otei
n)
Spermine (mM) 0 20 40 60
(a) (b) (c) NR1-R NR2A-R NR2B-R
012
345
Spe
rmin
e bo
und/
NR
1-R
(nm
ol/m
g pr
otei
n)
Spermine (mM) 0 100 200 300 0 40 80 120
Kd = 32.5 mM
Spermine bound/NR1-R(nmol/mg protein)
Spermine bound/NR2A-R(nmol/mg protein)
Spermine bound/NR2B-R(nmol/mg protein)
SP
M b
ound
/NR
1-R
/[SP
M]
(nm
ol/m
g pr
otei
n/mM
)
SP
M b
ound
/NR
2A-R
/[SPM
](n
mol
/mg
prot
ein/mM
)
SP
M b
ound
/NR
2B-R
/[SPM
](n
mol
/mg
prot
ein/mM
)
Hill coefficient =1.005 Hill coefficient =1.003 Hill coefficient =0.998
0
0.1
0.2
0.3
0.4
0 1 2 3 4 5 6 7 0 1 2 3 4 5 6 70
0.01
0.02
0.03
0.040.05
0
0.1
0.2
0.3
0 1 2 3 4 5 6 7 8
Ovalbumin
NR1-R,Kd = 18.5 mM
NR2A-R,Kd = 140 mM
NR1-R
NR1-R (E181Q)
NR2A-R
NR2B-R,
Fig. 5 Binding of spermine to R domain proteins.
Saturation isotherms (upper panels) and Scatchard plots (lower panels) of the binding of
[14C]spermine to NR1-R (a), NR2A-R (b), and NR2B-R (c). The Hill coefficient was
calculated from the plot of the logarithmic form of a Hill equation. Binding of
[14C]spermine to NR1-R (E181Q) and that to ovalbumin was also shown in upper
figures of (a) and (b), respectively. Values are means ± S. D. from three experiments.
SPM, spermine.
28
Fig. 6 Time course of [14C]spermine binding to NR2B-R and its dissociation by
nonlabeled 3 mM spermine.
The binding assay was performed using 12.5 (), 25 (), 50 () and 100 () μM
[14C]spermine as substrate, and nonlableled 3 mM spermine was added to the reaction
mixture at 16 min after the onset of incubation. [14C]spermine bound to NR2B-R was
measured as described in Materials and methods. Values are means ± S. D. from three
experiments.
29
1.0
1.4
1.6
1.8
2.0
1.2
2.4
2.2
1 10 100 1000 10000
Stim
ulat
ion
by s
perm
ine
(-fol
d)
(1 µ
M G
ly, 1
0 µM
Glu
)
NR1/NR2BNR1/NR2A
Spermine (µM)
(EC50 = 278 µM) (EC50 = 78 µM)
Fig. 7 Effects of spermine at intact, functional NMDA receptors.
The effects of spermine on currents induced by glutamate and glycine at NR1/NR2A (○)
and NR1/NR2B (●) were measured in oocytes expressing recombinant receptors and
voltage clamped at –20 mV. Values are mean ± S. D. from five experiments. The
Hill coefficients for spermine at NR1/NR2A and NR1/NR2B were 1.17 and 1.05,
respectively.
30
Ifenp
rodi
lbou
nd/N
R2B
-R(n
mol
/mg
prot
ein)
(b)
Ifenprodil (mM)
Ifenp
rodi
l bou
nd/N
R1-
R(n
mol
/mg
prot
ein)
(a)
Ifenprodil (mM)
0
1
2
3
4
5
0 0.2 0.4 0.6 0.80
1
2
3
4
5
0 0.2 0.4 0.6 0.8
NR1-R NR2-RHill coefficient =0.984 Hill coefficient =1.001
Ifenp
rodi
l bou
nd/N
R2B
-R/[I
fenp
rodi
l](n
mol
/mg
prot
ein/mM
)
(nmol/mg protein) Ifenprodil bound/NR2B-R
Ifenp
rodi
l bou
nd/N
R1-
R/[I
fenp
rodi
l](n
mol
/mg
prot
ein/mM
)
(nmol/mg protein) Ifenprodil bound/NR1-R
05
101520253035
0 1 2 3 4 5 60
5
10
15
20
25
0 1 2 3 4 5 6
NR1-R,Kd = 0.18 mM
NR2B-R,Kd = 0.21 mM
NR2A-R
NR2B-R
Fig. 8 Binding of ifenprodil to NR1-R and NR2-R.
Saturation isotherms (upper panels) and Scatchard plots (lower panels) of the binding of
[3H]ifenprodil to NR1-R (a) and NR2B-R (b). The Hill coefficient was calculated
from the plot of the logarithmic form of a Hill equation. Binding of [3H]ifenprodil to
NR2A-R is also shown in upper figure of (b). Values are means ± S. D. from three
experiments.
31
0
5
10
15
20
25
Θ (x
104
degc
m2 d
mol
e-1)
Spermine (mM) 0 100 200 300 400
Kd = 133 mM
0.01 0.02 0.03 0.04-0.01
(a) NR2A-R(b) NR2B-R
0
10
20
30
40
50
Spermine (mM) 0 100 200 300 400Θ
(x10
4de
gcm
2 dm
ole-1
)
-0.04 0.04 0.08 0.12
Kd = 35.0 mM
NR1-R (c)
[Spermine]-1 (mM)-1 [Spermine]-1 (mM)-1
[Shi
ft in
ellip
ticity
] -1
[x10
-6de
gcm
2 dm
ole-1
]-1
[Shi
ft in
ellip
ticity
] -1
[x10
-6de
gcm
2 dm
ole-1
]-1
0
10
20
30
40
0 20 40 60 80Θ (x
104
degc
m2 d
mol
e-1)
Spermine (mM)
2468
12
-0.1 0.1 0.2 0.3
10
[Shi
ft in
ellip
ticity
] -1
[x10
-6de
gcm
2 dm
ole-1
]-1
Kd = 20.0 mM
[Spermine]-1 (mM)-1
4
8
12
16
20
2
4
6
8
10
Fig. 9 Measurement of the Kd values for spermine at NR1-R, NR2A-R and
NR2B-R by CD.
CD measurements were performed as described in Materials and methods.
Concentration-dependent effects of spermine on shifts of magnitude at 208.6 nm are
shown in the upper panels, and the Kd values of spermine were determined from
double-reciprocal plots as shown in the lower panels. Values are mean ± S. D. from
three experiments.
32
0
4
8
12
16
0.5 1.0 1.5 2.0 2.50
(a) NR1-R
Θ (x
104
degc
m2 d
mol
e-1)
Ifenprodil (mM)
5
10
15
20
25
-10 -5 5 10 15
Kd = 0.14 mM
[Ifenprodil]-1 (mM)-1
[Shi
ft in
ellip
ticity
] -1
[x10
-6de
gcm
2 dm
ole-1
]-1
(b) NR2B-R
Θ (x
104
degc
m2 d
mol
e-1)
Ifenprodil (mM)
0
10
20
30
0.5 1.0 1.5 2.0 2.50
[Ifenprodil]-1 (mM)-1
[Shi
ft in
ellip
ticity
] -1
[x10
-6de
gcm
2 dm
ole-1
]-1
2468
101214
-10 -5 5 10 15 20 25
Kd = 0.17 mM
Fig. 10 Measurement of the Kd values of ifenprodil for NR1-R, and NR2B-R by
CD.
CD measurements were performed as described in Materials and methods.
Concentration-dependent effects of ifenprodil on shifts of magnitude at 208.6 nm are
shown in the upper panels, and the Kd values of ifenprodil were determined from
double-reciprocal plots as shown in the lower panels. Values are mean ± S. D. from
three experiments.
33
[3H
]Ifen
prod
il bo
und
(pm
ol)
NR1-R NR2A-R NR2B-R
50 (mg) 100 50 100 50 100
NR1-R + NR2A-R
NR1-R + NR2B-R
50 + 50 50 + 50
[14 C
]Spe
rmin
e bo
und
(pm
ol)
NR1-R NR2A-R NR2B-R
50 (mg) 100 50 100 50 100
NR1-R + NR2A-R
NR1-R + NR2B-R
50 + 50 50 + 50
(a)
(b)
0
100
200
300
400
0
100
200
300
400
Spermine
Ifenprodil
Fig. 11 Binding of spermine and ifenprodil to various combinations of R domain
proteins.
Binding was measured using 50 to 100 µg of NR1-R NR2A-R or NR2B-R, alone or in
combination. The concentrations of [14C]spermine and [3H]ifenprodil were 20 µM and
0.2 µM, respectively. Values are means ± S. D. from three experiments.
34
NR1 NR2A NR2B NR1+NR2A
NR1+NR2B
Anti-NR1
Anti-NR2A
Anti-NR2B
Immunoprecipitation with anti-NR1 Detection by
Western blotting
Fig.12 Identification of heteromer formation of R domains by
immunoprecipitation followed by Western blot analysis.
The R domains shown in the figure were immunoprecipitated by anti-NR1 as described
in Materials and methods. Immunoprecipitated protein was detected by Western blot
analysis using anti-NR1, anti-NR2A and anti-NR2B. Experiments were repeated twice,
and essentially the same results were obtained.
35
Distinct binding sites for spermine and ifenprodil on NR1-R and NR2B-R
Experiments were carried out to determine if there are interactions between
spermine and ifenprodil on the purified NR1-R protein. As shown in Table 1, binding
of spermine to NR1-R was inhibited by nonlabeled spermine and spermidine, but not by
tribenzylspermidine (TB-34), a polyamine derivative that is a potent NMDA channel
blocker but does not have effects at the stimulatory polyamine site [74]. Binding was
also unaffected by agonists (glycine and glutamate) that bind in the S1-S2 domains, and
by ifenprodil. The binding of ifenprodil to NR1-R was inhibited by nonlabeled
ifenprodil, but not by agonists or by spermine and spermidine (Table 1). Similarly, the
binding of spermine to NR2B-R was inhibited by nonlabeled spermine and spermidine,
but not by agonists and ifenprodil, and that of ifenprodil was inhibited by nonlabeled
ifenprodil, but not by agonists and spermine and spermidine (Table 2). The results
indicate that spermine and ifenprodil bind to distinct sites on NR1-R and NR2B-R.
36
Table 1 Spermine and ifenprodil binding to purified NR1-R
[14C]Spermine bound [3H]Ifenprodil bound Addition
nmol/mg protein % nmol/mg protein %
None
Spermine (300 µM)
Spermidine (1 mM)
Tribenzylspermidine (100 µM)
Ifenprodil (10 µM)
Glycine (100 µM)
Glutamate (100 µM)
3.20
0.08
0.09
3.28
2.83
3.23
3.45
±
±
±
±
±
±
±
0.23
0.01
0.02
0.21
0.25
0.24
0.27
100
3
3
103
88
101
108
2.98
2.63
2.71
0.27
3.15
2.88
±
±
±
±
±
±
0.17
0.14
0.17
0.01
0.16
0.19
100
88
91
n.d.
9
106
97
The concentration of [14C]spermine and [3H]ifenprodil used for the binding assay was
20 µM and 0.2 µM, respectively. Where indicated, nonlabeled spermine (300 µM),
spermidine (1 mM), tribenzylspermidine (100 µM), ifenprodil (10 µM), glycine (100
µM) or glutamate (100 µM) was added to the reaction mixture. Data are shown as mean
± S. E. from three experiments. n.d., not determined
37
Table 2 Spermine and ifenprodil binding to purified NR2B-R
[14C]Spermine bound [3H]Ifenprodil bound Addition
nmol/mg protein % nmol/mg protein %
None
Spermine (300 µM)
Spermidine (1 mM)
Ifenprodil (10 µM)
Glycine (200 μM)
Glutamate (200 μM)
3.85
0.28
0.25
4.14
3.89
3.93
±
±
±
±
±
±
0.38
0.05
0.04
0.36
0.41
0.40
100
7
6
108
101
102
3.21
3.17
3.15
0.48
3.27
3.31
±
±
±
±
±
±
0.22
0.40
0.31
0.09
0.32
0.34
100
99
98
15
102
103
The concentration of [14C]spermine and [3H]ifenprodil used for the binding assay was
40 µM and 0.4 µM, respectively. Where indicated, nonlabeled spermine (300 µM),
spermidine (1 mM), ifenprodil (10 µM) glycine (200 μM) or glutamate (200 μM) was
added to the reaction mixture. Data are shown as mean ± S. E. from three
experiments.
38
Effect of aminoglycosides on spermine binding to R domain proteins
We have previously shown that a number of aminoglycosides potentiate
macroscopic currents at heteromeric NR1/NR2B receptors, probably through binding to
a stimulatory polyamine site on the receptor [82]. As shown in Fig. 13, binding of
spermine to NR1-R, NR2A-R and NR2B-R was inhibited by neomycin B,
paromomycin, kanamycin A and streptomycin, consistent with the idea that
aminoglycosides act at the stimulatory polyamine binding sites on the R domains of
NR1, NR2A and NR2B. The magnitude of inhibition of spermine binding to R
domain proteins by aminoglycosides paralleled potentiation of intact NR1/NR2B
receptors by aminoglycosides measured in functional studies, and occurred at similar
concentrations of aminoglycosides [82].
39
[14 C
]Spe
rmin
e bo
und
(nm
ol/m
g pr
otei
n)
1
2
3
0
75 mM 150 mM 300 mM
NR1-R NR2A-R NR2B-R4
Fig. 13 Effect of aminoglycosides on spermine binding to R domain proteins.
Binding of [14C]spermine was measured in the presence and absence of
aminoglycosides (75 to 300 µM) as described in Materials and methods.
[14C]Spermine used was 20 µM. Values are means ± S. D. from three experiments.
40
Discussion Several studies have reported the purification and properties of soluble S1-S2
domains of AMPA and kainate receptor proteins [69, 71]. The same approach has been
applied to NMDA receptor subunits. The characteristics of the glycine binding site on
the NR1 subunit have been reported from studies using a purified soluble S1-S2 domain
[75] and a membrane-bound fusion protein containing the entire extracellular portion (R
domain plus S1-S2) of NR1 [86]. In more recent studies, some characteristics of an
ifenprodil binding site on NR2B have been described using a purified soluble NR2B R
domain [89, 95]. We have used a similar approach to study the binding sites for
spermine and ifenprodil on the R domains of NR1 and NR2 subunits. These studies
indicate that spermine and ifenprodil can differentially bind to these domains. The
experiments led to several interesting findings as discussed below.
We found that spermine bound to the R domains of all three NMDA receptor
subunits. The affinity for spermine was NR1-R > NR2B-R > NR2A-R; the Kd values
for spermine at NR1-R, NR2A-R and NR2B-R were 19, 140 and 33 μM, respectively.
The results suggest that spermine stimulation of NR1/NR2A and NR1/NR2B may be
caused through spermine binding to the R domain of NR2A and NR2B together with
binding to the R domain of NR1. It is notable that the potency of spermine as
determined in functional assays was 3- to 4-fold lower at NR1/NR2A receptors (EC50,
278 µM) than at NR1/NR2B receptors (EC50, 78 µM), which correlates with the 4-fold
lower affinity for spermine of the NR2A R domain (Kd, 140 µM) compared to the
NR2B R domain (Kd, 33 µM). In any event, the results indicate that there are discrete
41
spermine binding sites on the three different R domain proteins, and are consistent with
our previous mutagenesis studies that identified residues important for spermine
stimulation in the R domains of NR1 and NR2B [63,64].
The results demonstrate that ifenprodil binds to NR1-R and NR2B-R, but not
to NR2A-R. It has been reported that mutations at several residues in NR2B-R greatly
reduced sensitivity to ifenprodil [89]. These residues were in positions analogous to
residues in the NR2A subunit that affect sensitivity to Zn2+ and may form a Zn2+ binding
site on NR2A[94]. In the same report, ifenprodil was shown to retard protease
digestion of a soluble NR2B-R domain (residues 28 to 375) but not of an NR2A R
domain [89]. It was concluded that ifenprodil binds within the cleft of the bi-lobed R
domain of NR2B, analogous to binding of Zn2+ in the cleft of the NR2A R domain [89].
In this context, it should be noted that NR2A-R moves more rapidly on an SDS
polyacrylamide gel compared with NR1-R and NR2B-R (see Fig. 4), even though the
molecular masses of three regulatory domains were almost identical. This suggests
that the overall structure of NR2A-R may be different from that of NR1-R and NR2B-R,
accounting for differences in the binding sites for Zn2+ and ifenprodil even though these
two apparent binding sites share many homologous residues in NR2A and NR2B [88,
89].
In the present study, we observed binding of [3H]ifenprodil to NR1-R and
NR2B-R but not to NR2A-R. The Kd values for binding of ifenprodil to NR1-R and
NR2B-R (0.18 and 0.21 μM, respectively) were similar to the IC50 for ifenprodil
inhibition at intact, functional NR1/NR2B receptors (0.34 μM at pH 7.6) [55]. It has
42
also been reported that the binding constant for ifenprodil at NR2B-R was
0.13–0.17 μM when measured by circular dichroism [95] , a finding that we also
replicated in the current study. The finding that [3H]ifenprodil binds to NR1-R is
consistent with our previous finding that mutations in this region of the NR1 subunit
affect sensitivity to ifenprodil [64]. Although other reports have localized an ifenprodil
binding site to NR2B-R [89], our results suggest that the R domain of NR1 is also
capable of forming an ifenprodil binding site with a high affinity, similar to NR2B-R.
The finding that ifenprodil can bind to the R domain of NR1 is consistent with the high
affinity inhibition by ifenprodil of apparent "homomeric" NR1 receptors expressed in
oocytes [55]. It has been proposed that these receptors are not truly NR1 homomers and
that an endogenous 'NR2-like'Xenopus subunit can combine with NR1 to form these
receptors [100]. However, another study [101] has convincingly shown that this
endogenous subunit does not contribute to the formation of 'homomeric' NR1 receptors
in Xenopus oocytes, and the true nature of such receptors (NR1 homomers or NR1/NRX
heteromers) remains unresolved. There is no evidence for expression of functional
homomeric NR1 receptors in vivo, and ifenprodil appears to produce high affinity
inhibition (Kd less than 1 μM) only at heteromeric NR1/NR2 receptors containing
NR2B. Thus, even though the NR1 R domain is capable of forming a high affinity
ifenprodil binding site, the affinity for ifenprodil or the coupling of binding to channel
activity may be reduced in heteromeric receptors containing NR2A, NR2C, and NR2D,
but retained in receptors containing NR2B.
The results from this study are consistent with the idea that spermine and
ifenprodil act at distinct binding sites on the NMDA receptor [77, 64]. Amino acid
residues involved in ifenprodil inhibition in NR1-R and NR2B-R were mainly located
43
between residues 80 and 200[64, 89]. On the other hand, amino acid residues that
influence spermine stimulation in NR1 and NR2B were mainly located between
residues 170 and 350 [63, 64]. It may be that spermine binds within the cleft of the R
domain similar to polyamine binding to the bacterial protein PotD [90, 64]. In that case,
ifenprodil may bind to another site within the cleft [89] or elsewhere on the R domain.
Even though spermine and ifenprodil have separate binding sites, there are interactions
(presumably allosteric) between these two ligands at intact receptors [77].
44
CHAPTER 3
Modeling of NR1A and NR2B
regulatory domain of the NMDA receptor
45
Introduction NMDA receptor function is modulated by a wide variety of compounds such
as polyamine, proton and ifenprodil, and findings show that the biding sites for these
modulators are found in the amino teminal domain of such receptors. In our previously
studies suggest that the biding sites of spermine and ifenprodil are on the R domain of
NMDA receptor. The R domain of NMDA receptors have not been crystallized but it
has been noted that there is homology with other periplasmic binding proteins (LIVBP),
polyamine binding protein (Pot D) and metabotropic glutamate receptors (mGluRs). In
the present study, the construction of a three-dimensional model of the NR1A-R and
NR2B-R is described using the closed agonist-binding domain of mGluR1 and docking
the R domain with spermine and ifenprodil. Through the simulation we found that there
are two binding sites of spermine in NR1A-R and one is into the cleft of the 3D model
of NR1A-R the other on the surface. But in the 3D model of NR2B-R there is only one
spermine binding site. Ifenprodil bound into the cleft of the 3D model of NR2B-R and
bound to surface of the3D model of NR 1A-R. The results suggest that the ligand which
bound to the cleft of the NR-R maybe regulate the NMDA receptor more than to the
surface.
46
Results Determination of amino acid residues at the R domain of NR1A and NR2B which
are involved in spermine stimulation at -20mV
Spermine is polycationic and we hypothesized that the amino groups of
spermine may interact with acidic residues on NMDA receptor subunits, as has been
found for the interaction of polyamines with the bacterial polyamine binding protein
PotD[64]. We previously found that mutations at NR1 (E181) and NR1 (E342)
influence spermine stimulation. In this study we made a series of individual point
mutations in the R domain of NR1A and NR2B. We screen each mutation by measuring
spermine stimulation at -20mV with 100 mM spermine [63, 64]. If spermine stimulation
decreased³20% in the mutants compared with those of wild type NMDA receptor, it is
judged that mutant amino acid residues are involved in spermine stimulation,
respectively.
Results on NR1A and NR2B mutants are shown in Fig. 14 and 16. Mutations at
the acidic residues of NR1A near NR1 (E181) and NR1 (E342) have a strong effect on
spermine stimulation. It suggests that there are two spermine binding sites in NR1A-R.
Mutation at acidic residues from 190-210 of NR2B show a strong effct on spermine
stimulation and indicate that there is one spermine binding site in NR2B-R.
Determination of amino acid residues at the R domain of NR1A and NR2B which
are involved in ifenprodil inhibition at -20mV
Ifenprodil is an atypical noncompetitive antagonist at the NR1/NR2B NMDA
receptor. We previously found that mutations at NR1 (D130) influence ifenprodil
47
inhibition [64]. In this study we screen each mutation by measuring ifenprodil inhibiton
at -20mV with 1 mM ifenprodil. If ifenprodil inhibition decreased³150% in the mutants
compared with those of wild type NMDA receptor, it is judged that mutant amino acid
residues are involved in ifenprodil inhibition, respectively.
Results on NR1A and NR2B mutants are shown in Fig. 15 and 17. Mutations
at the amino acid residues from 100 to 134 of NR1A near NR1 (D130) have a strong
effect on ifenprodil inhibition. It suggests that there is a ifenprodil binding sites in
NR1A-R. Mutation from 100 to 114 amino acid residues of NR2B show a strong effct
on ifenprodil inhibition and that indicate there is one ifenprodil binding site in NR2B-R.
Molecular modeling of the NR1A-R and NR2B-R and docking of spermine and
infenprodil
We built a 3D model of the R domain of NR1A and NR2B using the
agonist-binding domain (ABD) of the metabotropic glutamate receptor mGluR1 as a
template(PDB code 1EWK:A) [96]. Three dimensional structures of NR1A-R and
NR2B-R were constructed by homology modeling with the Amber99 force field in
MOE (version 2007.09, CCG Inc., Montreal, Canada). 3D model were generated using
the alignment shown in Fig. 18. Because the sequence identity between NR1A or NR2B
and mGlur1 ABD is very low (~18%), we base our alignment according to known
(mGluR1 ABD) and predicted NR1A-R and NR2B-R secondary structure elements (Fig.
18) . However , because the sequence of the NR1A-R and NR2B share such a low
sequence with mGluR1 ABD, the orientations of residues side-chains are rather
imprecise. Thorough functional validation of these model are therefore mandatory to
48
comfirm its biological relevance.
Furthermore, the structure of the docking complex between NR1A-R and
spermine, NR1A-R and ifenprodil, NR2B-R and spermine, and NR2B-R and ifenprodil
were predicted with ASEDock of MOE. The resulting three-dimensional structure of
each complex was displayed using MolFeat (Ver. 3.6, FiatLux, Tokyo, Japan). We
found that there are two spermine binding sites in the 3D model of NR1A-R, one binds
into the cleft of the 3D model of NR1A shown in Fig. 19 and the other binds on the
surface. While there is only one ifenprodil binding site on the surface of 3D model of
NR1A-R. These results indicate that there are two spermine binding sites and one
ifenprodil biding site at NR1A-R, respectively. We also found that there is one
sepermine binding site in the surface and one ifenprosil binding site in the cleft of the
3D model of NR2B-R. This result incicates that there is one spermine and one
ifenprodil binding site at NR2B-R, respectively.
49
0 50 100 150 200 250
E188QR187AE186QE185QE181QE172QD170ND169NW160LW160FY158LE153QW151LH146SY144LF137L
H134SS132AK131LD130NS129AY128AS126AY114LF113LT110AY109LS108LF102L
H101SD100N
Y88LD81NE80QS77AK68AS64AV46AE44QF42AE39QT35AD23N
WT
% of control
0 50 100 150 200 250
E387QE385QD376NY367LY351LF348AD345ND343NE342QF340AE339QD332NY330LY330FF321LW315LW315FD303NE299QE297QE294QD283NE277QD264NY261LE253QE251QW247LD227ND226NE225QE215QE213QE210QD198NF197L
E192QWT
% of control
Fig. 14 Effects of spermine at mutate NMDA receptors in NR1A.
Effect of spermine (100 mM) were detemined in oocytes expressing NR1A/NR2B
receptors with wild-type or mutant NR1A subunits, voltage-clamped at -20mV and
activate by 10 mM glutamate and 10 mM glycine . Values are mean ±S.E.M. from 20
oocytes for wild type and four oocytes for each mutant. Wild type are shown by red
boxes. Mutations that reduced stimulation by ³20% compared with wild type are shown
in yellow boxes.
50
0 50 100 150
E188QR187AE186QE185QE181QE172QD170ND169NW160LW160FY158LE153QW151LH146SY144LF137L
H134SS132AK131LD130NS129AY128AS126AY114LF113LT110AY109LS108LF102L
H101SD100N
Y88LD81NE80QS77AK68AS64AV46AE44QF42AE39QT35AD23N
WT
% of control0 50 100 150
E387QE385QD376NY367LY351LF348AD345ND343NE342QF340AE339QD332NY330LY330FF321L
W315lW315FD303NE299QE297QE294QD283NE277QD264NY261LE253QE251QW247LD227ND226NE225QE215QE213QE210QD198NF197L
E192QWT
% of control
Fig. 15 Effects of ifenprodil at mutate NMDA receptors in NR1A.
Effect of ifenprodil (1 mM) were detemined in oocytes expressing NR1A/NR2B
receptors with wild-type or mutant NR1A subunits, voltage-clamped at -20mV and
activate by 10 mM glutamate and 10 mM glycine . Values are mean ±S.E.M. from 20
oocytes for wild type and four oocytes for each mutant. Wild type is shown by red box.
Mutations that reduced inhibition by ³150% compared with wild type are shown in
yellow boxes.
51
0 50 100 150 200 250
K234LP226SQ224HN218VI216T
S214LD213LD210NL209FM207TD206NL204TE201QE200QE198QW197LE191QF182LD181NF176LY167LD165NE162QE151QF146LE139QD138ND136NS131LH127SS116AF114LD113ND101AE106QL70AE69QS63AF59LD46NS34A
WT
% of control0 50 100 150 200 250
E449QE448QD447NE443QE374QE370QK361AY356AD354NE353QF351LN348DE345QF344AY338FR337KR337AR337QS332LY330TI329AE326QS319AE316QE310KD306SP290EG288SS271KT268LD265NT255FY254HG253DV247FN245RV243EE242LF241LY239LT238V
WT
% of control
Fig. 16 Effects of spermine at mutate NMDA receptors in NR2B.
Effect of spermine (100 mM) were detemined in oocytes expressing NR1A/NR2B
receptors with wild-type or mutant NR2B subunits, voltage-clamped at -20mV and
activate by 10 mM glutamate and 10 mM glycine . Values are mean ±S.E.M. from 20
oocytes for wild type and four oocytes for each mutant. Wild type are shown by red
boxes. Mutations that reduced stimulation by ³20% compared with wild type are shown
in yellow boxes.
52
0 50 100 150
E449QE448QD447NE443QE374QE370QK361AY356AD354NE353QF351LN348DE345QF344AY338FR337KR337AR337QS332LY330TI329A
E326QS319AE316QE310KD306SP290EG288SS271KT268LD265NT255FY254HG253DV247FN245RV243EE242LF241LY239LT238V
WT
% of control0 50 100 150
K234LP226SQ224HN218V
I216TS214LD213LD210NL209FM207TD206NL204TE201QE200QE198QW197
E191QF182LD181NF176L
Y167LD165NE162QE151QF146LE139QD138ND136NS131LH127SS116AF114LD113NT103AD101AE106Q
T76CL70AE69QS63AF59LD46N
V42AS34A
WT
% of control
Fig. 17 Effects of ifenprodil at mutate NMDA receptors in NR2B.
Effect of ifenprodil (1 mM) were detemined in oocytes expressing NR1A/NR2B
receptors with wild-type or mutant NR2B subunits, voltage-clamped at -20mV and
activate by 10 mM glutamate and 10 mM glycine . Values are mean ±S.E.M. from 20
oocytes for wild type and four oocytes for each mutant. Wild type is shown by red box.
Mutation that reduced inhibition by ³150% compared with wild type are shown in
yellow boxes.
53
RKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIR -------------KPIAGVIGPGKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLI SSQVYAILVSHPPTPNSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTD
SSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRQEAIAQILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQD
13199
104
mGluR1NR1ANR2B
239174181
mGluR1NR1ANR2B
GMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSAAQKRLETLLEERE-------SKAEKVLQFDPGTKNVTALLMEAREL-EARVIILSASEDDAATVYRAAAMLNMTGSGYFVNKIRSTIENS----FVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTW
mGluR1NR1ANR2B
313245256
LIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENVWLVGEREISGNAL---------RYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKIVPSLVAGTDTVPSEFPTGLISVSYDEWD-------YGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHEKRIY
mGluR1NR1ANR2B
387313330
PNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMKYYV
mGluR1NR1ANR2B
450380390
Fig. 18 Multiple amino acid sequence alignment of NR1A-R and NR2B-R with the
agonist-binding domain of mGluR1.
The indicated a-helix (red) and b-strands (blue) of mGluR1 are from the X-ray structure
of the agonist-binding domain of mGluR1 (PDB: 1EWK: A). Secondary structure
elements of NR1A-R and NR2B-R and the sequence alignment s were predicated using
MOE.
54
SPM
Ifenprodil
SPM
Fig. 19 3D model of spermine and ifenprodil binding into the R-domain of NR-1A.
The 3D model of NR1A-R shows a projected structure based on the known crystal
structure of agonist-binding domain of mGluR1.
55
SPM
Ifenprodil
Fig. 20 3D model of spermine and ifenprodil binding into the R-domain of NR-2B.
The 3D model of NR2B-R shows a projected structure based on the known crystal
structure of agonist-binding domain of mGluR1.
56
Discussion Several studies have reported the homology modeling of R domain of the
NMDA receptors. [97, 98, 99] In more recent studies NR1A-R or NR2B 3D model was
described with periplasmic binding proteins (LIVBP) and metabotropic glutamate
receptors (mGluRs) as template. [97, 98, 99] Their studies on homology modeling show
that ifenprodil binds into the cleft of the NR2B-R. We have used a similar approach to
study the homology modeling of NR1A-R and NR2B-R, then spermine and ifenprodil
were docked into the homology model. In our study we found that there are two
spermine binding sites ( one is on surface and the other is into the cleft of NR1A-R 3D
model) and one ifenprodil binding site at NR1A-R, but one spermine binding site on the
surface and one ifenprodil biding site into the cleft of NR2B-R 3D model. It is reported
that ifenprodil is a novel NMDA antagonist that selectively inhibits NR1/NR2 receptors
containing the NR2B subunit and binding of ifenprodil into the cleft of NR2B-R
controls the high-affinity ifenprodil inhibition. [98, 99] It suggest that binding into the
cleft will get a more conformation change of the NMDA receptor than biding on surface.
Therefore our results suggest that it is important for sepermine binding to NR1A-R
because one spermine binding site is in the cleft. It also indicates that it is important for
ifenprodil biding to NR2B-R.
57
REFERENCES
[1] Choen SS (1998) A guide to polyamines, Oxford University Press, New York.
[2] Igarashi K and Kashiwagi K (2000) Polyamine: mysterious modulators of
cellular functions. Biochem Biophys Res Commun 271: 559-564
[3] Igarashi K and Kashiwagi K (2006) Polyamine modulon in Escherichia coli:
genes involved in the stimulation of cell growth by polyamines. J biochem
(Tokyo) 139: 11-16
[4] Wallace HM, Fraser AV, and Hughes A (2003) A perspective of polyamine
metabolism. Biochem J 376: 1-14
[5] Williams, K. (1997) Interactions of polyamines with ion channels. Bicochem J
325: 289-297
[6] Williams, K. (1997) Modulation and block of ion channels: a new biology of
polyamines-regulation and molecular interaction. Cell. Signal 9: 1-13
[7] Marton, L., Edewards, M., Levin, V., Lubich, W. and Wilxon, C. (1979)
Predictive value of cerebrospinal fluid polyamines in medulloblastoma. Cancer
Research 39, 993-997.
[8] Masuko, T., Kusama-Eguchi, K., Salata, K., Kusama, T., Chaki, S., Okuyama,
S., Williams, K., Kashiwagi, K. and Igarashi, K. (2003) Polyamine transport,
accumulation, and release in brain. J. Neurochem. 84: 610-617
[9] Williams, K., Zappia, M. A., Pritchtt, B.D., Shen, M. Y. and Moinoff, B. P.
(1994) Sensitivity of the NMDA receptor to polyamines is controlled by NR2
subunits. Mol. Phamacology 45: 803-809
[10] Willams, K. (1994) Mechanisms influencing stimulatory effects of spermine at
recombinatant NMDA receptors. Mol. Phamacology 46: 161-168
58
[11] Benveniste M, Mayer ML (1993) Multiple effects of spermine on NMDA
receptors responses of rat cultured hippocampal neurons. J physiol. 464:
131-163.
[12] Rock, D. M., and R. L. MacDonald. (1992) The polyamine spermine has
multiple actions on N-methyl-D-aspartate receptors single-channel currents in
cultured cortical neurons. Mol. Pharmacology. 41: 83-88
[13] Rock, D. M., and R. L. MacDonald. (1992) Spermine and related polyamines
produce a voltage-dependent reduction of N-methyl-D-aspartate receptor
single-channel conductance. Mol. Pharmacology. 42: 157-164
[14] Lerma, J. (1992) Spermine regulates N-methyl-D-aspartate receptor
desensitization. Neuron 8: 343-352
[15] Zheng, X., Zhang, L., Durand, G. M., Bnnentt, M. V. L. and Zukin, R. S.
(1994) Mutagenesis rescues spermine and Zn2+ potentiation of recombinant
NMDA receptors. Neuron 12: 811-818.
[16] Bliss, T. V. P. and Collingridge, G. L. A synaptic model of memory:
long-term potentiation in the hippocampus. (1993) Nature 361: 31-39
[17] Collingridge, G. L. and Lester, R. A. J. (1989) Excitatoty amino acid receptor
in the vertebrate central nervous system. Pharmacol. Rev. 41: 143-210
[18] McBain, C. J. and Mayer, M. L. (1994) N-methyl-D-aspartic acid receptor
structure and function. Physiol. Rev. 74: 723-760
[19] Dingledine R, Borges K, Bowie D. and Traynelis SF. (1999) The glutamate
receptor ion channels. Pharmacol Rev. 51: 7-61
[20] Zukin, R. S. and Bnnentt, M. V. L (1995) Alternatively spliced isoforms of the
NMDAR1 receptor subunit. Trends Neuronsci. 18: 306-313
59
[21] Moriyoshi, K., Masu, M., Ishii, Y., Shigemoto, R., Mizuno, N., and Naknishi,
S. (1991). Molocular cloning and characterization of the rat NMDA receptor.
Nature 354: 31-37
[22] Anantharan, V., R. G. Phanchal, A. Wilson, V. V. Kolchine, S. N. Triestman,
and H. Bayley. (2002) Combinatorial RNA splicing alters the surface charge on
the NMDA receptor. FEBS Lett 305: 27-30
[23] Hollmann, M., J. Boulter, C. Maron, L. Beasley, J. Sullivan, G. Pecht, and S.
Heinemann. (1993) Zinc potentiates agonist-induced currents at certain splice
variants of the NMDA receptor. Neuron 10: 943-954
[24] Sugihara, H., Moriyoshi, K., Ishii, T., Masu, M. and Nakanishi, S. (1992)
Structures and properties of seven isoforms of the NMDA receptor generated
by alternative splicing. Biochem. Biophys. Res. Comm. 186: 826-832
[25] Ishii, T. K., Moriyoshi, K., Sugihara, H., Sakurada, K., Kadotani, H., Yokoi, M.,
Akazawa, C., Shigemoto, R., Mizuno, N., Masu, M., and Nakanishi, S. (1993)
Molecular characterization of the family of the N-methyl-D-aspartate receptors
subunits. J Biol. Chem. 268: 2836-2843
[26] Monyer, H., Sprengel, R., Schoepfer, R., Herb, A., Higuchi, M., Lo-meli, H.,
Burnashev, N., Sakamann, B., and Seeburg, P. H. (1992). Heteromeric NMDA
receptors: molecular and functional distinction of subtypes. Science 256:
1217-1221
[27] Hollmann, M. and Heinemann, S. (1994) Cloned glutamate receptors. Annu
Rev Neurosci 17: 31-108
[28] Ikeda, K., Nagasawa, M., Mori, H., Araki, K., Sakimura, K., Watanabe, M.,
Inoue, Y., and Mishina, M. (1992). Cloning and expression of the e4 subunit of
60
the NMDA receptor channel. FEBS Lett. 313: 34-38
[29] Kutsuwada, T., Kashiwabuchi, N., Mori, H., Sakimura, K., Kushiya, Ascher, E.,
Araki, K., Meguro, H., Masaki, H., Kumanishi, T., Arakawa, M., Mishina, M.
(1992). Molecular diversity if the NMDA receptor channel. Nature 358: 36-41/
[30] Meguro, H. Mori, H., Araki, K., Kushiya, E., Kutsuwada, T., Yamazaki, M.,
Kumanishi, T., Arakawa, M., Sakimyura, K., and Mishina, M. (1992)
Functional characterization of a heteromeric NMDA receptor channel
expressed from cloned cDNAs. Nature 357: 70-74
[31] Yamazaki, M., Mori, H., Araki, K. Mori, K. J., and Mishina, M. (1992).
Cloning expression and modulation of mouse NMDA receptor subunit. FEBS
Lett. 300: 39-45
[32] Forrest, D., Yuazki, M., Soares, H. D., Ng,L., Luk, D.C., Sheng, M., stewart, C.
L., Morgan, J. I., Connor, J. A., and Currant, T. (1994) Targeted disruption og
NMDA receptor 1 gene abolishes NMDA response and results in neonatal
death. Neuron 13: 325-338
[33] Li, Y., Erzurumly, R. S., Chen, C., Javeri, S., and Tonegawa, S. (1994).
Whisker-related neuronal patterns fail to develop in the trigeminal brainstem
nuclei of NMDAR1 knockout mice. Cell 76: 427-437
[34] Watanabe,M., Inoue, Y., Sakimura, K., and Mishina, M. (1992) Developmental
changes in distribution of NMDA receptor channel subunit mRNAs.
Neuroreport 3: 1138-1140
[35] Kutsuwada,T., Sakimura, K. Manabe, T., Takayama, C., Katukura, N., Kushiya,
E., Natsume, R., Watanabe, M., Inoue, Y., Yagi, T., Akizawa, S., Arakawa ,M.,
Takahashi, T., Nakamura, Y., Mori, H., and Mishina. M. (1996) Impairment of
61
suckling response, trigeminal neuronal pattern formation, and hippocampal
LTD in NMDA receptor e2 subunit mutant mice. Neuron 16: 333-344
[36] Sakimura, K., Kutsuwada, T., Ito, I., Manabe, T., Takayama, C., Kushiya, E.,
Yagi, T., Aizawa, S., Inoue, Y., Sugiyama, H., and Mishina , M. (1995).
Reduced hipppcampal LTP and spatial learning in mice lacking NMDA
receptor e1 subunit. Nature 373: 151-155
[37] Ikeda, K., Araki, K., Takayama, C., Inoue, Y., Yagi, T., Aizawa, S., and
Mishina, M. (1995). Reduced spontaneous activity of mice defective in the e4
subunit of the NMDA receptor channel. Mol. Brain Res. 33: 61-71
[38] Kadotani, H., Hirano, T., Masugi, M., et. Al. (1996) Motor discoordination
results from combined gene disruption of the NMDA receptor NR2A or NR2C
subunit. J. Neurosci. 16: 7859-7867
[39] Mishina, M., Mori, H., Araki, K., Kushiya, E., Meguro, H., Kutsuwada, T.,
Kashiwabuchi, N., Ikeda, K., Nagasawa, M., Ymazaki, M., et al. (1993).
Molecular and functional diversity of the NMDA receptor channel. Ann. NY
Acad. Sci. 707: 136-152
[40] Seeburg, P. H., (1993) The molecular biology of mammalian glutamate
receptor channels. Trends Neurosci. 16: 359-365.
[41] Mori, H., and Mishina, M. (1995). Structure and function of the NMDA
receptor channel. Neuropharmacology 34: 1219-1237
[42] Bodo, L., Jochen, K. and Heinrich, B. (1998) Evidence for a tetrameric
structure of recombinant NMDA receptors. J Neurosci. 18: 2954-2961
[43] Furukawa, H., Singh SK., Mancusso, R., and Gouaux, E. (2005) Subunit
arrangement and function in NMDA receptors. Nature (Lond) 438: 185-192
62
[44] McGurk, J. F., Bennett, M. V. L., and Zukin, R. S. (1990) Polyamine potentiate
responses of N-methyl-D-aspartate receptors expressed in xenopus oocytes.
Proc. Natl. Acad. Sci. U.S.A. 87: 9971-9974
[46] Araneda,R. C., Zukin, R. S., and Bennett, M. V. L. (1993) Effects of
polyamines on NMDA-induced currents in rat hippocampal neurons: A
whole-cell and single-channel study. Neurosci. Lett. 152: 107-112
[47] Igarashi, K. and Williams, K. (1995) Antagonist properties of polyamines and
bis(ethyl)polyamines at N-methyl-D-aspartate receptors. J Pharmacol Exp Ther
272: 1101-1109
[48] Durand, G. M., Gregor, P., Zheng, X., Bennett, M. V. L., Uhl, G. R. and Zukin,
R. S. (1992) Cloning of an apparent splice variant of the rat
N-methyl-D-aspartate receptor NMDAR1 with altered sensitivity to polyamine
and activators of protein kinase C. Proc. Natl. Acad. Sci. U.S.A. 89: 9359-9363
[49] Durand, G. M., Bennett, M. V. L., Uhl, G. R. and Zukin (1993) Splice variants
of the N-methyl-D-aspartate receptor NR1 identify domains involved in
regulation by polyamines and protein kinase C. Proc. Natl. Acad. Sci. U.S.A.
90: 6731-6736
[50] Zhang, L., Zheng, X.m Paupard, M. C., Wang, A. P., Santchi, L., Friedman, L.
K., Zukin, R. S. and Bennett, M. V. L. (1994) Spermine potentiation of
recombinant N-methyl-D-aspartate receptors is affected by subunit composition.
Proc. Natl. Acad. Sci. U.S.A. 91: 10883-10887
[51] Williams , K. (1995) Pharmacological properties of recombinat
N-methyl-D-aspartate ( NMDA) receptors containing the epsilon 4 (NR2D)
subunit. Neurosci. Lett. 184: 181-184
63
[52] Tang, C. M., Dichter, M. and Morad, M. (1990) Modulation of the
N-methyl-D-aspartate channel by extracellular H+. Proc. Natl. Acad. Sci. U.S.A.
87: 6445-6449
[53] Traynelis, S. F. and Cull-Candy, S. G. (1990) Proton inhibition of
N-methyl-D-aspartate receptors in cerebellar neurons. Nature (London) 245:
247-350
[54] Traynelis, S. F., Hartley, M. and Heinemann SF. (1995) Control of proton
sensitivity of the NMDA receptor by RNA splicing and polyamines. Scicence
(Wahs DC) 268: 873-876
[55] Williams, K. (1993) Ifenprodil discriminates subtypes of the
N-methyl-D-aspartate receptor: selectivity and mechanisms at recombinant
heteromeric receptors. Mol. Pharmacol. 44, 851-859.
[56] Chenard, BL., Menniti FS. (1999) Antagonist selective for NMDA receptors
containing the NR2B subunit. Curr Pharm Des 5: 381-404
[57] Carter, C., Benavides, J., Legendre, P., Vncnet, JD. Noel, F., Thuret, F., Loyd
KG., Arbilla S., Zivkovic, B., MacKenzie, ET., Scatton, B., Langer SZ. (1998)
Ifenprodil and SL 82.0715 as cerebral anti-sichemic agents: Evidence for
N-methyl-D-aspartate receptor antagonist properties . J Pharmacol Exp Ther
247: 1222-1232
[58] Legendre, P. and Westbrook, GL. (1991) Ifenprodil blocks
N-methyl-D-aspartate receptors by a two-component mechanism. Mol
Pharmacol 40:289-298
[59] Pahk, AJ. And Williams, K. (1997) Influence of extracellular pH on inhibition
by ifenprodil at N-methyl-D-aspartate receptors in xenopus oocytes. Neurosci
64
Lett 225: 29-32
[60] Mott DD., Doherty JJ., Zhang, S. Washburn, MS., Frendley, MJ., Lyuboslavsy
P., Traynelis SF., Dingledine, R. (1998) phenylethanolamines inhibit NMDA
receptors by enhancing proton inhibition. Nat Neurosci 1: 659-667.
[61] Kew JN., Trube G, Kemp JA. (1996) A novel mechanism of activity dependent
NMDA receptor antagonism describes the effect of ifenprodil in rat cultured
cortical neurons. J physiol (Lond) 497: 761-722
[62] Zheng F, Erreger K, Low CM, Banke T, Lee CJ, Conn PJ, Traynelis SF. (2001)
Allosteric interaction between the amino terminal domain and the ligand
binging domain of NR2A. Nat Neurosci 4: 894-901
[63] Williams K, Kashiwagi K, Fukuchi J, and Igarashi K. (1995) An acidic amino
acid in the N-methyl-D-aspartate receptor that is important for spermine
stimulation . Mol Pharmacol 48: 1087-1098
[64] Masuko T, Kashiwagi K, Kuno T, Nguyen ND, Pahk AJ, Fukuchi J, Igarashi K,
and Williams K (1999) A regulatory domain (R1-R2) in the amino terminus of
the N-methyl-D-aspartate receptor: Effects of spermine, protons, and ifenprodil,
and structural similarity to bacterial leucine/isoleucine/valine binding protein.
Mol Pharmacol 55: 957-969
[65] Ho SN, Hunt HD, Horton RM, Pullen JK, and Pease LR (1989) Site-derected
mutagenesis by overlap extension using the polymerase chain reaction. Gene
77: 51-59
[66] Kashiwagi K, Fukuchi J, Chao J, Igarashi K, and Williams K (1996) An
aspartate residue in the extracellular loop the N-methyl-D-aspartate receptor
controls sensitivity and protons. Mol Pharmacol 49: 1131-1141
65
[67] Paoletti P and Neyton K (2007) NMDA receptor subunits: function and
pharmacology. Curr Opin Pharmacol 7: 39-47
[68] Armstrong N., Sun Y., Chen G.-Q. and Gouaux E. (1998) Structure of a
glutamate-receptor ligand-binding core in complex with kainate. Nature 395,
913-917.
[69] Arvola M. and Keinänen K. (1996) Characterization of the ligand-binding
domains of glutamate receptor (GluR)-B and GluR-D subunits expressed in
Escherichia coli as periplasmic proteins. J. Biol. Chem. 271, 15527-15532.
[70] Chatterton J. E., Awobuluyi M., Premkumar L. S., Takahashi H., Talantova M.,
Shin Y., Cui J., Tu S., Sevarino K. A., Nakanishi N., Tong G., Lipton S. A. and
Zhang, D. (2002) Excitatory glycine receptors containing the NR3 family of
NMDA receptor subunits. Nature 415, 793-798.
[71] Chen G.-Q. and Gouaux E. (1997) Overexpression of a glutamate receptor
(GluR2) ligand binding domain in Escherichia coli: application of a novel
protein folding screen. Proc. Natl. Acad. Sci. USA 94, 13431-13436.
[72] Furukawa H. and Gouaux E. (2003) Mechanisms of activation, inhibition and
specificity: crystal structures of the NMDA receptor NR1 ligand-binding core.
EMBO J. 22, 2873-2885.
[73] Herin G. A. and Aizenman E. (2004) Amino terminal domain regulation of
NMDA receptor function. Eur. J. Pharmacol. 500, 101-111.
[74] Igarashi K., Shirahata A., Pahk A. J., Kashiwagi K. and Williams K. (1997)
Benzyl-polyamines: novel, potent, N-methyl-D-aspartate receptor antagonists. J.
Pharmacol. Exp. Ther. 283, 533-540.
[75] Ivanovic A., Reiländer H., Laube B. and Kuhse J. (1998) Expression and initial
66
characterization of a soluble glycine binding domain of the
N-methyl-D-aspartate receptor NR1 subunit. J. Biol. Chem. 273, 19933-19937.
[76] Kashiwagi K., Miyamoto S., Nukui E., Kobayashi H. and Igarashi K. (1993)
Functions of PotA and PotD proteins in spermidine-preferential uptake system
in Escherichia coli. J. Biol. Chem. 268, 19358-19363.
[77] Kew J. N. C. and Kemp J. A. (1998) An allosteric interaction between the
NMDA receptor polyamine and ifenprodil sites in rat cultured cortical neurones.
J. Physiol. 512, 17-28.
[78] Klimaviciusa L., Safiulina D., Kaasik A., Klusa V. and Zharkovsky A. (2008)
The effects of glutamate receptor antagonists on cerebellar granule cell survival
and development. Neurotoxicology 29, 101-108.
[79] Kuryatov A., Laube B., Betz H., and Kuhse J. (1994) Mutational analysis of the
glycine-binding site of the NMDA receptor: structural similarity with bacterial
amino acid-binding proteins. Neuron 12, 1291-1300.
[80] Laube B., Hirai H., Sturgess M., Betz H. and Kuhse J. (1997) Molecular
determinants of agonist discrimination by NMDA receptor subunits: analysis of
the glutamate binding site on the NR2B subunit. Neuron 18, 493-503.
[81] Lowry O. H., Rosebrough N. J., Farr A. L. and Randall R. J. (1951) Protein
measurement with the Folin phenol reagent. J. Biol. Chem. 193, 265-275.
[82] Masuko T., Kuno T., Kashiwagi K., Kusama T., Williams K. and Igarashi K.
(1999b) Stimulatory and inhibitory properties of aminoglycoside antibiotics at
N-methyl-D-aspartate receptors. J. Pharmacol. Exp. Ther. 290, 1026-1033.
[83] Mayer M. L. (2005) Crystal structures of the GluR5 and GluR6 ligand binding
cores: molecular mechanisms underlying kainate receptor selectivity. Neuron
67
45, 539-552.
[84] Mayer M. L., Olson R. and Gouaux E. (2001) Mechanisms for ligand binding to
GluR0 ion channels: crystal structures of the glutamate and serine complexes
and a closed apo state. J. Mol. Biol. 311, 815-836.
[85] Meddows E., Le Bourdellès B., Grimwood S., Waffords K., Sandhu S., Whiting
P. and McIlhinney R. A. J. (2001) Identification of molecular determinants that
are important in the assembly of N-methyl-D-aspartate receptors. J. Biol. Chem.
276, 18795-18803.
[86] Miyazaki J., Nakanishi S. and Jingami H. (1999) Expression and
characterization of a glycine-binding fragment of the N-methyl-D-aspartate
receptor subunit NR1. Biochem. J. 340, 687-692.
[87] Nielsen, P. J., Manchester, K. L., Towbin, H., Gordon, J. and Thomas, G. (1982)
The phosphorylation of ribosomal protein S6 in rat tissues following
cycloheximide injection, in diabetes, and after denervation of diaphragm. A
simple immunological determination of the extent of S6 phosphorylation on
protein blots. J. Biol. Chem. 257, 12316-12321.
[88] Paoletti P., Perin-Dureau F., Fayyazuddin, A., Le Goff A., Callebaut I. and
Neyton J. (2000) Molecular organization of a zinc binding N-terminal
modulatory domain in a NMDA receptor subunit. Neuron 28, 911-925.
[89] Perin-Dureau F., Rachline J., Neyton J. and Paoletti P. (2002) Mapping the
binding site of the neuroprotectant ifenprodil on NMDA receptors. J. Neurosci.
22, 5955-5965.
[90] Sugiyama S., Vassylyev D. G., Matsushima M., Kashiwagi K., Igarashi K. and
Morikawa K. (1996) Crystal structure of PotD, the primary receptor of the
68
polyamine transport system in Escherichia coli. J. Biol. Chem. 271, 9519-9525.
[91] Traynelis S. F., Hartley M. and Heinemann S. F. (1995) Control of proton
sensitivity of the NMDA receptor by RNA splicing and polyamines. Science
268, 873-876.
[92] Watanabe M., Inoue Y., Sakimura K. and Mishina M. (1992) Developmental
changes in distribution of NMDA receptor channel subunit mRNAs.
Neuroreport. 3, 1138-1140.
[93] Williams K., Russell S. L., Shen Y. M. and Molinof P. B. (1993) Developmental
switch in the expression of NMDA receptors occurs in vivo and in vitro.
Neuron 10, 267-278.
[94] Williams K., Kashiwagi K., Fukuchi J. and Igarashi K. (1995) An acidic amino
acid in the N-methyl-D-aspartate receptor that is important for spermine
stimulation. Mol. Pharmacol. 48, 1087-1098.
[95] Wong E., Ng F.-M., Yu C.-Y., Lim P., Lim L.-H., Traynelis S. F. and Low C.-M.
(2005) Expression and characterization of soluble amino-terminal domain of
NR2B subunit of N-methyl-D-aspartate receptor. Protein Sci. 14, 2275-2283.
[96] Kunishima N, Shimada Y, Tsuji Y, Sato Y, Yamamoto M, Kumasaka T,
Nakanishi S, Jingami H and morikawa K (2000) Structure basis of glutamate
recognition by a dimeric metabotropic glutamate receptor. Nature
407:971-977
[97] Chian-ming Low, Plina Lyuboslavsky, Adam French, Phuong Le, Karen
Wyatte, Williams H. Thiel, Edward M. Marchan, Kazuei Igarashi, Keiko
Kashiwagi, Kim Gernert, Keith Williams, Stephen F. Traynelis and Fang
Zheng (2003) Molecular determinants of proton-sensitive NMDA receptor
69
gating. Mol Pharm 63: 1212-1222
[98] Luciana M., Sandro C, Thomas S, Vittorio L, Alessia B, Ettore N ,David A C.
Homology modeling of NR2B modulatory domain of NMDA receptor and
nalysis of Ifenprodil binding. Chem med Chem 2007: 1498-1510
[99] Mony L, Krzaczkowski L, Leonetti M, Le Goff A, Alarcon K, Neyton J,
Bertrand HO, Acher F, Paoletti P. Structural basis of NR2B-selective
antagonist recognition by N-methyl-D-aspartate receptors. Mol Pharmacol.
2009 Jan:75(1):60-74
[100] Soloviev M. M and Barnard E. A. (1997) Xenopus oocyte express a unitary
glutamate receptor endogenousely. J Mol. Biol. 273, 14-18.
[101] Green T., Rogers C. A., Contractor A. and Heinemann S. F. (2002) NMDA
receptors formed by NR1 in Xenopus laevis oocytes do not contain the
endogenous subunit XenU1. Mol. Pharmacol. 61, 326–333
70
LIST OF PUBLICATIONS
Han, X., Tomitori, H., Mizuno, S., Higashi, K., Full, C., Fukiwake, T., Terui, Y., Leewanich, P., Nishimura, K., Toida, T., WIlliams, K., Kashiwagi, K., and Igarashi, K.: Binding of spermine and ifenprodil to a purified, soluble regulatory domain of the N-methyl-D-aspartate receptor. J. Neurochem. (2008)107, 1566-1577
71
ACKNOWLEDGEMENTS
I wish to express my great thanks to Professor Kazuei Igarashi for his constant
guidance , kind encouragement and valuable discussions in the course of this study.
I would like to acknowledge Professor Keiko Kashiwagi and Professor
Toshihiko Toida, and Associate Professor Kazuhiro Nishimura for their encouragement,
support and helpful advice. I also thanks for Professor Yu Tamura for his for his help on
the homology modeling and docking of spermine and ifenprodil to the R domain of the
NMDA receptor. Thanks are also due to Drs Hideyuki Tomitori, Yusuke Terui, Takeshi
Uemura, Kyouhei Higashi for their precious help and support.
I would also like to greatly appreciate Ms Satomi Mizuno, Lihua Jin, Hiromi
Sugiyama, Miki Takigawa and Mr Ryotaro Saiki for their kind experimental assistance
and continuous encouragement. If with out their help, it was not possible to accomplish
this work.
Deep appreciation is also expressed to our laboratory members and everyone
whom I have had the opportunity to share time with for their friendly collaboration
kindness and help.
Finally, I am deeply grateful to my friends and family for their understanding
patience support and constant encouragement.
72
THESIS COMMITTEE
This thesis was evaluated by the following committee authorized by the
Graduate School of Pharmaceutical Science, Chiba University.
Professor Kouichi Ueno, Ph.D. Chairman
(Graduate School of Pharmaceutical Science, Chiba University)
Professor Hiroshi Kobayashi, Ph.D.
(Graduate School of Pharmaceutical Science, Chiba University)
Professor Toshihiko Murayama, Ph.D.
(Graduate School of Pharmaceutical Science, Chiba University)
Recommended