of 26 /26
1 مقدمه فرگشت ا یل تکام] Evolution الم ولت ع ا و تحه ا گونه ورد منشی در م ۀ علمک نظری ی[ اد،ورد انتقده من ایف، ایای مختلا باورهت به فرگش نظریاییل تعارضهاران است. به دل جاند د عی نمودهان ان سی مغرض یارت، و بس ه اس گرفتاررراوان ق ای فمیه و کجفه ف تحری ا ا ب تد. دهنوه جلل باطه را نظریس اینسا بیانتقادهای ان. ک.) اسی اساد ب انتقت هف ازه نظری فرگشتت.دان اسشمنوم دانورد قبول عمی و م علمحکمیۀ مدارک محالیکه فرگشت بر پا در( درمكن، توضیح داده شود. سادهترین شكل م نظریه به شده این نوشتار سعی اینداز واژهط انۀ غله، ترجم نظرینه ایت بها نسب فارسیزبانهایشۀ برخی از كجفهمی شاید ریevolution به بوجودشاره و ا«فرگشت» و«بر آمدن» به معنی«لوشناو» ] شد. واژه با«تكامل» به هوم، نظریخلف تصور عم. برر از آب آمدن بخا دارد؛ مثل بوجودز دیگر از چیزی آمدن چی«تفرگش» «کمال یافتن» کی ازخلقی و حای ا به معنادن یا متکامل شارچ ب هین واژهت. ای نیسداران جانهد. فرگشت برابرشان میداق بیشتر با محیط نرای انطبدارن را بها تغییر جانارد بلكه تن اخلقی ندن. ک.) .ن استادی فرهنگستا درست پیشنه برای درستیمل برابر تکا چراEvolution نبست؟( آورد؟ر علم پدیده فرگشت انقلبی د چرا نظری) ارسطو۳۸۴ - ۳۲۲ نه ای را بخیر آب تبr میدانست، مثلال و غایات از امیعت را معجونی طبی( ق.مهنگ بت سا میگفكند یت بال حركت می رسیدن به كمال به سم برای علت میدانست كه آبعی خودگاه طبید به جای میخواهن میافتد کهیین علت به پای اهر با تیت؛ یین اسایه پ برسد کنهای. تبییم به سکون استجساعی اافتد که میل طبین می به زمیز پرتاب مدتی پس ا این علت ت.ن اس جهاشاعلمی بهک نگاه پی ینگارییتاست. غان ا جهانگار بهیتا نگاه غا] ی نمونه ارسطوی فرگشت وبلگ| کانال فرگشت| گروه فرگشت

Fargasht Chist

Embed Size (px)

Text of Fargasht Chist

  • 1

    ] Evolution [

    .

    (. . .

    ) .

    .

    evolution . [

    .

    .

    .

    ) Evolution . (. .

    .) r - (

    .

    [ . .

    | |

    http://fargasht.wordpress.com/http://zamaaneh.com/science/2009/12/post_80.htmlhttp://zamaaneh.com/science/2009/12/post_80.htmlhttp://fargasht.wordpress.com/2009/09/08/%D8%A7%D9%86%D8%AA%D9%82%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D8%B2-%D9%81%D8%B1%DA%AF%D8%B4%D8%AA/http://fargasht.wordpress.com/2009/09/08/%D8%A7%D9%86%D8%AA%D9%82%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D8%B2-%D9%81%D8%B1%DA%AF%D8%B4%D8%AA/http://fargasht.wordpress.com/2009/09/08/%D8%A7%D9%86%D8%AA%D9%82%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D8%B2-%D9%81%D8%B1%DA%AF%D8%B4%D8%AA/http://fargasht.wordpress.com/2009/09/08/%D8%A7%D9%86%D8%AA%D9%82%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D8%B2-%D9%81%D8%B1%DA%AF%D8%B4%D8%AA/http://en.wikipedia.org/wiki/Evolutionhttp://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 2

    [ .

    .

    . 1 .

    : :

    .

    :

    .

    () -

    ()- 2

    () -

    [

    .

    . .

    3 .

    .

    . !

    1 Anthropocentrism

    ) ! ( 2

    ( ) : 3

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 3

    . r

    () . :

    4 r .

    .

    5 () -

    . .

    . 6

    .

    .

    [ .

    . 4

    :

    There is grandeur in this view of life, with its several .

    powers, having been originally breathed into a few forms or into one ! : .

    .

    . 5

    . .

    6

    .

    | |

    http://fargasht.wordpress.com/http://www.scribd.com/doc/7785291/-http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 4

    ) - (

    8 .7

    7 The origin of species, by means of Natural selection or the Preservation of Favored Races in Struggle for life.

    .

    [ ] 8

    . .

    .

    | |

    http://fargasht.wordpress.com/http://www.literature.org/authors/darwin-charles/the-origin-of-species/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 5

    :

    - () .

    - r .

    - .

    - .

    . .

    .

    .

    .

    ! CD

    . CD

    . .

    .

    DNA

    .DNA .

    DNA )A) (T ) )C) (G. (

    | |

    http://fargasht.wordpress.com/http://en.wikipedia.org/wiki/Natural_selectionhttp://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 6

    . DNA [

    DNA .

    .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 7

    . DNA

    . ( .

    ) .

    . .

    r .

    . .

    .

    . .

    .

    .

    . .

    .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 8

    .

    r .

    .

    : ) . )

    .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 9

    B A . A

    . B .

    B r

    . B A

    .

    .

    . B A

    B .

    B .

    . .

    . . A

    .

    r .

    r

    .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 10

    .

    .

    .

    :

    : .

    .

    : .

    : . r

    . .

    : .

    : . ( ).

    .

    .

    . .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 11

    .

    .

    :

    . .

    .9

    r .

    .

    .

    .

    r 9

    . : ()

    . : .

    .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 12

    . .

    .

    ) ( . .

    .

    . (

    ).

    :

    .

    r

    . .

    . .

    .

    . (

    ) .

    .

    :

    - .

    ) . Backward (

    : (

    ) .

    ! !

    | |

    http://fargasht.wordpress.com/http://www.youtube.com/watch?v=hZydjvisFhQhttp://rdawkins.com/http://en.wikipedia.org/wiki/Evolution_of_the_eyehttp://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 13

    !

    !

    - ()

    . :

    .

    / .

    . r .

    .

    .

    .

    .

    - .

    .

    .

    10 .

    ) .. (11 . .

    : .

    .

    . ( )

    . (. . 10

    ). 11

    [ .

    : !

    . -

    .

    [ .

    ! (

    )

    | |

    http://fargasht.wordpress.com/http://fargasht.wordpress.com/2009/09/09/%D8%A8%D8%B1%D9%87%D8%A7%D9%86-%D9%86%D8%B8%D9%85-%D9%88-%DA%AF%D8%B2%DB%8C%D9%86%D8%B4-%D9%81%D8%B2%D8%A7%DB%8C%D9%86%D8%AF%D9%87/http://rdawkins.com/the-improbability-of-god/http://omilani.netfirms.com/baad/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 14

    12 r .

    .

    .

    .

    . r

    .

    .

    .13[

    :

    .

    .

    12

    . : . .

    . .

    .

    13

    . ( -

    : ) -

    : . : .

    : (!) [

    ]

    .

    .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 15

    ) . (. .

    .

    14 . .

    .

    .

    . .

    .

    ( )

    .

    .

    [ . [

    .

    .

    .

    .

    .

    . 14

    .

    . ( !)

    . (

    ).

    | |

    http://fargasht.wordpress.com/http://fargasht.wordpress.com/2009/09/08/%D8%A7%D9%86%D8%AA%D9%82%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D8%B2-%D9%81%D8%B1%DA%AF%D8%B4%D8%AA/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 16

    .

    .

    .

    .

    .

    .

    .

    r

    .

    .

    .

    . [

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 17

    . (

    )

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 18

    r

    .

    . r

    . 16 15 .

    r . r

    .

    : 17

    .

    . r

    .

    . 18

    (

    )

    .

    ) ( .

    15 Homologous structures

    : 16

    .

    : .

    .

    r

    ( r )

    . .

    17 Imperfect Structures

    18Imperfect design

    Intelligent design

    | |

    http://fargasht.wordpress.com/http://www.vonrechenberg.ch/blindspots.htmlhttp://rdawkins.com/?tag=%D8%A2%D9%81%D8%B1%DB%8C%D9%86%D8%B4-%D9%87%D9%88%D8%B4%D9%85%D9%86%D8%AFhttp://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 19

    : 19

    .

    .

    .

    . :

    .

    19 Vestigial structures

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 20

    . . r

    .

    .

    ) . (

    .

    .

    .

    ..

    ) (20

    (21

    .22 )

    20 Homo neanderthalensis

    21 Homo sapiens

    mtDNA . 22

    ) dead end (

    .

    | |

    http://fargasht.wordpress.com/http://en.wikipedia.org/wiki/Human_Genome_Projecthttp://en.wikipedia.org/wiki/Human_Genome_Projecthttp://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 21

    GLSDGEWQLVLNVWGKVEDAIPGHGQEVLIRLFKGHPETLEKFDKFHLKSEDEMKASEDLKKGGILKKKHGATVLTALKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVHSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

    GLSDGEWQLVLNVWGKVEDAIPGHGQEVLIRLFKGHPETLEKFDKFHLKSEDEMKASEDLKKGGILKKKHGATVLTALKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

    .

    .

    .

    23

    .

    :

    .

    23 Active site

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 22

    . (..

    )

    .

    ( ) r

    r

    .

    .

    r .

    . .

    .

    .

    .

    .

    .

    .

    24

    . r

    24 Industrial melanism .

    .

    | |

    http://fargasht.wordpress.com/http://iransecular.info/content/%D8%B9%D9%84%D9%85-%D9%88-%D9%85%D8%A7%D9%88%D8%B1%D8%A7%D8%A1-%D8%A7%D9%84%D8%B7%D8%A8%DB%8C%D8%B9%D9%87http://iransecular.info/content/%D8%B9%D9%84%D9%85-%D9%88-%D9%85%D8%A7%D9%88%D8%B1%D8%A7%D8%A1-%D8%A7%D9%84%D8%B7%D8%A8%DB%8C%D8%B9%D9%87http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 23

    .

    .

    .

    . .

    .

    .

    .

    .

    . .

    .

    | |

    http://fargasht.wordpress.com/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 24

    ( )

    .

    .

    .

    .

    .

    ) (26 ) (25

    ) (

    . ( )

    . .

    .

    .

    [ .

    .

    .

    . .

    : [ ] :

    . !

    !

    25 The Tiger Pufferfish (Fugu rubripes)

    26 Mus musculus

    | |

    http://fargasht.wordpress.com/http://fargasht.wordpress.com/2010/04/12/evolutionary-biology-21st-tech/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 25

    ! r . r

    . .

    . .

    .

    .

    ) ( :

    | |

    http://fargasht.wordpress.com/http://fargasht.wordpress.com/author/farpajoh/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT

  • 26

    :

    /http://tolweb.org/tree /http://machineslikeus.com

    /http://www.aboutdarwin.com /http://www.epjournal.net

    http://ncse.com/evolution /http://www.leakeyfoundation.org

    /http://www.eowilson.org . . http://evolve.zoo.ox.ac.uk

    /http://evolution.berkeley.edu /http://www.oeb.harvard.edu /http://www.bbc.co.uk/darwin

    /http://www.anth.ucsb.edu/projects/human /http://www.richarddawkins.net

    http://www.newscientist.com/topic/evolution /http://scienceblogs.com/pharyngula

    /http://humanorigins.si.edu [ /http://www.becominghuman.org

    http://mcb.harvard.edu/BioLinks/Evolution.html /http://www.sciencedaily.com/news/fossils_ruins/evolution

    /http://pbs.org/wgbh/evolution /http://www.talkorigins.org

    http://science.howstuffworks.com/biology-terms/evolution-info.htm /http://library.thinkquest.org/C004367

    http://emc.maricopa.edu/faculty/farabee/biobk/biobooktoc.html

    :

    http://fargasht.wordpress.com/link/ http://fargasht.wordpress.com/2009/09/06/evolution/

    | |

    http://fargasht.wordpress.com/http://fargasht.wordpress.com/2009/09/06/evolution/http://fargasht.wordpress.com/link/http://emc.maricopa.edu/faculty/farabee/biobk/biobooktoc.htmlhttp://library.thinkquest.org/C004367/http://science.howstuffworks.com/biology-terms/evolution-info.htmhttp://www.talkorigins.org/http://pbs.org/wgbh/evolution/http://www.sciencedaily.com/news/fossils_ruins/evolution/http://mcb.harvard.edu/BioLinks/Evolution.htmlhttp://www.becominghuman.org/http://humanorigins.si.edu/http://scienceblogs.com/pharyngula/http://www.newscientist.com/topic/evolutionhttp://www.richarddawkins.net/http://www.anth.ucsb.edu/projects/human/http://www.bbc.co.uk/darwin/http://www.oeb.harvard.edu/http://evolution.berkeley.edu/http://evolve.zoo.ox.ac.uk/http://www.eowilson.org/http://www.leakeyfoundation.org/http://ncse.com/evolutionhttp://www.epjournal.net/http://www.aboutdarwin.com/http://machineslikeus.com/http://tolweb.org/tree/http://www.facebook.com/Fargashthttp://www.youtube.com/FARGASHT