of 100 /100
PENGARUH PERUBAHAN TARIF TERHADAP PENDAPATAN SEWA TRANSPONDER JASA KOMUNIKASI DATA DAN INTERNET (Studi Pada PT. INDOSAT Tbk.) Disusun oleh: MAHARDIKA SURYAPUTRA 0410223095 KULIAH KERJA NYATA PROFESI (KKN-P) JURUSAN MANAJEMEN KONSENTRASI BIDANG KEUANGAN FAKULTAS EKONOMI UNIVERSITAS BRAWIJAYA MALANG 2007

contoh Laporan KKN-P

Embed Size (px)

Text of contoh Laporan KKN-P

PENGARUH PERUBAHAN TARIF TERHADAP PENDAPATAN SEWA TRANSPONDER JASA KOMUNIKASI DATA DAN INTERNET(Studi Pada PT. INDOSAT Tbk.) Disusun oleh: MAHARDIKA SURYAPUTRA 0410223095 KULIAH KERJA NYATA PROFESI (KKN-P) JURUSAN MANAJEMEN KONSENTRASI BIDANG KEUANGAN FAKULTAS EKONOMI UNIVERSITAS BRAWIJAYA MALANG 2007 LEMBAR PENGESAHAN LAPORAN KERJA PRAKTEK Nama: Mahardika Surya Putra Universitas: Brawijaya, Malang NIM: 0410223095 Judul:PengaruhPerubahanTarifTerhadapPendapatanSewaSatelit Transponder (Studi Pada PT Indosat Tbk.) Periode: 13 Agustus 2007 10 Oktober 2007 Menyetujui: Pembimbing LapanganDivision Head Divisi MIDI Brand ManagementMIDI Brand Management Syofya ilham E Agus Alamsyah Yahya NIK.75013685 NIK.64891661 Division Head Learning &Capabilities Management Edi Riyanto NIK.66943835 KATA PENGANTAR Alhamdulillah,pujisyukuryangsedalam-dalamnyapenulispanjatkan kehadiratAllahSWTatassegalarahmatdanhidayahNyasehinggapenulisdapat menyelesaikan Kuliah Kerja Nyata Profesi ini dengan judul: PENGARUH PERUBAHAN TARIF TERHADAP PENDAPATAN SEWA TRANSPONDER MULTIMEDIA, KOMUNIKASI DATA DAN INTERNET (Studi Pada PT. INDOSAT Tbk.) Adapun tujuandaripenulisan Laporan Kuliah Kerja Nyata Profesi adalah untukmemenuhisyaratdalammemberikanpenilaianKKN-Ppadajurusan (program)Sarjana Manajemen Fakultas Ekonomi Universitas Brawijaya Malang. Sehubungandenganselesainyakaryaakhirtersebut,penulismenyampaikan penghargaan dan ucapan terima kasih yang sebesar-besarnya kepada: 1.Ibu Himmiyatul Amanah J.J. sebagai pembimbing 2.Bapak M.S. Indrus selaku Ketua Jurusan (Program) Sarjana 3.BapakEdyRiyantoselakuDivisionHeadLearning&Capabilities Management PT Indosat Tbk. 4.BapakAgusAlamsyahYahyaselakuDivisionHeadMIDIBrand Management 5.Bapak Pembimbing di Lapangan Juliwardi 6.Ibu Pembimbing di Lapangan Lutfah 7.Ibu Pembimbing di Lapangan Syofia Ilham 8.Ibu Pembimbing di Lapangan Sri Mulyani i Penulis menyadari penyusunan Laporan Kuliah Kerja Nyata Profesi ini masih jauhdarisempurna.Untukitusaransertakritikyangmembangunsangatkami harapkan. Semoga karya akhir ini dapat bermanfaat bagi kita semua. Amin. Jakarta, 8 Oktober 2007 Penulis, Mahardika Suryaputra iiDAFTAR ISI Kata Pengantari Daftar Isiiii Daftar Tabelv Daftar Gambarvi BAB I PENDAHULUAN 1.1.Latar Belakang 1.2.Tujuan KKN-P 1.3.Manfaat KKN-P 1 3 3 BAB IILANDASAN TEORI 2.1.Pengertian Pemasaran 2.2.Pengertian Jasa 2.3.Kategori-kategori Bauran Jasa 2.4.Pengertian dan Konsep Strategi Pemasaran Jasa 2.5.Pengertian Promosi 2.6.PerbedaanKarakteristikProdukdanJasa:Implikasi terhadap Strategi Komunikasi Pemasaran Jasa 2.7.StrategiKomunikasiJasa:ImplementasiBauran KomunikasiJasa(MarketingCommunicationsMix Service) 2.8.Konsep Dan Peranan Harga 2.9.Tujuan Penetapan Harga 2.10. Faktor-faktoryangPerluDipertimbangkandalam Penetapan Harga 2.11. Metode Penetapan Harga 2.12. Penyesuaian-penyesuaian Khusus Terhadap Harga 2.13. Strategi Penetapan Harga 5 5 5 6 9 9 141618 22284451 BAB IIIPELAKSANAAN KEGIATAN KKN-P 3.1.Gambaran Umum Obyek KKN-P 3.2.Kegiatan yang ditekuni 3.3.Evaluasi Hasil Kegiatan KKN-P 3.4.Pengalaman Belajar 61757787 iiiBAB IVPENUTUP 4.1.Kesimpulan 4.2.Saran 8990 Daftar Pustaka91 ivDAFTAR TABEL No.Judul TabelHalaman2.1.Dimensi dan Macam Situasi Persaingan25 3.1.Ikhtisar Tarif dan Pendapatan Sewa Transponder78 3.2.Correlations81 3.3. Anovab82 3.4.Model Summaryb 83 3.5.Coefficientsa 83 vviDAFTAR GAMBAR No.Judul GambarHalaman2.1.Prestige Pricing31 2.2.Price Lining32 2.3.Standard Markup Pricing35 3.1.Struktur Organisasi66 3.2.Scatterplot - Uji Linearitas85 3.3.Scatterplot - Homoskedasitas86 3.4.Normal P-P Plot of Regression Standardized Residual87 BAB I PENDAHULUAN 1.1.Latar Belakang KKN-P Seiring dengan perkembangan jaman, informasi menjadi sebuah urat nadi untukperkembanganperekonomian,industri,maupunpemerintahan.Halini merupakanpeluangbagiparaperusahaantelekomunikasiuntukbersaing dalam menyediakan dan menyebarluaskan informasi melalui berbagai macam mediabaiksuaramaupundatadengandukunganteknologiinformasiyang merekamilikidankuasai.Perkembanganteknologiyangsemakinmaju, menyebabkanlayanankomunikasimenjadilebihmudahdiperolehdengan biaya yang relatif efisien. Perusahaan-perusahaantelekomunikasi,dalamhalinidisebutsebagai provider,berlomba-lombamemberikanlayananyangberkualitasagar konsumenmendapatkankepuasanataspelayanantersebut.Olehkarenaitu perusahaandituntutuntukmempertahankanataubahkanmeningkatkan kinerjanya agar tetap bertahan dalam persaingan yang semakin ketat. Divisipemasarandalamsebuahperusahaanmemilikiperananpenting dalam meningkatan kinerja perusahaan yang bersangkutan. Hal ini disebabkan pada dasarnya semua aktivitas dan prestasi perusahaan bermuara pada bidang pemasaran,aktifitaspemasarandimulaidarimelakukanrisetterhadaptarget marketyangakandituju.Halinidimaksudkanuntukmengetahuikeinginan ataukebutuhandankarakteristikdaritargetmarketitusendiri.Kemudian 1mengacupadahasilrisettersebut,perusahaandapatmenyusunsuatuproduk baru atau program pemasaran yang sesuai untuk meningkatkan penetrasi pasar perusahaan. Salah satu aspek dalam penyusunan produk baru atau program pemasaran adalahpenentuantarif,berapabesarantarifyangsesuaiuntuksuatulayanan agardapatmeningkatkanpenjualanproduktersebutdipasaryangjuga dibandingkandengantariflayanansejenisyangdiberikankompetitor.Aspek laindalamkegiatanpemasaranadalahpromosi,yaitubagaimanacara perusahaanuntukmengkomunikasikanprodukatauprogrampemasaranyang ada agar mudah ditangkap oleh konsumen atau target market yang dituju. Pada penelitian ini akan dibahas mengenai topik pengaruh perubahan tarif terhadappendapatansewadalamperusahaantelekomunikasi.Adapunlatar belakangnyaadalahtarifmerupakansalahsatufaktoryangpentingdalam kegiatanpenjualan,penyusunansuatusystempentarifanyangtepatakan menyebabkanperusahaandapatbersaingdalamerakompetisiyangketat, sehinggadapatmeningkatkanvolumepenjualan,dimananantinyaakan berpengaruh terhadap performansi perusahaan secara keseluruhan. Tujuan penelitian ini adalah untuk mengetahui hubungan antara perubahan tarifdenganpendapatansewauntuksalahsatujenisprodukyang diselenggarakanolehPT.INDOSATTbk.yangtelahdiluncurkandipasar. Makaberdasarkanlatarbelakangyangtelahdijelaskandiatas,peneliti mengambiljudulkaryatulisinisebagai:PENGARUHPERUBAHAN TARIFTERHADAPPENDAPATANSEWATRANSPONDER 2KOMUNIKASIDATA,INTERNET,DANMULTIMEDIA(StudiPada PT. INDOSAT Tbk.) 1.2.Tujuan KKN-P Dariuraianlatarbelakangdiatas,laporanpenulisaninimemilikitujuan sebagai berikut: 1.Untukmengetahuidanmenganalisispengaruhperubahantarifyang diselenggarakanterhadappendapatansewaTransponderDivisiMIDI (Multimedia Interactive Data Communication & Internet) PT Indosat Tbk. 2.Untuk mengetahui dan menganalisis pengaruh yang dominan dari variabel tarifterhadappendapatansewaTransponderpadaDivisiMIDI (Multimedia Interactive Data Communication & Internet) PT Indosat Tbk. 1.3.Manfaat KKN-P Manfaat dari KKN-P adalah: 1.3.1.Bagi Mahasiswa a.Dapat meningkatkan kecerdasan intelektual dan emosional. b.Dapatmenerapkanpengetahuanteoritisyangdiperolehdiprogram pendidikanuntukditerapkanpadaberbagaikasusriildiduniakerja maupun dunia usaha. 3c.Menumbuhkembangkanrasapercayadiridalammenjalanikehidupan bermasyarakat. 1.3.2.Bagi Perusahaan/Lembaga/Pelaku Usaha a.Dapat melaksanakan salah satu bentuk tanggung jawab sosial perusahaan / lembaga / pelaku usaha kepada masyarakat. b.Memperolehsumbanganpemikirandantenagadalamrangka meningkatkan kinerja perusahaan / lembaga / pelaku usaha. 1.3.3.Bagi Jurusan a.Memperluasjaringankerjasamadenganberbagaiperusahaan/lembaga/ pelaku usaha. b.Meningkatkanrelevansikurikulumberbagaiprogrampendidikandi Jurusan Manajemen dengan dunia kerja dan dunia usaha. 1.3.4.Bagi Dosen Pembimbing a.Memperolehpengetahuandanpemahamantentangberbagaipraktek manajemen di dunia kerja dan dunia usaha. Meningkatkan jaringan kerjasama dengan dunia kerja dan dunia usaha. 4BAB II LANDASAN TEORI 2.1.Pengertian Pemasaran Menurut Kotler (2004:9), Pemasaran adalah : Suatuprosessosialdanmanajerialyangdidalamnyaindividudankelompok mendapatkanapayangmerekabutuhkandaninginkandenganmenciptakan, menawarkan,dansecarabebasmempertukarkanprodukyangbernilaidengan pihak lain. Asosiasi Pemasaran Amerika memberi definisi bahwa marketing adalah : Prosesperencanaandanpelaksanaanpemikiran,penetapanharga,promosi, sertapenyalurangagasan,barang,danjasauntukmenciptakanpertukaranyang memenuhi sasaran-sasaran individu dan organisasi 2.2.Pengertian Jasa Menurut Phillip Kotler (2004:486) pengertian jasa adalah : Setiaptindakanataukegiatanyangdapatditawarkanolehsatupihakkepada pihaklain,yangpadadasarnyatidakberwujuddantidakmengakibatkan kepemilikan apa pun. 2.3.Kategori-Kategori Bauran Jasa Komponenjasadapatberupabagiankecilataubagianutamatawarantotal. Tawaran dapat dibedakan menjadi lima kategori : 51.Barang berwujud murni : tawaran hanya terdiri dari barang berwujud seperti sabun, pasta gigi, atau garam. Tidak ada jasa yang menyertai produk itu. 2.Barangberwujudyangdisertailayanan:tawaranterdiridaribarang berwujudyangdisertaidengansatuataubeberapalayananmobile.Levitt mengamatibahwasemakincanggihteknologiprodukgenerik(seperti mobildankomputer),penjualannyasemakintergantungpadamutudan tersedianya pelayanan pelanggan yang menyertainya (contoh : ruang pamer, pengiriman,perbaikandanpemeliharaan,bantuanaplikasi,pelatihan operator, nasihat instalasi, pemenuhan garansi). 3.Campuran : tawaran terdiri dari barang dan jasa dengan proporsi yang sama. Misalnya,orangmengunjungirestoranuntukmendapatkanmakanandan layanan. 4.Jasa utama yang disertai barang dan jasa tambahan : tawaran terdiri dari satu jasautamadisertaijasatambahandan/ataubarangpendukung.Contohnya, para penumpang pesawat terbang membeli jasa transportasi. 5.Jasamurni:tawaranhanyaterdiridarijasa.Contohnyamencakupjasa menjaga bayi, psikoterapi, dan jasa memijat. 2.4.Pengertian dan Konsep Strategi Pemasaran Jasa Untukmenghadapipersainganbisnisyangsemakinketat,makakegiatan pemasaranyangefektifdanefisienberfungsiuntukmenyelamatkanperusahaan. Strategipemasaranmerupakanpemilihanalternatifoptimaluntukmencapai tujuanpemasaranperusahaan.Komponennyaadalahpasaryangdisegmentasikan menjadipasarsasarandipadukandengansejumlahvariabelpemasaranterkendali 6(marketingmix)yangberfungsiuntukmempengaruhitanggapanparapembelidi pasar yang menjadi sasarannya. Strategibauranpemasaran(marketingmixstrategy)padaperusahaan manufaktursecaratradisionaldilaksanakandenganmenetapkan4Pmeliputi Product,Price,PlacedanPromotionsedangkanpadaperusahaanjasabauran pemasaran(servicemarketingstrategy)moderndilakukanmelalui8Pyaitu Product,Place(cyberspaceandTime),Price,Promotion,Process,Productivity andQuality,People,Physicalevidenceyangmerupakanpengembangandari4P tradisional. (Lovelock & Wright, 2002). Implementasi service marketing mix strategy tersebut tidak cukup tanpa diikuti olehpergeseranparadigmapemasarandaritransactionalmenujurelationship dimanapadaakhirnyaakanmembawaimplikasiyangsangatbesarpulabagi perubahan tujuan (objective) dari perusahaan jasa maupun manufaktur dewasa ini. Melaluipengembanganparadigmarelationship,konsumendipahamisebagai sentral dan bukan sebagai obyek, dengan demikian diharapkan akan tercipta suatu transaksipembelianyangdiikatdalamhubungankemitraan(relasi)agartercipta rebuyingataupembelianulang.Untukmembinahubungankemitraanataurelasi yangbaikdiperlukankomunikasiyangbaikpuladenganpelanggansasaran maupunpelangganpotensial.Dengandemikiansetiapperusahaan,baik manufakturmaupunjasatidakdapatmenghindarkandiridariperansebagai komunikator dan promotor. Sebagai komunikator atau promotor perusahaan harus menyampaikaninformasisecaraefektifterutamaberkaitandenganpenyampaian benefitataumanfaatprodukataujasasecarajelas,tepatsasaranmaupuntepat intensitasnya. 7 Perusahaanmanufakturmodernperlusuatusistemkomunikasipemasaran yangkompleks,demikianjugadenganperusahaanjasa.Komunikasipemasaranataudisebutjugapromosi,antaraperusahaanjasadengankonsumennyadapat dilakukandenganbanyakcara,bahkandengancarayangsangatkreatif dibandingkanmengkomunikasikanprodukmanufaktur.Haliniharusmenjadi fokusperhatianutama,mengingatbenefitdarijasayangditawarkantidakbisa langsungdilihatolehcalonkonsumennya.Alatpromosijugamerupakanfaktor yangsangatmenentukan,karenaalatpromosi dapat menentukan pula bagaimana respon dari konsumen terhadap apa yang diinformasikan oleh perusahaan jasa. Perusahaanjasadalammenjalankanperansebagaikomunikatormempunyai beberapatugas,yaitumenginformasikansekaligusmemberikanwawasanpada konsumententangorganisasi/perusahaansertamerekdanmanfaatyangdapat diberikan,membujukkonsumenpotensialuntukmemanfaatkanjasasebagai penyelesaianyangterbaikdarikebutuhankonsumendibandingkandengan pesaing,mengingatkankonsumenakankemampuanperusahaanjasamaupun motivasiperusahaantersebutsertamemperbaikihubunganpelanggandengan menawarkan pengetahuan yang lebih banyak untuk mengoptimalkan penggunaan jasa tersebut. (Kotler, 2004) Melihatbegitupentingnyaperanpromosidalamperusahaanjasa,perlu direncanakandenganmatangstrategipromosiyangtepat.Kesalahanfatalyang sering kali dilakukan oleh perusahaan jasa adalah membuat strategi promosi yang samadenganperusahaanmanufaktur.Untukitupembahasankaliinilebih ditekankanpadapelurusanpandanganyangsalahtersebut,yaituberangkatdari pemahamanbahwakarakteristikjasaberbedadengankarakteristikproduk 8manufaktur.Dengandemikiandiperlukanstrategipemasaranmaupunstrategi promosi yang berbeda dengan produk manufaktur. 2.5.Pengertian Promosi Agarkegiatanpromosidarisuatuperusahaanberjalanefektif,makakegiatan promosi tersebut harus diintegrasikan dengan strategi-strategi perusahaan lainnya. Mula-mulaprodukataujasadisesuaikandengankebutuhandanpreferensipasar, kemudianhargaprodukditetapkansesuaidengannilaiyangdikandungproduk ataujasatersebut,setelahituprodukdidistribusikankepasar.Karenacalon pembeliperlumengetahuikarakteristikyangkhasdariprodukataujasa,harga, danprodukataujasatersebuttersediamakaperusahaanmelakukankegiatan promosi.Jadipromosimerupakanelemenpentingdidalamstrategipemasaran yangtugasutamanyaadalahmengadakandanmemeliharakomunikasidengan konsumenyangmenjadisasaranperusahaan.Halinisesuaidengandefinisi promosi menurut Philip Kotler (2004:681) : Promosipenjualanterdiridarikumpulanalat-alatinsentifyangberagam, sebagianbesarberjangkapendek,dirancanguntukmendorongpembeliansuatu produk / jasa tertentu secara lebih cepat dan/atau lebih besar oleh konsumen atau pedagang. 2.6.PerbedaanKarakteristikProdukdanJasa:ImplikasiterhadapStrategi Komunikasi Pemasaran Jasa Mengembangkanstrategikomunikasipemasaranyangberbedauntuk mengkomunikasikanjasa(yangmenawarkanproduktidakberwujud)adalah 9berbedadenganstrategikomunikasiuntukmengkomunikasikanproduk manufaktur, hal ini harus benar-benar dipahami sebagai dasar strategi komunikasi itu sendiri. (Kathleen Mortimer & Brian P, 1998) Beberapaperbedaan antara jasa dan produk manufaktur mempunyai implikasi yang sangat penting dalam komunikasi pemasaran jasa tersebut. Terdapat enam perbedaan antara produk manufaktur dan jasa, yaitu : 2.6.1.Ketidakberwujudan dari tampilan jasa Pemahamanterhadapkenyataanbahwajasaadalahkinerjaatauprosesdan bukanmerupakanobyekadalahlangkahawaluntuklebihmemahamijasaitu sendiri,haliniterutamauntukklasifikasijasayangsangatsedikitberhubungan dengan peralatan atau equipment . Jasa lebih merupakan kinerja atau prestasi dan pengalamandaribentukobyek,makaspesifikasisertamanufakturyangtepat mengenai keseragaman kualitas sangat sulit untuk ditentukan. (Parasuraman et all, 1990) Mengingat jasa tidak berbentuk atau berwujud, maka konsumen tidak mungkin melihattampilansecarafisikataupunmengambilcontohdenganmenyentuh, mencicipi, melihat, mendengar atau membaui suatu jasa pada saat dibeli. Dengan demikian muncul kesulitan dalam mengkomunikasikan jasa. Untuk itu dibutuhkansuatuobyekyangdapatdigunakanuntukmengingatwujudfisikjasa tersebutyaituphisicalsymbol.(WillimR&Leonard,1981)Sebagaicontoh simbolkanggurudipakaisebagaiPhisicalsymbolperusahaanpenerbangan Australia.Konsumenterbantusecarafisikmengingatkeberadaanperusahaan penerbangan Australia tersebut melalui simbol kangguru. 2.6.2.Keterlibatan konsumen dalam proses produksi jasa 10 Doronganuntukmeningkatkanproduktivitaspadaperusahaanjasaseringkali dikaitkandenganinovasiteknologi.Dimanainovasiini,tentunyadikaitkanpula dengankemungkinanbiayatenagakerjayangdapatditurunkanataupun dioptimalkan.(Davisetall,1989).Permasalahanseringkalimuncul,apabila peningkatanproduktivitasinitidakdiimbangiolehusaha-usahauntuk mempertahankankualitasjasa.Untukitufaktormanusia(people)masih memegangperananyangcukupbesardalamjasa.(BrownJamesAndChekitan, 2000). Bentukjasayangmengharuskankonsumenaktifdalamprosestransferjasa yangdilengkapidenganpenggunaanteknologi,menuntutperusahaanjasa memberikanlayanantambahanberupapelatihanataupunpemberianinformasi yanglengkaptentangteknologiyangdigunakandalamprosesjasatersebut. Dengandemikianmarketerjasajugaharusbertindaksebagaiedukator.(Legand Barker,1992)karenamerekaberperanpuladalamtransferpengetahuantentang jasaitusendiri.Dengandemikiankomunikasitidakcukupdilakukanmelalui penyampaianbenefitataumanfaatjasa,tetapiharusditumbuhkanunsuredukasi dalamkomunikasitersebutsehinggabenefitataumanfaatyangdiharapkandari jasa tersebut benar-benar sesuai dengan ekspektasi dari konsumen jasa. (Howard, 1989) 2.6.3.Evaluasi terhadap jasa sangat sulit dilakukan oleh konsumen Meskipunkonsumensangatmengenalkarakteristikdarijasayangmereka konsumsi,namunmerupakanhalyangsulituntukmelakukanevaluasiterhadap kualitasdarijasaterutamauntukperusahaanjasadengankontakkonsumenyang rendah(lowcontactservice)sulitsekalimelakukanevaluasiterhadapkualitas 11jasa.Haliniterjadi,mengingatkomunikasidengankonsumensulituntuk dilakukan disebabkan oleh terbatasnya peluang atau kesempatan untuk melakukan kontak langsung dengan konsumen. Perananiklandalammenilaikualitasjasadapatdioptimalkandengan melakukan word of mouth (Haywood, 1989). Proses word of mouth akan semakin terpercayabilaberupakomentarkonsumenyangtelahmengkonsumsiatau mengalamiprosesjasa(servicedelivery)jasatersebut(DavidH.Maister,1997). Dengandemikiankomunikasidarimulutkemuluttersebutdiharapkantidak hanya berfungsi sebagai penyampaian informasi tentang benefit atau manfaat jasa, tapilebihlagidapatdigunakanuntukmembentukpersepsikonsumenyangbaik dan kuat tentang jasa tersebut. 2.6.4.Kebutuhan untuk menyeimbangkan penawaran dan permintaan Kebutuhanuntukmenyeimbangkanpenawarandanpermintaanberkaitan dengandemandmanagementstrategiesyaitubagaimanastrategiperusahaan dalammengelolaataumengaturaktivitasyangdapatmeningkatkanpermintaan padasaatpeakperiodsataupunmemperpanjangkondisihighperiods.Banyak peluang yang bisa dioptimalkan oleh marketer untuk dapat melaksanakan strategi ini misalnya dengan memberikan discount harga. Permintaan rendah pada peak periods merupakan masalah serius pada industri jasaterutamayangmempunyaibiayatetapataufixedcosttinggisepertihotel. Untuk itu, dapat disiasati dengan menawarkan discount harga maupun penawaran servicetambahanmisalnya:gratispenggunaanfasilitashotel,sarapanpagi,dan lain-lain agar akumulasi konsumen pada high periods dapat disebar untuk mengisi kekosongandemandkonsumenpadalowperiodshalinisamaartinyadengan 12memperpanjang kondisi high periods atau peak periods dari jasa tersebut. Dengan demikiankomunikasisangatberperandalammenginformasikanpenetapan strategi discount dengan tujuan menyeimbangkan penawaran dan permintaan jasa, bukan dengan tujuan penurunan kualitas jasa itu sendiri. 2.6.5.Pentingnya kontak secara personal dengan konsumen Perusahaanjasadapatdiklasifikasikandalamduakelompokyaitu:high contact servicesdan low contact services (lovelock, 2002). Pada perusahaan jasa dengankontakkonsumentinggi(highcontactservices),karyawanyang berhubunganlangsungdengankonsumenmerupakansentraldariprosestransfer jasa(servicedelivery).Untukitubanyakperusahaanyangmengupayakanagar proses jasa lebih tangible (berwujud) dan lebih personalised (personal). Padajenisjasadimanakontakdenganpelanggansangatbesar(highcontact services),karyawandapatbertindak sebagai pelengkap dari usaha-usaha promosi perusahaan. Mengingat karyawan dapat intens memanfaatkan waktu dalam proses transferjasauntukmengkomunikasikanbenefitataumanfaatjasa,tentunya disertaiupayauntukmembentukpersepsiyangbaikterhadapkualitasjasayang diberikan. 2.6.6.Kecilnya peran perantara Intermediariesatauperantarasepertiretail/pengecerseringmempunyaiperan yangcukuppentingdalammempromosikanprodukmanufakturpadakonsumen dansekaligusmemberikaninformasitentangkarakteristikprodukmanufaktur. Tetapijasatidakdapatdisamakandenganprodukmanufakturkarenaperusahaan jasaakanlangsungmenjualpadapelanggan.Berartidalamjasa,terdapatperan perantara yang sangat minimal. 13 Namundemikian,beberapaperusahaanjasasepertijasaangkutan(travel), asuransitetapmembutuhkanagen-agenuntukmenjadiperantaradalam memasarkanjasamereka.Olehkarenaperanperantarahampirtidakadadalam jasa,diperlukankomunikasilebihintensifuntukmenginformasikanbenefitdan value dari jasa tersebut. 2.7.StrategiKomunikasiJasa:ImplementasiBauranKomunikasiJasa (Marketing Communications Mix Service) Perusahaanharusmengalokasikananggaranpromosidiantarabeberapaalat promosi yang ada, yaitu personal selling, sales promotion, advertising, publicity, instructionalmaterial,corporatedesign,sertawiraniaga.Dalamindustriyang sama,berbagaiperusahaandapatsangatberbedadalamcaramengalokasikan anggaran promosi mereka. Perusahaanselalumencaricarauntukmemperolehefisiensidengan mensubstitusisuatualatpromosidenganyanglainnya.Kemampuanuntuk melakukansubstitusidiantaraalat-alatpromositersebutmenjelaskanmengapa fungsi-fungsi pemasaran harus dikoordinasikan. Sedangkan setiap alat promosi itu memiliki karakteristik dan biaya tersendiri yang unik. 2.7.1.Periklanan Karenabanyaknyabentukdanpenggunaanperiklanan,sangatsulituntuk membuatgeneralisasiyangmerangkumsemuanya.Namun,sifat-sifatberikut dapat diperhatikan: Presentasiumum:Periklananyangbersifatumumitumemberikansemacam keabsahanpadaprodukdanmenyarankantawaranyangterstandardisasi. 14Karena banyak orang menerima pesan yang sama, pembeli mengetahui bahwa motif mereka untuk membeli produk tersebut akan dimaklumi oleh umum. Tersebarluas:Periklananadalahmediumyangberdayasebarluasyang memungkinkanpenjualmengulangpesanberkali-kali.Iklanjuga memungkinkanpembelimenerimadanmembandingkanpesandariberbagai pesaing. Periklanan berskala besar oleh seorang penjual menyiratkan hal yang positif tentang ukuran, kekuatan, dan keberhasilan penjual. Ekspresiyanglebihkuat:Periklananmemberikanpeluanguntuk mendramatisasiperusahaandanproduknyamelaluipenggunaancetakan, suara, dan warna yang penuh seni. Tidak bersifat pribadi: Audiens tidak merasa wajib untuk memperhatikan atau menanggapi.Iklanhanyamampumelakukanmonolog,bukandialog,dengan audiens. Periklanan dapat digunakan untuk membangun citra jangka panjang bagi suatu produk,dandisisilain,mempercepatpenjualan.Periklanandapatsecaraefisien menjangkauberbagaipembeliyangtersebarsecarageografis.Bentukperiklanan tertentudapatdibuatdengananggaranyangkecil.Periklananmungkinmemiliki pengaruhataspenjualansemata-matamelaluikemunculannya.Konsumen mungkinpercayabahwamerekyangseringdiiklankanpastimenawarkannilai yang baik. 2.7.2.Promosi Penjualan Walaupun alat promosi penjualan kupon; kontes, harga premi, dan sejenisnya sangat beragam, semuanya memberikan tiga manfaat yang berbeda: 15Komunikasi:Promosipenjualanmenarikperhatiandanbiasanyamemberikan informasi yang dapat mengarahkan konsumen ke produk bersangkutan. Insentif:Promosipenjualanmenggabungkansejumlahkebebasan,dorongan, atau kontribusi yang memberi nilai bagi konsumen. Ajakan:Promosipenjualanmerupakanajakanuntukmelakukantransaksi pembelian sekarang. Perusahaanmenggunakanalat-alatpromosipenjualanituuntukmenciptakan tanggapanyanglebihkuatdanlebihcepat.Promosipenjualandapatdigunakan untukmendapatkanakibatjangkapendeksepertimendramatisirtawaranproduk dan mendorong penjualan yang lentur. 2.8.Konsep Dan Peranan Harga Agardapatsuksesdalammemasarkansuatubarangataujasa,setiapperusahaan harusmenetapkanharganyasecaratepat.Hargamerupakansatu-satunyaunsur bauranpemasaranyangmemberikanpemasukanataupendapatanbagi perusahaan,sedangkanketigaunsurlainnya(produk,distribusi,danpromosi) menyebabkantimbulnyabiaya(pengeluaran).Disampingituhargamerupakan unsurbauranpemasaranyangbersifatfleksibel,artinyadapatdiubahdengan cepat.Berbedahalnyadengankarakteristikprodukataukomitmenterhadap salurandistribusi.Keduahalterakhirtidakdapatdiubah/disesuaikandengan mudah dan cepat, karena biasanya menyangkut keputusan jangka panjang. Hargabisadiungkapkandenganberbagaiistilah,misalnyaiuran,tarif,sewa, bunga, premium, komisi, upah, gaji, honorarium, SPP, dan sebagainya. Dari sudut pandangpemasaran,hargamerupakansatuanmoneteratauukuranlainnya 16(termasukbarangdanjasalainnya)yangditukarkanagarmemperolehhak kepemilikan atau penggunaan suatu barang dan jasa. Pengertian ini sejalan dengan konsep pertukaran (exchange) dalam pemasaran. Hargamerupakankomponenyangberpengaruhlangsungterhadaplaba perusahaan. Hal ini terlihat jelas pada persamaan berikut: Total Biaya - Terjual) yang Kuantitas per Unit(HargaTotal Biaya - Total Pendapatan Laba == Tingkathargayangditetapkanmempengaruhikuantitasyangterjual.Selainitu secaratidaklangsunghargajugamempengaruhibiaya,karenakuantitasyang terjualberpengaruhpadabiayayangditimbulkandalamkaitannyadengan efisiensiproduksi.Olehkarenapenetapanhargamempengaruhipendapatantotal dan biaya total, maka keputusan dan strategi penetapan harga memegang peranan penting dalam setiap perusahaan. Sementara itu, dari sudut pandang konsumen, harga seringkali digunakan sebagai indikatornilaibilamanahargatersebutdihubungkandenganmanfaatyang dirasakanatassuatubarangataujasa.Nilai(value)dapatdidefinisikansebagai rasioantaramanfaatyangdirasakanterhadaphargaataudapatdirumuskan sebagai berikut: HargaDirasakan yang Manfaat Laba =Dengandemikiandapatdisimpulkanbahwapadatingkathargatertentu,bila manfaatyangdirasakankonsumenmeningkat,makanilainyaakanmeningkat pula.Demikianpulasebaliknyapadatingkathargatertentu,nilaisuatubarang 17ataujasaakanmeningkatseiringdenganmeningkatnyamanfaatyangdirasakan. Seringkalipuladalampenentuannilaisuatubarangataujasa,konsumen membandingkankemampuansuatubarangataujasadalammemenuhi kebutuhannya dengan kemampuan barang atau jasa substitusi. Hargamemilikiduaperananutamadalamprosespengambilankeputusanpara pembeli, yaitu peranan alokasi dan peranan informasi. 1.Perananalokasidariharga,yaitufungsihargadalammembantupara pembeliuntukmemutuskancaramemperolehmanfaatatauutilitas tertinggiyangdiharapkanberdasarkandayabelinya.Dengandemikian, adanyahargadapatmembantuparapembeliuntukmemutuskancara mengalokasikan daya belinya pada berbagai jenis barang dan jasa. Pembeli membandingkanhargadariberbagaialternativeyangtersedia,kemudian memutuskan alokasi dana yang dikehendaki. 2.Perananinformasidariharga,yaitufungsihargadalammendidik konsumenmengenaifaktor-faktorpenduduk,sepertikualitas.Halini terutamabermanfaatdalamsituasidimanapembelimengalamikesulitas untukmenilaifaktor-faktorprodukataumanfaatnyasecaraobjektif. Persepsiyangseringberlakuadalahbahwahargayangmahal mencerminkan kualitas yang tinggi. 2.9. Tujuan Penetapan Harga Pada dasarnya ada empat jenis tujuan penetapan harga, yaitu: 1.Tujuan berorientasi pada laba 18Asumsteoriekonomiklasikmenyatakanbahwasetiapperusahaanselalu memilihhargayangdapatmenghasilkanlabapalingtinggi.Tujuanini dikenal dengan istilah maksimisasi laba. Dalam era persaingan global yang kondisinyasangatkompleksdanbanyakvariabelyangberpengaruh terhadapdayasaingsetiapperusahaan,maksimisasilabasangatsulit dicapai,karenasukarsekaliuntukdapatmemperkirakansecarakurat jumlahpenjualanyangdapatdicapaipadatingkathargatertentu.Dengan demikian,tidakmungkinsuatuperusahaandapatmengetahuisecarapasti tingkat harga yang dapat menghasilkan laba maksimum. Oleh sebab itu ada pula perusahaan yang menggunakan penggunaan target laba,yaitutingkatlabayangsesuaiatauyangdiharapkansebagaisasaran laba.Adaduajenislabayangbiasadigunakan,yaitutargetmargindan targetROI(ReturnOnInvestment).Targetmarginmerupakantargetlaba suatuprodukyangdinyatakansebagaipresentaseyangmencerminkan rasiolabaterhadappenjualan.SedangkantargetROImerupakantarget labasuatuprodukyangdinyatakansebagairasiolabaterhadapinvestasi totalyangdilakukanperusahaandalamfasilitasproduksidanasetyang mendukung produk tersebut. 2.Tujuan berorientasi pada volume Selain tujuan berorientasi pada lab, ada pula perusahaan yang menetapkan harganyaberdasarkantujuanyangberorientasipadavolumetertenuatau yangbiasadikenaldenganistilahvolumepricingobjectives.Harga ditetapkans sedemikian rupa agar dapat mencapai target volume penjualan 19(dalamton,kg,unit,m3,danlain-lain),nilaipenjualan(Rp)ataupangsa pasar(absolutemaupunrelatif).Tujuaninibanyakditerapkanoleh perusahaan penerbangan, lembaga pendidikan, perusahaan tour and travel, pengusahabioskop,danpemilikbisnispertunjukkanlainnya,serta penyelenggaraanseminar-seminar.Bagisebuahperusahaanpenerbangan yangberupayamemeberikaninsentifberupahargaspecialagardapat meminimisasi jumlah kursi yang tidak terisi. 3.Tujuan berorientasi pada citra Citra(image)suatuperusahaandapatdibentukmelaluistrategipenetapan harga.Perusahaandapatmenetapkanhargatinggiuntukmembentukatau mempertahankancitraprestisius.Sementaraituhargarendahdapat digunakan untuk membentuk citra nilai tertentu (image of value), misalnya denganmemberikanjaminanbahwaharganyamerupakanhargayang terendah di suatu wilayah tertentu. Pada hakikatnya, baik penetapan harga tinggimaupunrendahbertujuanuntukmeningkatkanpersepsikonsumen terhadap keseluruhan bauran produk yang ditawarkan perusahaan. 4.Tujuan stabilisasi harga Dalam pasar yang konsumennya sangat sensistif terhadap harga, bila suatu perusahaanmenurunkanharganya,makaparapesaingnyaharus menurunkanpulahargamereka.Kondisisepertiiniyangmendasari terbentuknyatujuanstabilisasihargadalamindustri-industritertentuyang produknyasangatterstandarisasi(misalnyaminyakbumi).Tujuan stabilisasidilakukandenganjalanmenetapkanhargauntuk 20mempertahankanhubunganyangstabilantarahargasuatuperusahaaan dan harga pemimpin industri (industri leader). 5.Tujuan-tujuan lainnya Hargadapatpuladitetapkandengantujuanmencegahmasuknyapesaing, mempertahankanloyalitaspelanggan,mendukungpenjualanulang,atau menghindaricampurtanganpemerintah.Organisasinon-profitjugadapat menetapkantujuanpenetapanhargayangberbeda,misalnyauntuk mencapai partial cost recovery, full cost recovery, atau untuk menetapkan sosial price. Tujuan-tujuanpenetapanhargadiatasmemilikiimplikasipentingterhadap strategi bersaing perusahaan. Tujuan yang ditetapkan harus konsisten dengan cara yangditempuhperusahaandalammenempatkanposisirelatifnyadalam persaingan.Misalnya,permulihantujuanberorientasipadalabamengandung makna bahwa perusahaan akan mengabaikan harga para pesaing. Pilihan ini cocok diterapkan dalam 3 kondisi, yaitu: a.Tidak ada pesaing. b.Perusahaan beroperasi pada kapasitas produksi maksimum. c.Harga bukanlah atribut yang penting bagi pembeli. Berbeda dengan tujuan berorientasi pada laba, pemilihan tujuan berorientasi pada volumedilandaskanpadastrategimengalahkanataumengatasipersaingan. Sedangkantujuanstabilisasihargadidasarkanpadastrategimenghadapiatau 21memenuhituntutanpersaingan.Dalamtujuanberorientasipadavolumedan stabilisasi, perusahaan harus dapat menilai tindakan-tindakan pesaingnya. Dalamtujuanberorientasipadacitra,perusahaanberusahamenghindari persaingandenganjalanmelakukandiferensiasiprodukataudenganjalan melayani segmen pasar khusus. 2.10.Faktor-faktor yang Perlu Dipertimbangkan dalam Penetapan Harga Secara mum ada dua faktor utama yang perlu dipertimbangkan dalam menetapkan harga(KotlerdanAmstrong,1994),yaitufaktorinternalperusahaandanfaktor lingkungan eksternal. 2.10.1. Faktor internal perusahaan 1.Tujuan pemasaran perusahaan Faktorutamayangmenentukandalampenetapanhargaadalahtujuan pemasaranperusahaan.Tujuantersebutbisamaksimisasilaba, mempertahankankelangsunganhidupperusahaan,meraihpangsapasar yangbesar,menciptakankepemimpinandalamhalkualitas,mengatasi persaingan, melaksanakan tanggung jawab sosial, dan lain-lain. 2.Strategi bauran pemasaran Harga hanyalah salah satu komponen dari bauran pemasaran. Oleh karena itu,hargaperludikoordinasikandansalingmendukungdenganbauran pemasaran lainnya, yaitu produk, distribusi, dan promosi. 223.Biaya Biayamerupakanfaktoryangmenentukanhargaminimalyangharus ditetapkanagarperusahaantidakmengalamikerugian.Olehkarenaitu, setiap perusahaan pasti menaruh perhatian besar pada aspek struktur biaya (tetapdanvfariabel),sertajenis-jenisbiayalainnya,sepertiout-of-pocket cost,incrementalcost,opportunitycost,controllablecost,danreplacement cost. Untuk menganalisis pengaruh biaya terhadap strategi penetapan harga, ada tigamacamhubunganyangperludipertimbangkan.Pertama,rasiobiaya tetap terhadap biaya variabel. Bila proporsi biaya tetap terhadap biaya total lebihbesardaripadaproporsibiayavariabelnya,makapenambahan volumepenjualanakansangatmembantudalammeningkatkan penghasilan/laba.Situasisepertiinidikenaldenganistilahvolume sensitive.Salahsatunyaadalahperusahaanpenerbangan.Biasanyabiaya tetapnyamencakupsekitar60hingga70persendaribiayatotalnya. Apabila biaya tetap telah tertutupi, maka setiap tambahan tiket yang terjual akanmemberikanlabayangbesar.Akantetapi,adapulaindustriyang mengalamisituasisebaliknya(misalnyaindustrikertas),dimanabiaya variabelnyamemilikiproporsiyanglebihbesar.Situasiinidisebutprice sensitive,karenakenaikanhargasedikitsajadapatmeningkatkanlaba cukup besar. Kedua,skalaekonomisyangtersediabagisuatuperusahaan.Bilaskala ekonomisyangdiperolehdarioperasiperusahaancukupbesar,maka 23perusahaanyangbersangkutanperlumerencanakanpeningkatanpangsa pasardanharusmemperhitungkanharapanataspenurunanbiayadalam menentukanhargajangkapanjangnya.Alternatiflainadalahbila pengalamanperusahaandiharapkanbisamenghasilkanpenurunanbiaya, makahargadapatditurunkandalamjangkapanjanggunameraihpangsa pasar yang lebih besar. Ketiga,strukturbiayaperusahaandibandingkanpesaingnya.Bilasebuah perusahaanmemilikistrukturbiayayanglebihrendahdaripadapara pesaingnya,makaiaakanmemperolehlabatambahandengan mempertahankanhargapadatingkatkompetitif.Labatambahantersebut dapatdipakaiuntukmempromosikanproduknyasecaraagreseif. Sebaliknya,bilabiayasuatuperusahaanlebihtinggidibandingkanpara pesaingnya,makajangansampaiiaberinisiatifuntukmenurunkanharga, karena itu hanya akan mengarah pada perang harga dan ia pasti rugi. 4.Organisasi Manajemenperlumemutuskansiapadidalamorganisasiyangharus menetapkan harga. Setiap perusahaan menangani masalah penetapan harga menurutcaranyamasing-masing.Padaperusahaankecil,umumnyaharga ditetapkanolehmanajemenpuncak.Padaperusahaanbesarseringkali masalahpenetapanhargaditanganiolehdivisiataumanajersuatulini produk. Dalam pasar industri, para wiraniaga (salespeople) diperkenankan untukbernegosiasidenganpelanggannyagunamenetapkanrentang (range)hargatertentu.Dalamindustridimanapenetapanharga 24merupakanfaktorkunci(misalnyaperusahaanminyak,penerbanganluar angkasa),biasanyasetiapperusahaanmemilikidepartemenpemasaran ataumanajemenpuncak.Pihak-pihaklainyangmemilikipengaruh terhadappenetapanhargaadalahmanajerpenjualan,manajerproduksi, manajer keuangan, dan akuntan. 2.10.2. Faktor lingkungan eksternal 1.Sifat pasar dan permintaan Setiapperusahaanperlumemahamisifatpasardanpermintaanyang dihadapinya,apakahtermasukpasarpersaingansempurna,persaingan monopolistic,oligopoly,ataumonopoli.Faktorlainyangtidakkalah pentingnya adalah elastisitas permintaan. Tabel 2.1 Dimensi dan Macam Pasar Persaingan Dimensi Penting Macam Situasi Persaingan SempuranOligopoliPersaingan MonopolistikMonopoli Kekhasan produk masing-masing perusahaan Tidak adaTidak adaAdaKhas Jumlah peserta persaingan BanyakBeberapaBeberapa sampai banyakTidak ada Ukuran para peserta persaingan (dibandingkan dengan ukuran pasar) KecilBesarBesar sampai kecilTidak ada 25 Elastisitas permintaan yang dihadapi perusahaan Sangat elastisKurva permintaan berbelok (elastic dan inelastic) Salah satuSalah satu Elastisitas permintaan industri Salah satuInelastisSalah satuSalah satu Pengendalian harga oleh perusahaan Tidak adaAda (harus berhati-hati)AdaSepenuhnya 2.Persaingan Menurut Porter (1985), ada lima kekuatan pokok yang berpengaruh dalam persaingansuatuindustri,yaitupersainganindustriyangbersangkutan, produksubstitusi,pemasok,pelanggan,danancamanpendatangbaru. Informasi-informasiyangdibutuhkanuntukmenganalisiskarakteristik persaingan yang dihadapi antara lain meliputi: a.Jumlah perusahaan dalam industri Bilahanyaadasatuperusahaandalamindustri,makasecarateoritis perusahaanyangbersangkutanbebasmenetapkanharganya seberapapun.Akantetapisebaliknya,bilaindustriterdiriatasbanyak perusahaa, maka persaingan harga terjadi. Bila produk yang dihasilkan tidakterdiferensiai,makahanyapemimpinindustriyangleluasa menentukan perubahan harga. b.Ukuran relatif setiap anggota dalam industri 26Bilaperusahaanmemilikipangsapasaryangbesar,makaperusahaan yangbersangkutandapatmemeganginisiatifperubahanharga.Bila pangsa pasarnya kecil, maka hanya menjadi pengikut. c.Diferensiasi produk Bila perusahaan berpeluang melakukan diferensiasi dalam industrinya, makaperusahaantersebutdapatmengendalikanaspekpenetapan harganya,bahkansekalopunperusahaanitukecildanbanyakpesaing dalam industri. d.Kemudahan untuk memasuki industri yang bersangkutan Bilasuatuindustrimudahuntukdmasuki,makaperusahaanyangada sulitmempengaruhiataumengendalikanharga.Sedangkanbilaada hambatan masuk ke pasar (barrier to market entry), maka perusahaan-perusahaanyangsudahadadalamindustritersebutdapat mengendalikan harga. Hambatan masuk ke pasar dapat berupa: Persyaratan teknologi, Investasi modal yang besar, Ketidaktersediaan bahan baku pokok/utama, Skalaekonomisyangsudahdicapaiperusahaan-perusahaanyang telah ada dan sulit diraih oleh pendatang baru, Kendaliatassumberdayaalamolehperusahaan-perusahaanyang sudah ada, 27Keahlian dalam pemasaran. 3.Unsur-unsur lingkungan eksternal lainnya Selainfaktor-faktordiatas,perusahaanjugaperlumempertimbangkan faktorkondisiekonomi(inflasi,boomatauresesi,tingkatbunga), kebijakan dan peraturan pemerintah, dan aspek sosial (kepedulian terhadap lingkungan). 2.11.Metode Penetapan Harga Secaragarisbesarmetodepenetapanhargadapatdikelompokkanmenjadiempat kategoriutama,yaitumetodepenetapanhargaberbasispermintaan,berbasis biaya, berbasis laba, dan berbasis persaingan. 2.11.1. Metode penetapan harga berbasis permintaan Metodeinilebihmenekankanfaktor-faktoryangmempengaruhiseleradan preferensipelanggandaripadafaktor-faktorsepertibiaya,laba,danpersaingan. Permintaan pelanggan sendiri didasarkan pada berbaga pertimbangan, diantaranya yaitu: a.Kemampuan para pelanggan untuk membeli (daya beli), b.Kemauan pelanggan untuk membeli, c.Posisisuatuprodukdalamgayahiduppelanggan,yaknimenyangkut apakah produk tersebut merupakan symbol status atau hanya produk yang digunakan sehari-hari, 28d.Manfaat yang diberikan produk tersebut kepada pelanggan, e.Harga produk-produk substitusi, f.Pasar potensial bagi produk tersebut, g.Sifat persaingan non-harga, h.Perilaku konsumen secara umum, i.Segmen-segmen dalam pasar. Palingsedikitadatujuhmetodepenetapanhargayangtermasukdalammetode penetapan harga berbasis permintaan, yaitu skimming pricing, penetration pricing, prestigepricing,priceliningpricing,odd-evenpricing,demand-backward,dan pricing bundle pricing. 1.Skimming pricing Strategiiniditerapkandenganjalanmenetapkanhargatinggibagisuatu produk baru atau inovatif selama tahap perkenalan, kemudian menurunkan hargatersebutpadasaatpersainganmulaiketat.Strategiinibarubisa berjalanbaikjikakonsumentidaksensitiveterhadapharga,tetapilebih menekankanpertimbangan-pertimbangankualitas,inovasi,dan kemampuan produk tersebut dalam memuaskan kebutuhannya. Bila segmen pasar yang tidak sensitive terhadap harga ini telah terpuaskan (dilayanidenganbaik),makaperusahaanakanmenurunkanharganya untukmenariksegmenpasarlainnya,yaknisegmenyanglebihsensitive terhadapharga.Kadangkalapenurunanhargainidiikutipuladengan 29sedikitmodifkasiproduk.MisalnyanovelTheChamberJohnGrisham ditawarkan pertama kali dalam edisi hardcover, kemudian beberapa waktu kemudiandiproduksipulaedisibukusakuuntukmenjangkausegmen pasar lainnya. 2.Penetration pricing Dalamstrategiiniperusahaanberusahamemperkenalkansuatuproduk barudenganhargarendahdenganharapanakanmemperolehvolume penjualanyangbesardalamwakturelatifsingkat.Selainitustrategiini juga bertujuan untuk mencapai skala ekonomis dan mengurangi biaya per unit.Padasaatyangbersamaanstrategipenetrasijugadapatmengurangi minatdankemampuanpesaing,karenahargayangrendahmenyebabkan margin yang diperoleh setiap perusahaan menjadi terbatas. 3.Prestige pricing Hargadapatdigunakanolehpelanggansebagaiukurankualitasatau prestise suatu barang/jasa. Dengan demikian bila harga diturunkan sampai tingkat tertentu, maka permintaan terhadap barang atau jasa tersebut akan turun. Gambar dibawah menunjukkan bahwa dari titik A ke B, konsumen menganggap penurunan harga sebagai efek dari tawar-menawar, karena itu mereka membeli dalam jumlah yang lebih banyak. Akan tetapi dari titik B keC,merekameragukankualitasdanprestisebarangataujasa bersangkutan,sehinggamerekaakanmengurangipembeliannya.Strategi yang tepat di sini adalah mempertahankan tingkat harga agar tetap berada di atas titik P0. 30 Gambar 2.1 Prestige pricing merupakan strategi menetapkan tingkat harga yang tinggi sehinggakonsumenyangsangatpedulidenganstatusnyaakantertarik denganproduk,dankemudianmembelinya.Produk-produkyangsering dikaitkandenganprestigepricingantaralainpermata,berlian,parfum, porselin,limousing,jaketkulit,danlain-lain.Produk-produkinimalah sulit laku bila dijual dengan harga murah. 4.Price lining Price lining digunakan apabila perusahaan menjual produk lebih dari satu jenis.Hargaproduktersebutbisabervariasidanditetapkanpadatingkat hargatertentuyangberbeda.Misalnyahargaliniprodukpakaianwanita ditetapkanpadatingkat harga Rp 50.000,-; Rp 79.000,-; dan Rp 99.000,-. Gambardibawahmenunjukkanbahwapermintaanbersifatelastispada masing-masingtingkatharga,tetapiinelastisdiantaraberbagaitingkat harga tersebut.31 Gambar 2.2 Price lining dapat dilakukan dengan 2 cara, yaitu: a.Produsen menjual setiap item barang dengan harga yang sama kepada pengecer.Kemudian pengecer menambahkan persentasemarkup yang berbedauntukmasing-masingitem,sehinggatingkatharganya berbeda.Kriteriayangmendasaripembedaantersebutadalahwarna, model, dan permintaan yang dihadapi. b.Produsenmerancangprodukdengantingkathargayangberbeda-beda danpengecermenambahkanpersentasemarkupyangrelatifsama, sehinggahargajualyangditawarkankepadakonsumenakhirnya bervariasi. Biasanya variasi tingkat harga yang baik berkisar antara 3 hingga 4 macam tingkatharga.Bilaterlampaubanyak,makajustruakanmembingungkan konsumen. 5.Odd-even pricing 32Bila kita masuk ke sebuah supermarket, kerapkali kita menjumpai barang-barangyangditawarkandenganhargayangganjil,misalnyaRp1.595,- danRp9.975,-.Pertanyaanyangbisamunculadalahbukankahharga-haraga tersebut sebenarnya sama saja dengan Rp 1.600,- dan Rp 10.000,-? ApalagisaatinisulitmencarikembalianRp5,-,Rp10,-danRp25,-, bahkan seringkali malah dengan permen. Harga-hargatersebutditetapkandenganmetodeodd-evenpricing,yakni hargayangbesarnyamendekatijumlahgenaptertentu.Masihbanyak kelompokkonsumenyangmenganggapbahwahargaRp9.975,-masih dibawah Rp 10.000,-, artinya bila dibayar dengan Rp 10.000,- maka masih adakembaliannya.HargasebesarRp9.975,-masihberadadalamkisaran Rp9.000,-an,bukanRp10.000,-an.Padapraktiknyamemanguntuk satuanataukuantitasyangkecil,strategiinikurangmengenasasaran. Tetapibilamenyangkutsatuanataukuantitasbesarataupundikaitkan denganpembelian(belanjaan)berbagaimacamproduklainnya,maka hasilnya akan lebih efektif. 6.Demand-backward pricing Perusahaan kadangkala memperkirakansuatutingkathargayangbersedia dibayar konsumen untuk produk-produk yang relatif mahal seperti halnya shoppinggoods(misalnyapakaiandansepatuuntukanak-anakdan wanita;mainananak-anak).Kemudianperusahaanyangbersangkutan menentukanmarginyangharusdibayarkankepadawholesalerdan retailer. Setelah itu barulah harga jualnya dapat ditentukan. Jadi proses ini 33berjalankebelakang,sehinggaistilahnyadisebutdemand-backward pricing.Berdasarkansuatutargethargatertentu,kemudianperusahaan menyesuaikankualitaskomponen-komponenproduknya.Dengankata lain,produkdidesainsedemikianrupasehinggadapatmemenuhitarget harga yang ditetapkan. 7.Bundle pricing Bundle pricing merupakan strategi pemasaran dua atau lebih produk dalam satu harga paket. Misalnya travel agency menawarkan paket liburan yang mencakuptransportasi,akomodasi,dankonsumsi.Bundlepricing didasarkan pada pandangan bahwa konsumen lebih menghargai nilai suatu pakettertentusecarakeseluruhandaripadanilaimasing-masingitem secara individual. Strategi ini memberikan manfaat besar bagi pembeli dan penjual.Pembelidapatmenghematbiayatotal,sedangkanpenjualdapat menekan biaya pemasarannya. 2.11.2. Metode penetapan harga berbasis biaya Dalam metode ini faktor penentu harga yang utama adalah aspek penawaran atau biaya, bukan aspek permintaan. Harga ditentukan berdasarkan biaya produksi dan pemasaran yang ditambah dengan jumlah tertentu sehingga dapat menutupi biaya-biaya langsung, biaya overhead, dan laba. 1.Standard markup pricing Dalamstandardmarkuppricing,hargaditentukandenganjalan menambahkan persentase tertentu dari biaya pada semua item dalam suatu 34kelasproduk.Misalnya,pemakaiandikenaitambahan15%,sepatu20%, arloji 25%, hem 15%, dan lain-lain. Metodeinibanyakditerapkandisupermarketdantoko-tokoeceran lainnyayangmenawarkanbanyakliniproduk.Persentasemarkup bervariasibesarnya,tergantungpadajenistokoeceran(pakaian,grosery, atau furniture) dan jenis produk yang dijual. Biasanya produk-produk yang tingkatperputarannyatinggidikarenakanmarkupyanglebihkecil daripadaproduk-produkyangtingkatperputarannyarendah.Contoh aplikasi ini dapat dilihat melalui gambar dibawah ini. Gambar 2.3 Darigambardiatasdapatdilihatbahwamarkupyangditetapkansemakin besarseiringdengansemakindekatnyaprodukkekonsumenakhir. Produsenmemperoleh15%markupatashargajualnya,wholesaler memperoleh 20%, dan retailer mendapatkan 40%. Kondisi ini dikarenakan semakindekatsuatuprodukkekonsumenakhir,makapenjualhanya 35memilikiprodukdalamvolumeyangkecildanharusmenyediakan berbagai macam pelayanan atau perhatian individual kepada pembeli. 2.Cost plus percentage of cost pricing Banyakperusahaanmanufaktur,arsitektural,dankonstruksiyang menggunakan berbagai variasei standard markup pricing. Dalam cost plus percentage-of-costpricing,perusahaanmenambahkanpersentasetertentu terhadapbiayaproduksiataukonstruksi.Metodeiniseringkalidigunakan untukmenentukanhargasatuitematauhanyabeberapaitem.Misalnya suatuperusahaanarsitekturmenetapkantarifsebesar15%daribiaya konstruksi sebuah rumah. Jadi, bila biaya konstruksi sebuah rumah sebesar Rp100jutadanfeearsiteksebsesar15%daribiayakonstruksi(Rp15 juta), maka harga akhirnya sebesar Rp 115 juta. 3.Cost plus fixed fee pricing Metode ini banyak diterapkan dalam prodk-produk yang sifatnya teknikal, sepertimobil,pesawat,atausatelit.Dalamstrategiinipemasokatau produsenakanmendapatkanhantiatassemuabiayayangdikeluarkan, seberapapunbesarnya,tetapiprodusentersebuthanyamemperolehfee tertentusebagailabayangbesarnyatergantungpadabiayafinalproyek tersebut yang disepakati bersama. Misalnya Singapura menyepakati untuk membayarPTSatelitKitasehargaRp2trilyunsebagaibiayapeluncuran satelitSS1danfeesebesarRp200milyar.Bilakemudianternyatabiaya peluncuranmembengkakhinggamencapaiRp3triliun,makafeeyang diterima PT Satelit Kita tetap sebesar Rp 200 milyar. 364.Experience curve pricing Metode ini dikembangkan atas dasar konsep efek belajar (learning effect) yang menyatakan bahwa unit cost barang dan jasa akan menurun antara 10 hingga30%untuksetiappeningkatansebesarduakalilipatpada pengalaman perusahaan dalam memproduksi dan menjual barang tersebut. Pengalamanperusahaantersebutdinyatakandalamvolumeproduksidan penjualan.Berdasarkankonsepinibiayanyaakanmenurunsebesar15% setiapkaliterjadipeningkatanvolumeproduksisebesar2kalilipat. Dengandemikianbiayaproduksidanpenjualanunitke100akansebesar 85%daribiayapadaunitke50,danseterusnya.Strategiinibanyak diterapkandalamperusahaan-perusahaanelektronik,misalnyatape recorder,kalkulator,TV,laserdisc,compactdisc,DVDplayer,dan sebagainya. 2.11.3. Metode penetapan harga berbasis laba Metodeiniberusahamenyeimbangkanpendapatandanbiayadalampenetapan harganya.Upayainidapatdilakukanatasdasartargetvolumelabaspesifikatau dinyatakan dalam bentuk persentase terhadap penjualan atau investasi. 1.Target profit pricing Target profit pricing umumnya berupa ketetapan atas besarnya target laba tahunan yang dinyatakan secara spesifik. Contoh penerapan metode ini: 37PTShandybermaksudmenggunakantargetprofitpricingdalam menetapkanhargalaserdisc,dimanainformasiselengkapnyaadalah sebagai berikut: Biaya tetap sebesar Rp 26 juta. Biaya variabel sebesar Rp 22.000,- per unit. Permintaankonsumentidaksensitifsampaidenganhargasebesar Rp 60.000,- per unit. TargetlabasebesarRp7jutaditetapkanatasdasarvolume penjualan tahunan sebesar 1.000 unit. Besarnya harga yang ditetapkan adalah: 55.000,- Rp Hargajuta 48 Rp juta 7 Rp Harga 1.000juta] 22 Rp juta 26 [Rp - Harga 1.000 juta 7 Rp1.000)] 22.000 (Rp juta 26 [Rp - 1.000] [Harga juta 7 Rp] Kuantitas) Variabel (Biaya Tetap [Biaya - Kuantitas] [Harga LabaTotal Biaya - Total Pendapatan Laba=+ =+ = + = + == 2.Target return on sales pricing Dalammetodeini,perusahaanmenetapkantingkathargatertentuyang dapatmenghasilkanlabadalampersentasetertentuterhadapvolume penjualan.Biasanyametodeinibanyakdigunakanolehjaringan-jaringan supermarket. Misalnya struktur biaya PT Chandra sebagai berikut: 38Biaya tetap sebesar Rp 26 juta. Biaya variabel sebesar Rp 22.000,- per unit. Permintaankonsumentidaksensitifsampaidenganhargasebesar Rp 60.000,- per unit. TargetlababerupaReturnonSalessenilai20%padavolume penjualan tahunan sebesar 1.250 unit. Besarnya harga yang ditetapkan: 53.500,- Rp P1.250 P1.250)] 22.000 (Rp juta 26 [Rp - 1.250] [P0,20Q PQ)] (VC [FC - Q] [P0,20TRTC - TR20%Penjualan TotalLaba TotalSales onReturnTarget = + = + === Pada harga Rp 53.500,- per unit dan kuantitas penjualan tahunan 1.250 unit, maka: ,- 13.375.000 Rp53.500.000 Rp - 66.875.000 RpTC - TR Laba,- 53.500.000 Rp1.250) 22.000 (Rp juta 26 RpQ) (VC FC TC,- 66.875.000 Rp1.250 53.500 RpQ P TR==== + = + == = = 39Bila diperiksa kembali maka diperoleh: 20%,- 66.875.000 Rp=,- 13.375.000 Rp Penjualan TotalLaba TotalSales onReturnTarget == 3.Target return on investment pricing DalammetodeiniperusahaanmenetapkanbesarnyasuatutargetROI tahunan,yaiturasioantaralabadenganinvestasitotalyangditanamkan perusahaanpadafasilitasproduksidanasetyangmendukungproduk tertentu.KemudianhargaditentukanagardapatmencapaitargetROI tersebut.Misalnyaseorangprodusenbolabaskettelahmengeluarkan investasisenilaiRp1milyardaninginmenetapkanhargayangakan menghasilkan ROI sebesar 20% (atau Rp 200 juta). Bila biaya per unitnya adalahRp16.000,-jumlahpenjualanyangdiharapkansebesar50.000 bola,makabesarnyahargauntukmemperolehROIdihitungdengan rumus: bola. per20.000,- Rp4.000 Rp 16.000 Rpbola 50.000milyar 1 Rp 20%16.000 RpDiharapkan yang PenjualanJumlah ikan Diinvestas yang Modal Diinginkan yang anPengembaliper UnitBiaya anPengembali SasaranuntukHarga=+ =+ =+ = 2.11.4. Metode penetapan harga berbasis persaingan Selainberdasarkanpadapertimbanganbiaya,permintaan,ataulaba,hargajuga dapat ditetapkan atas dasar persaingan, yaitu apa yang dilakukan pesaing. Metode 40penetapan harga berbasis persaingan terdiri dari empat macam, customary pricing, above, at, or below market pricing, dan sealed bid pricing. 1.Customary pricing Metodeinidigunakanuntukproduk-produkyangharganyaditentukan olehfaktor-faktorsepertitradisi,salurandistribusiyangterstandarisasi, atau faktor persaingan lainnya. Penetapan harga yang dilakukan berpegang teguhpadatingkathargalainnya.Penetapanberusahauntukmengubah hargadiluarbatas-batasyangditerima.Untukituperusahaan menyesuaikan ukuran dan isi produk guna mempertahankan harga. Contoh produkyangharganyabiasaditetapkandenganmetodeiniantaralain beras, gula, dan makanan ringan. 2.Above, at, or below market pricing Umumnyasangatsulituntukmengidentifikasihargapasarspesifikuntuk suatuprodukataukelasproduktertentu.Olehkarenaitu,seringkaliada perusahaan yang menggunakan pendektan subjektif dalam memperkirakan hargapesaingatauhargapasar.Berdasarkanpatokansubjektiftersebut, kemudianperusahaansecaracermatmemilihstrategipenetapanharga yang berada di atas, sama, atau di bawah harga pasar tersebut. Above-marketpricingdilaksanakandenganjalanmenetapkanhargayang lebih tinggi daripada harga pasar. Metode ini hanya sesuai digunakan oleh perusahaanyangsudahmemilikireputasiatauperusahaanyang menghasilkanbarang-barangprestise.Inidikarenakankonsumenkurang memperhatikanaspekhargadalampembeliannya,tetapimerekalebih 41mengutamakan kualitas atau faktor prestise yang terkandung dalam produk yangdibeli.Contohperusahaanyangmenerapkanmetodeiniadalah perusahaan jam tangan Rolex dan perusahaan busana rancangan Christian Dior. Dalam at-market pricing, harga ditetapkan sebesar harga pasar, seringkali dikaitkan dengan harga pesaing. Metode ini juga sering disebut going rate atauimitativepricing.Contohperusahaanyangmenerapkanstrategiini adalahSears,Revlon,danprodusenkemejaArow(CluettPeabody& Company). Strategi ini banyak digunakan dalam kondisi: Biayasulitdiukurdandirasakanbahwahargayangberlaku ditetapkanberdasarkanpendapatsebagianbesarperusahaandi dalam industri. Penyesuaiandenganhargayangberlakuumumdipandangsebagai cara yang tidak akan merusak keseimbangan dalam industri. Sulitmengetahuireaksipembelidanpesaingterhadapperbedaan antarahargajualperusahaandanhargarata-ratadalamindustri (harga pasar). Sementaraitubelow-marketpricingyangharganyaditetapkandibawah hargapasar,banyakditerapkanolehprodusenproduk-produkgenerik (misalnya obat-obatan) dan pengecer yang menjual produk dengan private brand(contohproduknyaantaralaingula,makanankecil,minuman ringan,dansebagainya).Hargayangditetapkanbiasanyaberkisarantara 8%hingga10%lebihrendahdaripadahargaprodukpesaingmerek 42nasinal.HeroSupermarketmerupakansalahsatupengeceryang menerapkan strategi ini, terutama untuk produk-produk private brand-nya. 3.Loss leader pricing Kadangkalauntukkeperluanpromosikhusus,adaperusahaanyang menjualhargasuatuprodukdibawahbiayanya.Tujuannyabikanuntuk meningkatkanpenjualanprdukyangbersangkutan,tetapiuntukmenarik konsumen untuk datang ke toko dan membeli pula produk-produk lainnya, khususnyaproduk-produkyangber-markupcukuptinggi.Jadi,suatu produk dijadikan semacam penglaris (pancingan) agar produk lainnya juga laku. Produkpenglaristersebutbiasanyadijualdengandasarpersediaan terbatas,misalnyahanyaberlakuselamapersediaanmasihadaatau hanya untuk 100 pelanggan pertama saja. Strategi ini banyak diterapkan disupermarketdandepartmentstore.Penetapanhargapenglaris(loss leader pricing) merupakan alat untuk mempromosikan pengecer (retailer) danbukanproduknya,sehinggakebanyakanprodusentidaksukabila produk-produknyadijadikanpenglaris.Inidisebabkanbeberaparisiko yangmungkintimbul.Pertama,produsenproduktersebutbisadiprotes toko(pengecer)laindanparapelangganyangberbelanjaditempatlain dengan harga normal. Mereka menganggap ada perbedaan perlakuan yang tidak adil. Kedua, produsen bakalan menghadapi perang harga, bila para pesaingindustrinyabereaksidenganmenurunkanharga.Danketiga, produk yang dijadikan penglaris bisa turun citra/prestise-nya. 43Adakalanyastrategiinidiselewengkanmenjadibait-and-switchpricing, di mana harga ditetapkan rendah untuk memikat pelanggan agar datang ke toko,tetapiketikamerekasampaiditoko,perusahaanberusaha menawarkanmodel-modelprodukyanglebihmahal.Pramuniaga berupayamemikatdanmembujukpelangganuntukmembelimodellain yang marginnya lebih besar dan lebih mahal harganya. Di Amerika Serikat praktiksepertiinidianggapilegal,karenaseringkalimengecohatau menipu pelanggan. 4.Sealed bid pricing Metodeinimenggunakansistempenawaranhargadanbiasanya melibatkanagenpembelian(buyingagency).Jadi,bilaadaperusahaan atau lembaga yang ingin membeli suatu produk, maka yang bersangkutan menggunakanjasaagenpembelianuntukmenyampaikanspesifikasi produkyangdibutuhkankepadaparacalonprodusen.Setiapcalon produsendimintauntukmenyampaikanhargapenawarannyauntuk kuantitasyangdibutuhkan.Hargapenawarantersebutharusdiajukan dalamjangkawaktutertentu,kemudiandiadakansemacamlelanguntuk menentukanpenawaranterendahyangmemenuhisyaratuntuk melaksanakan kontrak pembelian. 2.12.Penyesuaian-penyesuaian Khusus Terhadap Harga Penyesuaian khusus terhadap harga menurut daftar (list price) terdiri atas diskon, allowance, dan penyesuaian geografis (geographical adjusment). 442.12.1. Diskon Diskonmerupakanpotonganhargayangdiberikanolehpenjualkepadapembeli sebagai penghargaan atas aktivitas tertentu dari pembeli yang menyenangkan bagi penjual.Dalamstrategipemasarandikenalempatbentukdiskon,yaitudiskon kuantitas diskon musiman, diskon kas (cash discount), dan trade discount. 1.Diskon kuantitas Diskonkuantitasmerupakanpotonganhargayangdiberikanguna menorongkonsumenagarmembelidalamjumlahyanglebihbanyak, sehinggameningkatkanvolumepenjualansecarakeseluruhan.Selainitu, diskonkuantitasjugadapatmemberikanmanfaatberupapenurunanunit cost sebagai akibat pesanan dan produk dalam jumlah yang besar. Contoh diskonkuantitasadalahhargapembeliansuatumajalah.Misalnyauntuk pembelian1hingga10eksemplarharganyamasing-masingRp5.000,-; untuk11-25eksemplarharganyaRp4.900,-danuntuk26eksemplar keatas harganya Rp 4.750,-. Diskonkuantitasbisaditerapkanberdasarkanberbagaiukuran,misalnya nilai(dalamrupiah)barangyangdibeli,jumlahunitbarangyangdibeli, dansebagainya.Dalampraktik,diskonkuantitasseringtidakberwujud potongantunai,melainkanberupatambahanunityangditerimauntuk jumlahpembayaranyangsama(bonusataufreegoods)yangdiberikan kepadakonsumenyangmembelidalamjumlahbesar.Bisapulaberupa voucheruntukberbelanjaberikutnya.Diskonkuantitasterdiridaridua jenis, yaitu diskon kuantitas kumulatif dan diskon kuantitas non kumulatif. 45a.Diskon kuantitas kumulatif Diskon kuantitas kumulatif diberikan kepada konsumen yang membeli barang selama periode waktu tertentu, misalnya terus-menerus selama setahun. Adanya diskon ini menyebabkan konsumen akan terikat pada penjual selama periode tersebut apabila ia mengharapkan memperoleh potongan. b.Diskon kuantitas non kumulatif Diskonkuantitasnonkumulatifdidasarkanpadapesananpembelian secara individual. Jadi hanya diberikan pada satu pembelian dan tidak dikaitkandenganpembelian-pembeliansebelumdansesudahnya. Potonganinilebihmenekankanusahamerangsangpembeliandalam jumlahbesarpadasatukalipembeliandaripadaserangkaian pembelian. 2.Diskon musiman Diskon musiman adalah potongan harga yang diberikan hanya pada masa-masatertentusaja.Diskonmusimandigunakanuntukmendorong konsumenagarmembelibarang-barangyangsebenarnyabaruakan dibutuhkanbeberapawaktumendatang.Dengandemikian,diskon musimanberpengaruhpadapolapembeliankonsumen,sehinggafungsi persediaanataupenyimpananbergeserketangankonsumen.Bagi konsumensendiri,diskonmusimanmemberikanbeberapamanfaat. Pertama,hargaproduknyalebihmurah.Kedua,merekabiasaberbelanja denganlebihleluasadanterhindardariantripanjangyangbiasaterjadi 46bilamerekaberbelanjapadamusimramai.Danketiga,biasanyapada hari-harimenjelanghariHadakemungkinanterjadilonjakanharga sebagai akibat besarnya permintaan. Bila konsumen telah berbelanja jauh-jauh hari sebelumnya, maka ia akan terhindar dari situasi itu. Dinegara-negarayangmemilikiempatmusim,diskonmusimansering diberikanuntukpembelianproduk-produktertentu(terutamapakaian) padasaatmenjelangmusimdinginmaupunmusimpanas.Sedangkandi Indonesiapotongansemacam ini acapkali diberikan menjelang Hari Raya LebaranataumenjelangNataldanTahunBaru.Setelahmasapotongan berakhir, biasanya harga barang akan kembali seperti semula. 3.Diskon Kas (cash discount) Dalamberbagaitransaksijualbeliseringkaliditerapkancarapembayaran kredit.Melaluicarainipembelimemperolehmanfaatberupalebih singkatnyajangkawaktuperputarandana.Akantetapi,carainidapat memberatkanparapenjualkarenadananyaterikatpadapiutangdalam jangkawaktuyangcukuplama.Olehkarenaitu,penjualakanberusaha mengurangijumlahkredit.Salahsatucarayangditempuhadalahdengan jalanmenawarkancashdiscount,yangmerupakanpotonganyang diberikanapabilapembelimembayartunaibarang-barangyangdibelinya ataumembayarnyadalamjangkawaktutertentusesuaidenganperjanjian transaksi(terminpenjualan/salesterm).Misalnyadalamsalesterm dinyatakannilaitransaksiRp1jutadengantermin2/10,n/30.Artinya jangkawaktupelunasanadalah30harisejaktransaksijualbeli 47berlangsung.Bilapembelimelunasinyapadaharikesepuluhatau sebelumnya, maka ia akan mendapatkan potongan sebesar 2% (2% xRp 1 juta=Rp20.000,-).Sebaliknyabilapembayarandilakukansetelahhari ketigapuluh,makapembeliakandikenakanbungatertentuyangdiatur dengan perjanjian tersediri. 4.Trade (functional) discount Trade discount diberikan oleh produsen kepada para penyalur (wholesaler danretailer)yangterlibatdalampendistribusianbarangdanpelaksanaan fungsi-fungsitertentu,sepertipenjualan,penyimpangan,danrecord-keeping.Misalnyaprodusenmemberikanpotongansebesar25%darilist pricekepadaretailer.Begitupulakepadawholesaler,produsenmemberi potongan25%ditambah15%,denganharapanwholesalerakan memberikanpotongansebesar25%darilistpricekepadaretailer.Lini produk yang biasa menggunakan trade discount antara lain makanan, obat-obatan, dan perangkat keras. Selain empat macam diskon di atas, ada pula istilah harga obral (sale price), yakni diskon sementara dari harga menurut daftar (list price). Tipe diskon ini bertujuan mendorongpembeliansegera.Dengankatalain,untukmenikmatihargaobral, pelanggan mengorbankan kenyamanan membeli pada saat mereka memang ingin membeli----dansebagaigantinyamalahmelakukanpembelianjustrupadasaat penjual ingin menjual. 2.12.2. Allowance 48Seperti halnya dengan diskon, allowance juga merupakan pengurangan dari harga menurutdaftar(Iistprice)kepadapembelikarenaadanyaaktivitas-aktivitas tertentuyangdilakukanpembeli,Adatigabentukallowanceyangbiasa digunakan, yaitu: 1.Trade-in allowance Trade-inallowancemerupakanpotonganhargayangdiberikandalam sistemtukartambah.Misalnyaseorangpelangganinginmenukarkan sepeda motor Astrea 800 bekas pakai (second hand) dengan sepeda motor HondaGrand(harganyaRp3.500.000,-)disuatudealer,makapelanggan tersebuttinggalmenambahkansejumlahtertentu(Rp2.250.000,-)setelah hargadikuranginilaitaksiran(misalnyaRp1.250.000,-)terhadapsepeda motor tersebut. 2.Promotional allowance Promotionalallowancediberikankepadasetiappenjualdalamjaringan distribusiperusahaanyangmelakukanaktivitasperiklananataupenjualan tertentuyangdapatmempromosikanprodukprodusen.Bentuk promotionalallowancebisaberupapembayarantunaiyanglebihkecil atau jumlah produk gratis yang lebih banyak. 3.Product allowance Productallowanceadalahpotonganhargayangdiberikankepadapara pembeliyangbersediamembelibarangdalamkondisitidaknormal. Misalnyapembelianbarangyangbelumselesai100%,ukurannyatidak 49tepat, warnanya sudah luntur, modelnya sudah ketinggalan jaman, edisinya ketinggalan atau sudah lama (contohnya buku teks), atau juga produk yang rusak. Selaintigabentukallowancetersebut,adapulabentukkhususlainnya,seperti stocking allowance dan push money allowance (price money allowance). Stocking allowance atau kadang disebut pula slotting allowance diberikan kepada perantara tertentuagarprodusenmemperolehruangrakbagiproduknya.Misalnya, produsenmenawarkanprodukgratisatausejumlahuangtunaikepadajaringan supermarket supaya mereka bersedia memajang suatu produk baru. Sedangkan push money allowance diberikan kepada pengecer oleh produsen atau pedagang grosir untuk diteruskan kepada petugas penjualan toko atas jasa mereka menjualitemproduktertentusecaraagresif.Allowanceini(yangsifatnyaseperti komisi penjualan) dipakai untuk menjual produk baru, produk yang penjualannya lambat, dan barang-barang mahal (marginnya tinggi). Tunjangan seperti ini sering digunakanuntukmendorong[enjualanmebel,busana,costumerelectronics,dan kosmetik. 2.12.3. Penyesuaian geografis (geographical adjusment) Penyesuaiangeografismerupakanpenyesuaianterhadaphargayangdilakukan oleh produsen atau wholesaler sehubungan dengan biaya transportasi produk dari penjualkepembeli.Biayatransportasiinimerupakansalahsatuunsurpenting dalambiayavariabeltotal,yangtentunyaakanmenentukanhargayangharus dibayarolehpembeli.Adaduametodeyangbiasadigunakanuntukmelakukan peyesuaian geografis, yaitu: 501.FOB origin pricing FOB(FreeOnBoard)berartipenjualmenanggungsemuabiayasampai pemuatanprodukkekendaraanpengangkutyangdigunakan(misalnya kapal,truk,keretaapi,danlain-lain).UmumnyadalamFOBpricing penjualmenentukanlokasipemuatanproduk,yangseringkaliadalahdi pabrik,gudangpenjualataudipelabuhanterdekatdarilokasipenjual. Tanggungjawabatasprodukakanberalihkepadapembelibilaproduk sudahdimuatkekendaraanpengangkut.Segalabiayatransportasidan penangananprodukselanjutnyaditanggungpembeli.Pembeliyang berlokasipalingjauhdaripenjualakanmenanggungbiayatransportasi paling besar. 2.Uniform delivered pricing Dalammetodeini,hargayangditetapkanpenjualjugamencakupsemua biayatransportasi.Penjualmenentukancarapengangkutan,membayar biayapengangkutan,danbertanggungjawabatassegalakerusakanyang mungkinterjadi.Olehkarenaitu,tanggungjawabpenjualadalahsampai produk diterima pembeli. 2.13.Strategi Penetapan Harga Secaragarisbesarstrategipenetapanhargadapatdikelompokkanmenjadi8 kelompok, yaitu: 1.Strategi penetapan harga produk baru, 512.Strategi penetapan harga produk yang sudah mapan, 3.Strategi fleksibilitas harga, 4.Strategi penetapan harga lini produk, 5.Strategi leasing, 6.Strategi bundling-pricing, 7.Strategi kepemimpinan harga, 8.Strategi penetapan harga untuk membentuk pangsa pasar. 2.13.1. Strategi Penetapan Harga Produk yang Sudah Mapan Adabeberapafaktoryangmenyebabkansuatuperusahaanharusselalumeninjau kembalistrategipenetapanhargaproduk-produknyayangsudahadadipasar, diantaranya yaitu: 1.Adanyaperubahandalamlingkunganpemasaran,misalnyaadapesaing besar yang menurunkan harganya. 2.Adanyapergeseranpermintaan,misalnyaterjadiperubahanselera konsumen. Dalam melakukan penilaian kembali terhadap strategi penetapan harga yang telah diakukan,perusahaanmemilikitigaalternatifstrategi,yaitumempertahankan harga, menurunkan harga, dan menaikkan harga. 2.13.1.1.Mempertahankan harga Strategiinidilaksanakandengantujuanmempertahankanposisidalampasar (misalnyapangsapasardanprofitabilitasperusahaan)danuntukmeningkatkan 52citra yang baik di masyarakat. Ada beberapa persyaratan atau kondisi yang sesuai untuk menerapkan strategi ini, diantaranya: 1.Pasaryangdilayaniperusahaantidakterpengaruholehperubahan lingkungan. 2.Adaketidakpastianberkaitandenganreaksipelanggandanpesaing terhadap perubahan harga. 3.Imagemasyarakatterhadapperusahaandapatditingkatkandengan meresponpermintaanpemerintahataupendapatpublikuntuk mempertahankanharga.Biasanyahalinieratkaitannyadengansituasidi manapemerintahberusahamengendalikantingkatinflasi,sehingga perusahan-perusahaanyangadadimintauntukmempertahankanharganya pada tingkat tertentu. Melaluistrategimempertahankanharga,perusahaanberharapakanmemperoleh hasilberupastatusquoposisiperusahaandipasardansemakinbaiknyaimage masyarakatterhadapperusahaan.Padagilirannyakeduahaliniakanbermanfaat bagi perkembangan perusahaan di masa mendatang. 2.13.1.2.Menurunkan harga Adatigapenyebabataualasanyangmendorongsuatuperusahaanperlu menurunkan harga produk-produknya yang sudah mapan. Ketiga alasan tersebut: 1.Strategidefensif,dimanaperusahaanmemotonghargagunamenghadapi persaingan yang semakin ketat. 2.Strategiofensif,dimanaperusahaanberusahamemenangkanpersaingan. Halinierathubungannyadengankonsepkurvapengalamanyangintinya menyatakanbahwabiayaperusahaanakanmenurundalampresentase 53tertentusetiapkalipengalamannyaberlipatganda.Halinmengandung maknabahwaperusahaanyangmemilikipengalamanlebihbanyakakan memilikitingkatbiayayanglebihrendahdaripadaperusahaanyang pengalamannyamasihterbatas.Biayayangrendahiniakansangat menguntungkan, karena dapat menghasilkan laba besar. 3.Responterhadapkebutuhanpelangganyangdisebabkanilehperubahan lingkungan.Adanyainflasiyangberkelanjutandantingkathargayang semakinmelonjakdapatmenyebabkankonsumenmenjadisensitif terhadaphargadansetiapalternatifprodukyangada.Merekamenjadi semakinselektifdalamberbelanja.Olehkarenaitu,agarperusahaan menjadisemakinselektifdalamberbelanja.Olehkarenaitu,adar perusahaanbisamendapatkanperhatiandarikonsumen,makaiaperlu menurunkan harganya. Strategiinibukanlahstrategiyanggampangdilaksanakan,karenaperusahaan harusmemilikikemampuanfinansial yang besar dan sanggup menghadapi setiap kemungkinanpersainganyangtimbul,terutamadalamaspekharga.Selainitu perusahaan juga harus memahami fungsi permintaan terhadap produknya. Apabila strategimenurunkanhargadapatdilaksanakandenganbaik,makaperusahaan yangmenerapkannyamungkindapatmemperolehhasilberupamarjinlabayang lebih.Meskipundemikian,dalampraktiknyakeberhasilanstrategiinisangat ditentukanolehpersainganhargaantarperusahaandanelastisitasharga. Elastisitashargamerupakanintensitasreaksikonsumendalambentukperubahan jumlah barang yang diminta terhadap perubahan harga satuan produk tertentu. 54Faktoryangperludipertimbangkansecaracermatdalammemutuskanstrategi penurunan harga meliputi empat hal berikut: 1.Pengaruhjangkapanjangdaripenurunanhargatersebutterhadappara pesaingutama.Bilapenurunanhargayangdilakukansuatuperusahaan kemudiandibalasdenganpenurunanhargayanglebihbesarlagioleh pesaingnya,sementaraperusahaanyangbersangkutantidakmemiliki kemampuanfinansialyangkuat,makayangakanrugidalahperusahaan yang menurunkan harga pertama kali. 2.Kadangkaladalamsituasipersainganyangketat,hargasuatuprodukbisa sajaditetapkanlebihtinggidaripadamerek-mereklainapabilamemang produktersebutdipasarkansebagaiprodukyangberbedadarilainnya, misalnyadalamhalkeunggulankualitas.Dengandemikianbila perusahaan berusahan menciptakan image produk yang berkualitas tinggi, makastrategipenurunanhargaperludipertimbangkansecaramatang, karenadampaknyaakansangatbesarterhadappenjualandanlabayang dapat dihasilkan. 3.Pengaruhpenurunanhargapadasuatuprodukterhadapproduklainnya dalamsatuliniproduk.Halinidikarenakanhargaseringkalidianggap sebagaiindikatorkualitasproduk.Bisasajaterjadikondisidimana penurunansuatuprodukmenyebabkanimagekonsumenterhadapsemua produk yang dihasilkan perusahaan juga berubah total. 4.Pengaruhpenurunanhargaterhadapkinerjafinansialprodukyang bersangkutan.Biladiperkirakanbahwapenurunanhargadapat 55menyebabkanmelemahnyaprofitabilitasperusahaan,makasebaiknya keputusan menurunkan harga dihindari. 2.13.1.3.Menaikkan harga Menaikkanhargaprodukbiasanyadilakukandengantujuanuntuk mempertahankan profitabilitas dalam periode inflasi, mengambil keuntungan dari diferensiasi produk (baik diferensiasi riil maupun diferensiasi persepsi) atau untuk melakukansegmentasipasaryangdilayani.Dalamsituasiinflasi,hargaperlu disesuaikanbilaperusahaanbermaksuduntukmempertahankanprofitabilitasnya. Halinikarenasemuaelemendanjenisbiayamenjadimeningkatpadaperiode inflasi.Secarakonseptual,peningkatanhargayangdilakukanharusditetapkan padasuatutingkatyangmemungkinkanbesarnyalabasama,baiksebelum maupun adanya inflasi. Dalam situasi di mana suatu merek memiliki keunggulan diferensial dibandingkan mereklainnya,makaperusahaanbisamenaikkanharganyasehinggadapat memaksimumkanmanfaatprodukdanmemperolehkeuntungandarikeunikan produktersebut.Selainituhargajugabisadinaikkandengantujuanuntuk melakukansegmentasipasar.Misalnya,suatuperusahaanminumanringan melemparkanprodukbarunyayangdiarahkanbagiparaprofesionalmudayang sibuk.Hargaminumanringantersebutdapatditetapkanlebihtinggidaripada mereklainnya,misalnyakadarkalorinyarendah,dapatmenambahstaminadan energi, dan lain-lain. Palingtidakadaduapersyaratanyangperludipenuhiagarstrategiinidapat memberikan hasil yang memuaskan. Persyaratan tersebut adalah: 561.Elastisitas harga relatif rendah, tetapi elastisitasnya relatif akan tinggi bila berkaitan dengan faktor seperti kualitas atau distribusi. 2.Dorongan(reinforcement)dariunsurbauranpemasaranlainnya.Sebagai contoh,bilasuatuperusahaanmemutuskanuntukmenaikkanhargadan membedakanproduknyaberdasarkanaspekkualitas,makaaktivitas promosi dan distribusinya harus pula kualitas produk. Hasilyangdiharapkandaristrategimenaikkanhargainiadalahmarjinpenjualan yanglebihbesar,pasaryangtersegmentasi(berdasarkankesadaranakanharga, kualitas,danlain-lain),sertaunitpenjualanyanglebihbesarapabila diferensiasinya efektif. 2.13.2. Strategi Fleksibilitas Harga Strategi fleksibilitas harga terdiri atas dua macam strategi, yaitu strategi satu harga (hargatunggal)danstrategipenetapanhargafleksibel.Fleksibilitasdapat dilakukandenganjalanmenetapkanhargayangberbedapadapasaryang berlainanatasdasarlokasigeografis,waktupenyampaian/pengiriman,atau kompleksitas produk yang diharapkan. 2.13.2.1.Strategi satu harga (harga tunggal) Dalamstrategiini,perusahaanmembebankanhargayangsamakepadasetiap pelangganyangmembeliprodukdengankualitasdankuantitasyangsamapada kondisiyangsamapula(termasuksyaratpenjualannyasama).Strategiinisering dijumpaipadaperusahaan-perusahaanyangmelakukandistribusimassadan penjualanmassa.Tujuanstrategiiniadalahuntukmempermudahkeputusan penetapanhargadanuntukmempermudahkeputusanpenetapanhargadanuntuk mempertahankan goodwill serta menjalin hubungan baik dengan semua pelanggan 57(karenataksatupunpelangganyangmendapatkanhargakhususataudianggap lebih penting daripada pelanggan yang lain). Ada beberapa persyaratan yang perlu dipenuhi guna melaksanakan strategi ini, di antaranya: 1.Perluadanyaanalisissecaraterperincimengenaiposisiperusahaandan strukturbiayabiladibandingkandenganindustrimengenaiposisi perusahaandanstrukturbiayabiladibandingkandenganindustrisecara keseluruhan. 2.Dibutuhkaninformasiyangberkaitandenganvariabilitashargapada penawaran harga yang sama kepada tiap orang. 3.Perlu pemahaman atas skala ekonomis yang tersedia bagi perusahaan. 4.Dibutuhkan informasi tentang harga kompetitif, yaitu harga yang sanggup dibayar oleh pelanggan. Hasil yang diharapkan dari implementasi strategi satu harga meliputi empat aspek pokok, yaitu: 1.Biaya penjualan dan biaya administrasi yang semakin menurun. 2.Marjin laba yang konstan. 3.Image pelanggan yang baik terhadap perusahaan. 4.Pertumbuhan pasar yang stabil. 2.13.2.2.Strategi penetapan harga fleksibel Strategipenetapanhargafleksibelmerupakanstrategipembebananhargayang berbedakepadapelangganyangberbedauntukprodukyangkualitasnyasama. Tujuanstrategiiniadalahuntukmemaksimalkanlabajangkapanjangdan memberikankeluwesandenganjalanmemungkinkan setiap penyesuaian, baik ke bawah maupun ke atas terhadap harga. Penyesuaian harga sangat tergantung pada 58tingkatpersainganyangdihadapi(hargapesaing),hubungandenganpelanggan, danseberapabesarpelangganbersediamembayaruntukproduktersebut (termasukdidalamnya kemampuan tawar-menawar pelanggan). Penetapan harga fleksibel banyak diterapkan dalam kalangan saluran distribusi, penjualan langsung produk-produk industrial,dan pada penjualan eceran produk-produk yang mahal, serta dalam pemasaran homogeneous shopping products (McCarthy dan Perreault, 1995). Strategiinimengandungbeberapakelemahan.Pertama,seorangpelangganyang mengetahuibahwaadaoranglainyangmenikmatihargalebihmurahuntuk mendapatkanbauranpemasaranyangsamaakanmerasatidakpuas.Kedua, apabilakonsumenmengetahuibahwatawar-menawardapatmenguntungkan mereka,makamerekaakanmelunangkanlebihbanyakwaktugunamenawar hargabarang.Halinibisamempengaruhibiayapenjualan.Kelebahanketiga adalahsebagianbesarwiraniagaakanterbiasamelakukanpenurunanharga.Ini mengurangiperananhargasebagaialatpersaingandanmenyebabkanturunnya harga.Selainitu,diAmerikaSerikatadapembatasanterhadapmetodeiniuntuk mencegahtimulnyadiskriminasihargayangmenjuruspadaupaya menekan/menghapuspersaingandanoenciptaanmonopoli(Berkowitzetal., 1992) Persyaratanyangperludiperhatikandalamstrategipenetapanhargafleksibel antara lain meliputi: 1.Perusahaanmemilikisegalainformasiyangdibutuhkanuntuk mengimplementasi strategi penetapan harga fleksibel. Biasanya strategi ini diimplementasikan dengan salah satu dari empat cara berikut: 59a.Berdasarkan pasar (segmen pasar maupun lokasi geografis), b.Berdasarkan produk, c.Berdasarkan timing, d.Berdasarkan teknologi. 2.Perlu dilakukan analisis customer-value terhadap produk. 3.Penekanan lebih besar pada marjin laba daripada volume penjualan. 4.Pemantauan terhadap reaksi persaingan terhadap perubahan harga di masa lampau. Hasilyangdiharapkandariimplementasistrategiiniadalahpeningkatanlaba jangkapendekdanpeningkatanpenjualanyangmengarahpadapeningkatan pangsa pasar perusahaan. 60BAB III PELAKSANAAN KEGIATAN KKN-P 3.1. Gambaran Umum Obyek 3.1.1.Sejarah singkat dan perkembangan umum perusahaan IndosatyangmerupakankependekandariIndonesianSatelliteCorporation didirikanpadatahun1967sebagaiperusahaantelekomunikasimultinasional AmerikaSerikat,InternationalTelephoneandTelegraphCorporation(ITT). Bisnis utama Indosat pada awal berdirinya adalah membangun, mengalihkan, dan mengoperasikanstasiunbumiintelsat,yangbersamaandenganmasuknyaera telekomunikasimoderndimanateknologisatelitmulaidiperkenalkandi Indonesia.SebagailangkahawaluntukmeningkatkanmutupejasaIndosat terhadapmasyarakat,makadibangunlahStasiunBumiSatelitInternasionaldi Jatiluhur, Jawa Barat. Padatanggal19Juni1967,sesuaiperjanjianantaraRepublikIndonesiadan ITT,tentangpembangunandanpengoperasiansatelitkomunikasi,Pemerintah Indonesiamendapat50%darihasilbersihlabadaripemakaiansatelit.Perjanjian tersebut sangat merugikan pihak Perumtel (yang sekarang PT TELKOM) sebagai BadanUsahaMilikNegarayangbertanggungjawabmenyelenggarakan telekomunikasi untuk umum dan luar negeri. Oleh karena itu, pada tanggal 28 Mei 1974diadakanperjanjianantaraIndosatdenganPerumtel,yangakhirnya menerima15%darikeuntunganpemakaianteleponinternasional.Padatahun 1997diresmikanlagisebuahantennasehinggamulaisaatituStasiunBumi Jatiluhurbekerjasamadenganduasistemantennayangmasing-masing 61menghadapkeposisiSatelitINTELSATdiatasSamuderaHindiadanSamudera Pasifik. Padatahun1980,IndosatmulaimengoperasikanSistemKomunikasiKabel Laut(SKKL)yangpertamayaituSKKLASEANIndonesia-Singapore(I-S), tetapi kepemilikan Indosat pada SKKL (I-S) tersebut dialihkan kepada Perusahaan Umum Telekomunikasi (Perumtel sekarang PT Telkom) yang kemudian disewa kembaliolehIndosat.PadaAkhirtahun1980,InternationalTelephoneand TelegraphCorporation(ITT)menjualIndosatkepadaPemerintahIndonesia berdasarkan PP No.52 / 1980 dan PP No.53 / 1980, maka Perumtel (sekarang PT Telkom)ditetapkansebagaiBadanUsahaPenyelenggaraJasaTelekomunikasi DalamNegeri.Sejakitu,IndosatmenjadiBadanUsahaMilikNegara(BUMN) yangberbentukPersero.Padatahun1983,dengantujuanmemisahkanjaringan telekomunikasidomesticdaninternasionalsecaraefektif,seluruhkepemilikan Perumtel maupun sentral gerbang dan operator telepon internasionalnya dialihkan kepadaPTIndosatdanbegitupunsebaliknya,PTIndosatmengalihkansemua aktivayangberkaitandengantelekomunikasidomestickepadaPerumtel.PT Indosat memperkenalkan jasa Sambungan Langsung Internasional (SLI 001) yang merupakan produk unggulannya. Padatahun1994,IndosatmendaftarkansahamnyadiNewYorkStock Exchange,BursaEfekJakarta(BEJ),danBursaEfekSurabaya(BES).Dengan pencatatansahamtersebut,resmilahPTIndosatmenjadiperusahaanpublicatau yangdisebutsebagaiPTIndosatTbk(terbuka).PadaakhirDesember2002, kepemilikansahamIndosatsebesar41,49%dijualkepadaSingapore 62TechnologiesTelemedia(STT)merupakananakperusahaanBUMNSingapura (termasuk Holdings) yang juga memiliki Sing Tel. Untukmengoptimalisasikansemuasumberdayayangdimilikitermasuk kelimaanakperusahaannya(Satelindo,IM3,IM2,Indosatcom,Lintasarta),dan sebelumnyaterdapatenamanakperusahaannamunPTIndosattanggal7Januari 2005,melepaskepemilikanatas96,87persensahamPTSisindosatLintasbuana kepadaPTAnekaSpringTelekomindo.Totaldanatunaihasilpenjualanyang diterimaIndosatsebesarRp40miliar.PenjualankepemilikansahamIndosatdi Sisindosat ini merupakan bagian dari strategi Indosat untuk merestrukturisasi anak perusahaanyangtidakterkaitdenganbisnisutama.Melaluiprosesini,Indosat dapatsemakinfokusdibisnisseluler,sertaterusmenjagakesinambunganusaha pengembangan bisnis telekomunikasi tetap dan multimedia, data komunikasi dan internet(MIDI).PTIndosatmelaluioptimalisasiinidiharapkandayasaing perusahaandapatmeningkat.UntukitupadabulanMei2002laludibentuk IndosatGroupdimanaIndosatbertindaksebagaiholdingdengankelimaanak perusahaannyasebagaianggotakelompokusaha.DenganterbentuknyaIndosat Group ini maka Indosat mengakhiri aktivitasnya sebagai unit usaha sendiri. Pada tanggal31Desember2002,IndosatGroupmelakukanpenggabungan(spinoff) Indosatcom ke IM2. Dengandemikiansetelahspinnoffmakajumlahanggotakelompokusaha IndosatGroupberubahmenjadiempatbuahyaituIndosat,IM3,IM2,dan Lintasarta. Pada tanggal 20 November 2003 lalu bertepatan dengan HUT Indosat ke-36,secararesmitelahdilakukanpenandatangananpenggabunganusaha 63(merger) Sehingga Satelindo, Indosat GroIM3danBoup beranggBimagraha gotakan : keIndosatt,dinamakaanIndosatbaru. Indosaat IM2 Lintasarta Langkatentanglainternal peah awal yanangkahstraterusahaan. ng dilakukantegiyangakn oleh Indokandiambilosat Baru adlolehselurdalah menyruhunitkerjamakan perrjadilingkursepsi ungan 3.1.2.Viisi dan misii PT Indosaat Tbk. a.Visi TtelTobecome ecommunictheleadication netwoingcellulaork and servar/wireless vices providfocused, der in Indonfullyintegnesia. grated DatelIndalambahaekomunikadonesia. asaIndonesiterpadu esia:Meberfokus njadipenyselular/wiryelenggara relessyangjaringan gterkemukdan kadi b.Misi 64Toprovideanddevelopinnovativeandqualityproducts,services, and solutions, which offer the best value to our customers. To continuosly grow shareholders values. To provide better quality of life to our stakeholders. Dalam bahasa Indonesia: Menyediakandanmengembangkanproduk,jasa,dansolusiyang inovatifdanberkualitasuntukmemberikanmanfaatyangterbaik bagi pelanggan. Meningkatkan shareholder values secara terus menerus. Mewujudkan kualitas kehidupan stakeholder yang lebih baik. 3.1.3.Logo PT Indosat Tbk. Berubahorientasiberubahpulalogonya.LogoIndosatkiniberupatigaelips salingbersilangmembentukbunga.Masing-masingelipsmempunyaiarti tersendiri.MerahmelambangkanrakyatIndonesia,Birumenyimbolkan Teknologi,danKuningmelambangkanTelekomunikasi.Gabunganketigaelips tadi menggambarkaninteraksi dan kecendrungan bisnis komunikasi saat ini serta citra yang lebih akrab dan bersahabat. 3.1.4.Struktur Organisasi 65 Gambar 3.1 3.1.5.Bidang usaha PT Indosat Tbk. PTIndosatTbk.sepenuhnyatergabungdalampenyediajasajaringan telekomunikasiIndonesia,menyediakanjasakomunikasinasionaldan internasionalyanglengkapdiIndonesia.PTIndosatTbkmerupakanoperator selularterbesarkeduadanpemimpindalamjasakomunikasijarakjauhdi IndonesiajugamenyediakanjasaMIDIuntukkonsumenkorporatdanretaildi Indonesia. Selama tahun 2006, total pendapatan operasi yang diterima PT Indosat Rp 12,239 milyar (US$ 1,356.9 billion). Adapun jasa dan produk yang ditawarkan PT Indosat Tbk, meliputi: 66Cellularservices.PTIndosatTbk.menyediakanjasakomunikasiGSM900 dan1800yangkira-kiraberjumlah16,7jutapelangganselulardiIndonesia sampai31Desember2006.PTIndosatTbk.sedangmemfokuskanpada peningkatancakupanarea,kapasitas,dankualitasjaringanselularnyadengan membeli peralatan baru. Fixed telecommunications services. PT Indosat Tbk. merupakan leader dalam penyediajasasambunganjarakjauh,diukurdenganjumlahmenitpanggilan datangdankeluaruntuktahun2006.Untukmelengkapijasaselulardan memperluasjaluraksesdomestikdaninternationaljarakjauhpelanggannya, PTIndosatTbk.telahmeluncurkanjasafixedwirelessdanakanterus melakukan ekspansi. MIDIservices.PTIndosatTbk.menyediakanjasabroadbanddan narrowband,meliputijasaframerelay,jasaVSAT,jasainternetdanleased circuit,melaluiLintasarta,PTIndosatMegaMedia(IMM)danPTIndosat Tbk. itu sendiri. PT Indosat Tbk. menawarkan produk-produk utamanya untuk pelanggankorporat,retail,danwholesalerdalamusahamenyediakansolusi jasa komunikasi secara menyeluruh. 3.1.6.DivisiMIDI(MultimediaInteractiveDataCommunicationand Internet) Brand Management PT Indosat Tbk. Pertumbuhanyangpotensialataspenggunaanjasakomunikasidatadan jaringanlaintermasukjasainternet,membuatPTIndosatTbk.membentuk DivisiMIDIBrandManagementyangkhususuntukmelayanibisnisini.Produk danjasayangditawarkanPTIndosatTbk.untuksegmenbisnisinimeliputijasa high-speedpoint-to-pointinternasionaldandomestikdigitalleasedline 67broadband dan narrowband, jasa high-performance packet-switching, sewa satelit transponder,danjasabroadcasting.Ditahun2006,jasa-jasaMIDImemberikan kontribusi sebesar Rp 1.902,6 milyar atau 15,5% dari total pendapatan usaha yang diterima PT Indosat Tbk. Jasa-Jasa MIDI WorldLink,DirectLink,danDigitalDataNetwork.WorldLinkadalahjasa internationalleasedlinedanDigitalDataNetworkadalahjasadomestic leased line. Kedua jasa tersebut menyediakan high-speed, high-quality digital data circuit pada basis point-to-point, dan menawarkan line speed 64 Kbps 2 Mbpsuntuknarrowbandatau45Mbps155Mbpsuntukbroadband. KebanyakanpelangganbroadbandWorldLinkPTIndosatTbk.adalah penyediajasatelekomunikasiyangmembutuhkanbroadbandinternational datalink,sedangkanpelanggannarrowbandWorldLinkPTIndosatTbk. utamanya adalah korporasi yang ditujukan untuk penggunaan internal mereka. KoneksiVSATdigunakanuntukpelangganWorldLinkdanleasedlinelain yangberadadilokasiyangtidaksepenuhnyadidukungolehjaringan domestik.Untukpasardomestik,PTIndosatTbk.menawarkanjasadigital datanetworkmelaluiLintasartauntukpelanggankorporat.Ditahun2006, WorldLink,DirectLink,danDigitalDataNetworkmemberikankontribusi sebesar Rp 453,5 milyar, atau 23,8% total pendapatan usaha MIDI. IPVPN.PTIndosatTbk.menyediakanjasamulti-pointconnectivity, interkoneksiLANyangtahanujidanmendukungsecarapenuhdistribusi aplikasi-aplikasi perkantoran. 68FrameRelay.PTIndosatTbk.menyediakanjasaframerelayyang memanfaatkanteknologiterdepantelekomunikasikecepatantinggidengan biayaekonomisuntukhubunganantarLocalAreaNetwork(LAN)yang tersebardiberbagailokasi,baiklokasidiseluruhpelosoktanahair,maupun lokasidimancanegara.Pada31Desember2006,jasaframerelaydomestik Lintasartatelahtersediadi51kotabesardiIndonesiadanjasaframerelay internasionalIndosattelahtersedialebihdari225negaradipenjurudunia yangmelakukankerjasamadenganACASIA,C&W,danNTT.PTIndosat Tbk. mencatat pendapatan usaha sebesar Rp 387,3 milyar dari jasa ini di tahun 2006 atau 20,4% dari total pendapatan usaha MIDI. NationalLink. PTIndosat menyediakan jasa komunikasi digital pont to point denganteknologicircuitswitch,mempunyaikecepatantinggiserta menghasilkansuaradangambardengankualitasyangjernih.NationalLink disediakan bagi perusahaan di Indonesia dengan cakupan domestik secara on-line,baikinnercity(dalamkota)maupunintercity(antarkota).Kecepatan aksesNationalLinkmencapai64Kbpssampaidengan155Mbpsdengan pilihan solusi n x 64 Kbps, n x E1, 45 Mbps dan 155 Mbps. MPLS dan Metro Ethernet. MPLS dan Metro Ethernet merupakan jasa leased linedomestikyangberbasisIP.MPLSbanyakdigunakanuntukkoneksidari satu lokasi ke lokasi lain maupun any to any baik mesh maupun hub and spoke untukaplikasisuara,data,video,daninternetdengankecepatanmulai64 Kbpssampaidiatas2Mbpsuntuknarrowbanddan45Mbpssampai155 Mbpsuntukbroadband.MetroEthernetmenyediakanbandwidth berkecepatantinggidanmenawarkankecepatanportlinedari10Mbps, 69100Mbps,dan1Gbpsdansebuahethernetbasedengantambahanjaminan bandwidth 1 Mbps. SatelliteServices.LayananIndosatuntukteknologisatelitadalahdengan menyewakan transponder satelit Palapa C2 yang memiliki bandwidth tertentu kepadaperusahaandiIndonesia.SalahsatulayananIndosatuntukteknologi tersebut adalah Indosat Telecast Service. Layanan ini disediakan Indosat untuk pelanggan,khususnyanewsagency,newsbroadcastersdanparaevent organiser,sehinggapelangganbisamengirimkanberbagailiputanberita terkaitperistiwayangterjadidilapangansecaracepatdanlangsungdengan jangkauannasionalmaupuninternasional.Satelittidaksemata-matahanya berfungsiuntukbroadcasting.Namunsatelitjugadapatmemberikan kemudahan pelaku bisnis untuk mentransmisi data tanpa terinterupsi. Di tahun 2006, jasa satelit memperoleh pendapatan sebesar Rp 124,5 milyar atau 6,5% dari total pendapatan MIDI. InternetServices.PTIndosatTbk.menyediakanjasaInternetNetwork Provider untuk ISP dan Internet Access untuk pengguna akhir dan pelanggan korporat. Pada 31 Desember 2006, PT Indosat Tbk. mengoperasikan dua ISP-nyayangmemberikankontribusipendapatansebesarRp422milyar.IMM menyediakanjasadedicateddandial-up,pada31Desember2006telah memiliki pelanggan kira-kira berjumlah 50.000, lebih dari 10% dan 20% akses pasar internet dial-up dan internet dedicated yang PT Indosat Tbk. perkirakan di Indonesia. Untuk mengantisipasi peningkatan persaingan di bisnis internet, IMMtelahmengembangkanstrategiuntukbisnisnyamelaluipengembangan Internetprotocolbackbonediarea-areapotensiallewatpenyebaranhotspot 70umum,pendiriancustomercarecenters,mengembangkanjaringannyalewat rencanajointinvestmentdenganpenggunaanhybridfiberdanteknologi coaxial,sertapengembanganprosesbisnisnya.Lintasartamenawarkan pelanggannyaIdOLAuntukpenggunaindividudanLintasartaNetuntuk pelanggan korporatnya. Lewat IdOLA dan LintasartaNet, pelanggannya dapat mengaksesinformasidaribeberapapenyediadiIndonesiadanpenjurudunia. KorporatmungkinmenggunakanLintasartaNetuntukpromosiinternet, alokasisoftwaredankomputer,transaksidagangdomestikdaninternasional. Ditahun2006,pendapataninternetdial-upLintasartaturun3,2%dan pendapatan jasa internet dedicated-nya meningkat 32,5%. Pada akhir tahun 31 Desember2006,PTIndosatTbk.menerimapendapataninternetservices sebesar Rp 422 milyar atau 22,2% dari total pendapatan MIDI. VSATNet/IPdanVSATLink.JasaVSAT(VerySmallApertureTerminal) Net/IPmemberikansolusitelekomunikasidatadenganbiayaekonomisuntuk hubunganantarlokasi(point-to-multipoint)yangtidakdapatdilayanidengan mediakabel.JasaVSAT(VerySmallApertureTerminal)Linkmenawarkan layanansirkuitlangganandigitalpoint-to-pointberkecepatantinggidengan kualitaspre