616
3D numerical wave tank 90' bend elbow duct A class division A-60 class bulkhead 맞바람받이 선미방향으로 위임폐기 옆방향 아벨식밀폐시험 숙련선원 비정상운전 abnormal operation 비정상값 abnormal value 선내에 aboard 상방 above (ABV) 기준선상방 above base (A/B) 기선에서 이격거리 above baseline (A/B) 수상부투영면적 above-water projected area abrasion material 마멸시험 abrasive 절대압력 절대횡동요 절대온도 절대속도 절대영도 흡수단면적 흡수식냉동기 인접판 abutting plate 가속도 acceleration 가속영역 가속도계 합격품질수준 acceptable quality level 허용기준 acceptance criteria 인수자안벽시운전 허용요건 acceptance requirement 인수자해상시운전 Acceptance Sea Trial (AST) 인수자시운전 Acceptance Trial (AT) 출입문 access door 출입창구덮개 access hatch cover 접근창구 access hatchway 통로구멍 출입사다리 access ladder 출입 맨홀 access manhole 출입 트렁크 access trunk 접근성 부속품 사고 accident 사고범주 accident category 사고시나리오 accident scenario 사고하중 accidental loads 거주설비 accommodation 거주구갑판 현측사다리 거주구배치도 3차원수치파동수조 90도곡면 엘보덕트 A급 구획 A-60 급 격벽 aback abaft abandonment abeam Abel's close test able seaman 연마제 abrasion test 연마제 absolute pressure absolute rolling absolute temperature absolute velocity absolute zero absorption cross- section absorption refrigerating machine acceleration zone accelerometer Acceptance Harbor Trial (AHT) access hole accessibility accessory 거주용부선 accommodation barge accommodation deck accommodation ladder accommodation plan

kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

  • Upload
    vankhue

  • View
    222

  • Download
    0

Embed Size (px)

Citation preview

Page 1: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

3D numerical wave tank90' bend elbow ductA class divisionA-60 class bulkhead맞바람받이선미방향으로위임폐기옆방향아벨식밀폐시험숙련선원비정상운전 abnormal operation비정상값 abnormal value선내에 aboard상방 above (ABV)기준선상방 above base (A/B)기선에서 이격거리 above baseline (A/B)수상부투영면적 above-water projected areaabrasion material마멸시험abrasive절대압력절대횡동요절대온도절대속도절대영도

흡수단면적흡수식냉동기인접판 abutting plate가속도 acceleration가속영역가속도계합격품질수준 acceptable quality level허용기준 acceptance criteria인수자안벽시운전허용요건 acceptance requirement인수자해상시운전 Acceptance Sea Trial (AST)인수자시운전 Acceptance Trial (AT)출입문 access door출입창구덮개 access hatch cover 접근창구 access hatchway통로구멍출입사다리 access ladder출입 맨홀 access manhole출입 트렁크 access trunk접근성부속품사고 accident사고범주 accident category사고시나리오 accident scenario사고하중 accidental loads거주설비 accommodation

거주구갑판현측사다리거주구배치도

3차원수치파동수조90도곡면 엘보덕트A급 구획A-60 급 격벽

aback  abaft   abandonment   abeam Abel's close test     able seaman   

연마제abrasion test   연마제absolute pressure      absolute rolling absolute temperature   absolute velocity       absolute zero  absorption cross-section      absorption refrigerating machine 

acceleration zone      accelerometer  

Acceptance Harbor Trial (AHT)

access hole    

accessibility    accessory      

거주용부선 accommodation barge  accommodation deck   accommodation ladder  accommodation plan    

Page 2: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

거주구축기시험탑재중량누적곡선축전지 accumulator축열기 accumulator축압기 accumulator축전등 accumulator lamp아세틸렌가스발생기아세틸렌용접산세척탱크산세척취성

acid pickling

산성법내산페인트산성강음향방출 acoustic emission음향방출시험음향속도목표포착아크릴수지페인트 acrylic resin paint능동제어능동타주공정작업작업기간단축실제화물질량 actual cargo mass

실질작업투입시수실적선투입시수실제두께 actual thickness실제목두께 actual throat thickness동작신호구동시스템 actuation system작동시험 actuation test애덤슨링어댑터 adapter부가질량 added mass부가질량계수부가수질량부가관성모멘트 added moment of inertia부가중량법어덴덤 addendum어덴덤 원추가부기부호 additional notation

additional workadditive부착력시험 adhesion test단열압축단열효율단열팽창조정가능 핀지그 adjustable pin jig조정용관 adjustable pipe조정식축베어링자동반목가변속력조속기 adjustable speed governor

accommodation space  accumulation test      accumulative erection weight curve

acetylene gas generator acetylene welding      acid bath       acid brittleness 

산세척acid process   

acid resisting paint     acid steel      

Acoustic Emission Test (AET)acoustic velocity       acquisition     

active control  active rudder  activities on critical pathactivity duration reduction

Actual Hours of Work Performed (AHWP)actual man-hours used on previous ship

actuating signal 

Adamson's ring       

added mass coefficient added mass of water   

added weight method  

addendum circle       

추가공사첨가제adiabatic compression  adiabatic efficiency     adiabatic expansion    

adjustable shaft bearing    adjustable side block   

Page 3: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

조절식추력베어링조절토피스조절식드래그헤드조정볼트 adjusting bolt조절장치조절장치조정피스 adjusting piece조정나사adjusting shim조정주관청 Administration애드미럴티계수애드미럴티포금진입공기소음기선회전진거리 advance전진각 advance angle전진계수전진비전진속력 advance speed 전진시기조종주시동밸브

손도끼이지스체계 AEGIS안테나장치 aerial항공프로펠러공탄성해석 aero elastic analysis항공터빈풍향풍속계에어로포일 aerofoil에어로포일형 단면 aerofoil section

항공학

항공프로펠러해상에서 afloat

부유하는 afloatafloat condition아프라막스급 탱커 Aframax tanker고정식크레인

선미부선미끝 aft end (A.E.)선미기관선미피크 aft peak선미피크탱크선미수선 aft perpendicular (A.P.)후부스퍼드선체후반부선미흘수선미피크 after peak선미격벽선미피크탱크

adjustable thrust block adjustable toe piece    adjustable type drag head   

adjusting device adjusting gear  

adjusting screw 조정-심adjustment     

admiralty coefficient   admiralty gun-metal    admission air silencer  

advance coefficient     advance ratio  

advance timing advanced starting valve adz    

aerial propeller 

aero turbine    aero vane       

aeronautics    

aero-propeller 

부양상태A-frame derrick       에이(A)프레임 A-frame       aft body       

aft engine      

aft peak tank   

aft spud       after body      after draft     

after peak bulkhead     after peak tank 

Page 4: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

애프터스프링후연후부복수기지연발생후부선창최후단베어링선미포핏선미현호뒷톱마스트선미쪽으로 aftward맞바람선령 age of vessel 경년효과 ageing effect 계량기골재호퍼총괄생산계획시효시효경화 agitation좌초전진 ahead전진캠전진더미전진배기캠전진점화캠전진분사캠

전진조종밸브전진단전진터빈항로표지공기축압기공기최종냉각기채광통풍공간공기관겸용측심관공기블라스트 air blast공기분사분무기통기송풍기압축공기병공기제동기공기거품방파제공기케이싱공기공동 air cavity공기실환기지수풍동공기충진시험 air charging test기중차단기 Air Circuit Breaker (ACB)에어콕공기압축기 air compressor공기조화기공기조화 air conditioning공기조화장치공기로공기저장용기공기함유량 air content

선미수선 after perpendicular     after spring    after-burning  after-condenser after-generation after-hold      aftermost bearing      after-poppet   after-sheer    after-topmast  

against wind   

aggregate batcher      aggregate hopper      aggregate production planningaging  aging hardening 교반aground 

ahead cam     ahead dummy  ahead exhaust cam     ahead igniter cam      ahead injection cam    ahead maneuvering valve       ahead stage    ahead turbine  aids to navigation      air accumulator air after cooler air and light space     air and sounding pipe  

air blast atomizer      air blow       air blower     air bottle      air brake       air bubble breakwater  air casing      

air chamber    air change rate air channel     

air cock    

air conditioner       

air conditioning system air conduit     air container   

Page 5: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

공기함유율 공기냉각기 air cooler

공기냉각기세척수탱크공냉 air cooling공냉식공기통로공기부양선공기실린더통풍댐퍼탈습기통풍로공기이젝터공기빼기 air escape

공기빼기관공기뽑기공기여과기통기시험 air flow test에어갭공기망치공기조화장치 Air Handling Unit (AHU)

공냉경화강공기창공기가열기공기구멍 air hole (A/H)기적공기불요추진장치공기분사 air injection공기분사압력공기분사식공기입구 air inlet공기입구소음기공기흡입밸브공기중간냉각기공기재킷공기로커공기조절창공기구동식전등공기출구각공기통로공기관 air pipe공기관 폐쇄장치공기마개공기포켓 air pocket공기예열기공기압력계

air content ratio       

air cooler cleaning water tank 

air cooling system     air course      

Air Cushion Vehicle(ACV) air cylinder    air damper     air dryer       air duct air ejector     

air escape pipe 

air extractor   

air filter       

air gap 

air hammer    

air hardening steel     

air hatch       air heater      

air horn Air Independent Propulsion (AIP) system

air injection pressure  air injection type       

air inlet silencer       air inlet valve  air inter cooler air jacket      air lock air louver      air operating electric light      air outlet angle air passage    

air pipe head  air plug 

air preheater   air pressure gauge     

Page 6: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

공기펌프 air pump공기펌프레버공기배출정화 air purge

기포식액면계공기담금질공기율공기조절구공기탱크공기저항공기분리기공기소음기공기시동캠공기시동밸브공기흡입 air suction공기흡입관공기흡입구공기탱크기밀시험 air test (A/T)공기온도계통풍로공기밸브공기관 폐쇄장치 air vent head공기관공기세척기기적 air whistle

공기전달소음공냉익렬공냉실린더 air-cooled cylinder공냉식기관항공모함공기연료비율 air-fuel ratio무공기분사 airless injection무공기분사기관항공장애표시등기밀 airtight기밀격벽기밀문기밀시험공대함 유도탄항공화물수취증 AirWay Bill (AWB)경보 및 감시장치경보벨 alarm bell경보신호경보장치알코올기관알코올페인트 alcohol paint알코올온도계경고 alert에일리어징정렬 alignment구조정렬 alignment of structure알칼리도알키드수지페인트 alkyd resin paint전자세용접 all position welding전주등 all round light

air pump lever 

air purge type level gauge     air quenching  air rate air register    air reservoir   air resistance  air separator   air silencer    air starting cam air starting valve       

air suction pipe air suction port air tank 

air thermometer air trunk       air valve       

air vent pipe   air washer    

공기-아세틸렌용접 air-acetylene welding  airborne noise air-cooled cascade blade       

air-cooled engine      aircraft carrier 

airless injection engine airplane warning light  

airtight bulkhead       airtight door  airtight test    Air-to-Surface Missile (ASM)alarm and monitoring system

alarm signal    alarm system  alcohol engine 

alcohol thermometer   

aliasing 

alkalinity       

Page 7: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

총재화중량톤수 all told

전용착금속시험편통로악어가위절단기동소변태허용각도 allowable angle

allowable error허용적재하중 allowable hold loading 허용한계 allowable limit

인체진동허용한계진동허용한계

allowable load허용국부하중 allowable local loading허용화물질량 허용수직응력 allowable normal stress허용압력허용전단응력 allowable shear stress허용응력허용치 allowable valueallowable water velocity허용차 allowance누락자재 목록 allowance list합금 alloy합금철배관용 합금강관 Alloy Steel Pipes (SPA)합금강합금원소접안alongside repair접안 alongside ship개조 alterationalteration survey격창적하 alternate loadingalternate subcontractor교류전류 Alternating Current (AC)교류전동기 alternating current motor

교류동력계통교색섬광등 alternating flashing light

교색다섬광등교색다명멸등교색등 alternating light교색명멸등교번응력 alternating stress 대안제시대체동력원 alternative power supply대체동력원교류발전기 alternator알루미늄도금 aluminizing알루미늄 aluminum알루미늄합금 aluminum alloy방식알루미늄 aluminum anode

all weld metal test specimen   alley way      alligator shear allotropic transformation       

허용오차allowable limits of vibration to human body    allowable limits of vibration    허용하중allowable mass of cargo 

allowable pressure     

allowable stress 

허용유속

alloy iron      

alloy steel     alloying element       alongside pier  안벽수리

개조검사외주업체 변경

alternating current power network

alternating group flashing lightalternating group occulting light

alternating occulting lightalternative method proposal alternative source of power

Page 8: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

알루미늄청동일루미늄스프레이코팅 aluminum spray coating표준주위조건주위온도 ambient temperature주위환경시험 ambient test개정도 amendment plan

미국선급미국표준협회미국석유협회미국재료시험협회

미국냉동공조학회

미국기계학회미국수조회의미국용접학회아메리카 컵 경기 요트 America's Cup Yacht선체중앙부 amidships전류계 ammeter

암모니아흡수식냉동기암모니아압축식냉각기암모니아콘덴서 ammonia condenser암모니아청정기 ammonia purifier

암모니아냉매압축기무정형탄소수륙양용 장갑차수륙양용정상륙지휘함증폭기진폭 amplitude진폭변조 Amplitude Modulation (AM)해석피치 analysis pitch해석과정 analysis process닻 anchor앵커 anchor앵커암 anchor arm정박표시구 anchor ball앵커받침 anchor bed앵커빌 anchor bill앵커받침 anchor board앵커볼트 anchor bolt

aluminum bronze   

ambient reference condition

American Bureau of Shipping (ABS)American National Standards Institute (ANSI)American Petroleum Institute (API)American Society for Testing Materials (ASTM)American Society of Heating, Refrigeration and Air Conditioning Engineers (ASHRAE)American Society of Mechanical Engineers (ASME)American Towing Tank Conference (ATTC)  American Welding Society (AWS)

ammonia absorption refrigerating machine      ammonia compression refrigerating machine

ammonia refrigerating compressoramorphous carbon      Amphibious Assault Vehicle (AAV)amphibious boat Amphibious Command Ship (LCC)amplifier       

Page 9: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

앵커부이 anchor buoy

앵커체인 anchor cable

앵커캡스턴 anchor capstan앵커체인 anchor chain앵커체인 anchor chain cable앵커촉 anchor chock앵커크레인 anchor crane앵커크라운 anchor crown앵커대빗 anchor davit투묘시험 anchor drop-and-snub test정박료 anchor dues앵커플루크 anchor fluke양묘기 anchor gear양묘선 anchor handling boat앵커핸들링윈치 anchor handling winch앵커헤드 anchor head정박등 anchor light앵커라이닝 anchor lining앵커팜 anchor palm앵커패턴 anchor pattern고착쇠붙이 anchor piece앵커포켓 anchor pocket고정지점 anchor point앵커리세스 anchor recess앵커 링 anchor ring앵커로프 anchor rope앵커섀클 anchor shackle앵커샤프트 anchor shaft앵커섕크 anchor shank앵커스톡 anchor stock앵커스토퍼 anchor stopper앵커스위블 anchor swivel앵커텔레그래프 anchor telegraph앵커 목 anchor throat앵커텀블러 anchor tumbler앵커윈치 anchor winch양묘기 anchor windlass묘박지정박료묘박 anchoring묘박설비 anchoring equipment양묘기 anchoring gear투양묘시험 anchoring test무향실 anechoic chamber무향실 anechoic room풍속계풍향계 anemoscope아네로이드기압계형강 angle형강 angle bar각도계 angle gauge압력각 angle obliquity

anchorage anchorage 

anemometer 

aneroid barometer  

Page 10: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전진각받음각 angle of attack투영횡경사각 angle of attack in roll발산파각 angle of diverging wave표류각 angle of drift만남각 angle of encounter물가름각 angle of entrance횡경사각 angle of heel or list입사각 angle of incidence안식각 angle of repose횡동요각 angle of roll물모음각 angle of run표류각분무각도 angle of spray종경사각 angle of trim파도진행각 angle of wave direction무양력각 angle of zero lift앵글밸브 angle valve옹스트롬각가속도 angular acceleration전진각 angular advance운동량의 모멘트 angular momentum각운동 angular motion각속도 angular velocity아닐린 점 aniline point어닐링 annealing어닐링 로 annealing furnace연차검사 Annual Survey (AS)환상연소실 annulus combustion chamber표시계 annunciator양극 anodeanode current양극방식법회답기 answering flag회답기 answering pennant예연실 antechamber안테나 antenna주사안테나 antenna scanner안테나장치 antenna unit무연탄 anthracite (coal)클러터방지 anti-clutter충돌예방등 anti-collision light레이더충돌예방장치충돌예방장치 anti-collision system방식코팅 anticorrosive coating방식제 anticorrosive composition방식도료 anticorrosive paint방식테이프 anticorrosive tape방식처리 anticorrosive treatment노출보호복 anti-exposure suit방오 anti-fouling방오코팅 anti-fouling coating방오제 anti-fouling compositionanti-fouling paint부동액 antifreeze solution마찰감소제 antifriction composition마찰감소그리스 antifriction grease마찰감소금속 antifriction metal

angle of advance  

angle of sideslip  

angstrom 

양극전류anodic protection       

anti-collision radar system

방오도료

Page 11: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

감요장치 anti-motion device프라이밍방지관 anti-priming pipe횡동요방지봉 anti-rolling bar횡동요감쇠탱크 anti-rolling tankanti-skid bar대잠잠수함 antisubmarine submarine대잠수함전대잠함정 antisubmarine warfare ship결로방지 anti-sweat insulation대어뢰장갑판 anti-torpedo armament대어뢰정포 anti-torpedo boat gun모루 anvil비주기적인 aperiodic겉보기피치 apparent pitch겉보기횡동요 apparent rolling겉보기 미끄럼 apparent slip겉보기 미끄럼비 apparent slip ratio

겉보기 화물비중겉보기파고 apparent wave height겉보기파장 apparent wave length겉보기파도주기 apparent wave period겉보기무게 apparent weight불복신청 appeal on disagreement선체부가물 appendage선체부가물척도영향비적용규칙 applicable rule적용표준 applicable standard실습생 apprentice접근항주 approach run접근속력 approach speed

approval 승인도면 approved drawing승인된 제조자 approved maker승인도면 approved plan승인형식 approved type승인사용압력 approved working pressure근사 계산 approximate calculation에이프런 apronarbitration

중재재판소 arbitration tribunal아크 arc아크경납땜 arc brazing아크절단 arc cutting아크끝아크등아크길이 arc length내아크성재료 arc resistant material아크안정제 arc stabilizer아크스트라이크 arc strike순수용접시간 arc time아크전압 arc voltage

배관용 아크용접 탄소강관아크용접 arc welding아치선미재 arch아치식늑골구조 arch framing아치식배구조 arch principle

미끌림방지봉AntiSubmarine Warfare (ASW)

apparent specific gravity of cargo

appendage scale effect factor

승인

중재

arc end (of electrode)   arc lamp   

Arc Welded Carbon Steel Pipe (SPW)

Page 12: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

아치형선박 arch vessel문서보관소 archives면적계수 area coefficient면적곡선 area curve침수표면적 area of wetted surface면적비 area ratio아르곤아크용접 argon arc welding전기자 armature전기자코일 armature coil전기자철심 armature core전기자권선 armature winding장갑 armor장갑뒷판 armor backing장갑볼트 armor bolt장갑끝판 armor closing plate장갑받침 armor shelf장갑피복케이블 armored cable장갑호스 armored hose방탄판 armored plate장갑피복전선 armored wire배치도 arrangement plan입항 arrival비소청동 arsenic bronze선용품 articles for ship

관절기둥형계류다관절형크레인 articulated crane모조공중선 artificial antenna연탄 artificial coal인공통풍 artificial draft인공지능 artificial intelligence인공시효처리 artificial seasoning인공통풍 artificial ventilation

합리적 실행가능한 낮은 수준석면 asbestos석면판 asbestos board석면포 asbestos cloth

석면보온재석면마대 asbestos lagging석면패킹콕 asbestos packed cock석면패킹석면판 asbestos plate석면링 asbestos ring석면판 asbestos sheet석면테이프 asbestos tape완성도면 as-built drawing건조총두께 as-built gross thickness건조두께 as-built thickness무회연료 ash free fuel소각재 배출구 ash-shoot종횡비 aspect ratio압연강 as-rolled steel대조립 assembly조립용 지그플랜 assembly jig plan조립라인 assembly line

assembly stage

articulated column type mooring

As Low As Reasonably Practicable (ALARP)

asbestos heat insulating material

asbestos packing  

조립공정

Page 13: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소집장소 assembly station보조실린더 assistant cylinder조기원 assistant oiler관련작업공정 associated work processes후진 astern후진캠 astern cam후진더미 astern dummy후진배기캠 astern exhaust cam후진중간밸브 astern guardian valve후진점화캠 astern igniter cam후진조종밸브 astern maneuvering valve후진노즐 astern nozzle후진출력 astern output후진출력 astern power후진단 astern stage후진시험 astern test후진터빈 astern turbine비대칭스핀 asymmetric spin옆방향 athwartship대기압복수기 atmospheric condenser대기방출관 atmospheric discharge pipe대기압드레인탱크 atmospheric drain tank대기방출관 atmospheric escape pipe대기배출 atmospheric exhaust대기선 atmospheric line대기오염 atmospheric pollution대기압 atmospheric pressure원자수소용접 atomic hydrogen welding원자질량단위 atomic mass unit원자력추진 atomic propulsion분무화 atomization분무기 atomizer중앙홀 atrium부착 attach부착캐비티 attached cavity부착판 attached plating 부착품 attachment부착 형강 attachment angle부착 플러그 attachment plug도달구획지수 attained subdivision index과열조절기 attemperator주의환기신호등 attention attracting light감쇠 attenuation인력 attraction가청식 audible가청경보 audible alarm자동경보수신기 auto alarm receiver자동여과기 auto filter자동부하경감장치자동변환기 auto-converter자동화선 automated ship자동아크용접 automatic arc welding자동보일러 제어 automatic boiler control자동전환 automatic changeover자동전환장비 자동체크밸브자동폐쇄장치

Auto Unloading System (AUS)

automatic changeover deviceautomatic check valve  automatic closing appliances

Page 14: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

자동연소제어자동제어 automatic control

자동화기기 작동시험자동급수조절기자동화재경보장치자동추종장치 automatic follow-up system자동가스절단 automatic gas cutting

자동식별장치 자동계선윈치 automatic mooring winch

자동항해 및 침로유지장치자동체크밸브 automatic non-return valve

자동충돌예방장치비상신호자동키장치자동복귀 automatic resetting자동소기밸브 automatic scavenging valve

자동복원팽창식구명뗏목센서위치자동추종장치자동정지 automatic shut down 자동살수소화장치 automatic sprinkler system자동시동장치 automatic starting system자동조타 automatic steering자동정지장치 automatic stopping device

자동온도기록계자동장력조절장치 automatic tension system자동추적장치 automatic tracking aids

자동전압 조정기자동용접 automatic welding자동차도선 automobile ferry

자주식무인잠수정자동조타장치 autopilot자동작도기 auto-plotter자동시동기 auto-starter단권변압기 autotransformer보조공기압축기 auxiliary air compressor보조공기이젝터 auxiliary air ejector보조공기탱크 auxiliary air reservoir보조밸러스트탱크 auxiliary ballast tank보조보일러 auxiliary boiler보조순환펌프 auxiliary circulating pump보조복수펌프 auxiliary condensate pump보조복수기 auxiliary condenser

보조제어콘솔

Automatic Combustion Control (ACC)

automatic control device operation testautomatic feed water regulatorautomatic fire alarm system

Automatic Identification System (AIS)

Automatic Navigation and Track-keeping System (ANTS)Automatic Radar Plotting Aids(ARPA)automatic radiotelegraph alarm signal keying device    

automatic self-righting inflatable liferaftautomatic sensor positioning equipment 

automatic temperature recorder

Automatic Voltage Regulator (AVR)

Autonomous Underwater Vehicle (AUV)

Auxiliary Control Console (ACC)

Page 15: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

개장순양함 auxiliary cruiser보조디젤기관 auxiliary diesel engine보조드레인펌프 auxiliary drain pump보조기관 auxiliary engine보기배기 auxiliary exhaust보기배기계통보조급수체크밸브 auxiliary feed check valve보조급수관계통 auxiliary feed line보조급수펌프 auxiliary feed water pump보조발전기 auxiliary generator

보조발전기용디젤기관보조발전기연료유탱크개장포함 auxiliary gunboat보조등 auxiliary light보기 auxiliary machinery

보기용디젤기관보기실보기용증기터빈보조타보조증기관보조조타장치보조스톱밸브보조배전반보조선유효에너지유효열량해손정산인

average error

평균운임요율해손항공브리핑실 aviation briefing room천막 awning천막붐차양갑판 awning deck천막대들보 awning rafter천막대들보 awning ridge천막횡재 awning spar천막기둥 awning stanchion천막살 awning stretcher축류송풍기 axial blower축방향틈 axial clearance축류압축기 axial compressor축방향댐퍼 axial damper축류 axial flow축류펌프 axial flow pump축류터빈 axial flow turbine축방향유기속도 axial induced velocity축하중 axial load축응력 axial stress축류속도 axial velocity종진동댐퍼 axial vibration damper동요기준축 axis of oscillation

auxiliary exhaust arrangement

auxiliary generator diesel engine auxiliary generator engine fuel oil tank

auxiliary machinery diesel engineauxiliary machinery room      auxiliary machinery steam turbineauxiliary rudder auxiliary steam pipe   auxiliary steering gear auxiliary stop valve    auxiliary switchboard   auxiliary vessel available energy       available heat  average adjuster       평균오차Average Freight Rate Assessment (AFRA)average 

awning boom   

Page 16: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용접기준축 axis of weld축대칭물체 axisymmetric body차축 axle축하중 axle load 방위각 azimuth방위환 azimuth circle방위컴퍼스 azimuth compass방위경 azimuth mirror선회식추진장치 azimuth propulsion system방위눈금 azimuth ring방위안정 azimuth stabilization방위표 azimuth table선회식추진기 azimuth thruster방위날개 azimuth vane애지포드 AZIPODB class division배빗금속 Babbitt metal뒷댐형강 back angle후면조립공사 back assembly뒷면비드 back bead배판 back board이면 브래킷 back bracket뒷면캐비테이션 back cavitation뒷면다듬질 back chipping뒷막음판 back end plate뒷면가우징 back gouging뒷면문걸이 back hook뒷댐재 back piece횡피치 back pitch배판 back plateback pressure배압터빈 back pressure turbine백로프 back ropeback stay역세척여과기 back wash filter역세척여과기 back wash strainer이면용접 back weldback wind뒷기둥 back-column역화 backfire후진용접 backhand welding뒷기둥 back-housing뒷댐형강 backing angle뒷댐재료 backing materials이면용접 backing pass전선도판 backing plate후진출력 backing power뒷댐편 backing stripbacklash후면마킹 backside marking후면언더컷 backside undercut백스테이 backstay후진용접법 back-step sequence후진용접 back-step weldingback-strip welding백업 backup뒷받침차단기 backup breaker백업펌프 backup pump

B급구획

배압

뒷당김줄

뒷바람 (순풍)

백래시

뒷댐편용접

Page 17: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

뒤로휜날개 backward curved vane후진계획법 backward scheduling조절판 baffle plate옷선반 bag rack소화물실 baggage room물푸개 bailer미끼 bait활어창 bait tank활어창 bait well평형 balance평형계수 balance factor평형추 balance weight밸런스드 체인 balanced chain평형타 balanced rudder평형추식하역법 balanced weight method밸런서 balancer평형시험기 balancing machine평형시험 balancing test포장화물용적 bale capacity포장화물 bale cargo포장화물용적 bale cargo capacity포장화물하역고리 bale slingball and socket coupling볼베어링 ball bearing볼조인트 ball joint볼진수 ball launching추력볼베어링 ball thrust bearing볼밸브 ball valve밸러스트 ballast밸러스트상태 ballast condition밸러스트조정실 Ballast Control Room (BCR)밸러스트펌프 ballast pump밸러스트펌프용디젤기관 ballast pump diesel engine밸러스트펌프용터빈 ballast pump turbine밸러스트스트리핑펌프 ballast stripping pump밸러스트흡입관 ballast suction pipe밸러스트탱크 ballast tank밸러스트수교환 ballast water exchange 밸러스트수탱크가속도오차방탄판 ballistic plate벌룬탑 balloon hatch

발틱국제해운동맹발틱운임지수 Baltic Freight Index (BFI)발틱해 내빙 Baltic ice class띠 band밴드브레이크 band brake밴드레벨 band level띠판 band plate뱅크 bank바 bar봉요소 bar element봉게이지 bar gauge봉격자 bar grating방형용골 bar keel봉강 bar steel바 선수재 bar stem

볼-소켓연결

ballast water tank     ballistic deflection 

Baltic and International Maritime Council (BIMCO)

Page 18: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

막대온도계 bar thermometer포탑장갑 barbette나용선 Bare Boat Charter (BBC)알몸용접봉 bare electrode알몸선체 bare hull나충전부 bare live part부선 barge

부선적립식펌프준설선부선형해상플랜트 Barge Mounted Plant (BMP)부선형플랫폼 barge type platform부선운반선 barge-carrying ship바크 bark바컨틴 barkentine따개비 barnacle기압계 barometer대기압 barometric pressure 바크 barque연속운전금지구역 barred speed range배럴 barrel중추가이드윈치 barrel hoisting winch배리어 barrier손수레 barrow바닥받침목 base block밑짐 base cargo모재 base metal모재시험편 base metal test specimen밑판 base plate기선 baseline밑면공기공급흐름 base-vented flows기본설계 basic design기본절연 basic insulation염기성강 basic steel계류시운전 basin trial외장 basket armor일괄처리 batch processing일괄청정 batch purification배처 batcher콘크리트믹서용 부선 batcher plant barge수심수온기록기 bathy thermograph바티스카프 Bathyscaphe배튼 batten죔장치 battening arrangement경사단면 battered section충전기 battery charger

배터리내장형비상등축전지식 전등 battery operated lamp순양전함 battle cruiser전함 battle ship항적추적기록기 battle tracer보메 비중계 Baume's hydrometer보메 눈금 Baume's scale바우싱거 효과 Bauschinger effect베이 bay베이어닛꼭지 bayonet base베이어닛연결 bayonet joint비치 마크 beach mark

barge loading cutter suction dredger

battery integrated emergency light

Page 19: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

표지 beacon표지부호 beacon sign표지국 beacon station비드용접 bead welding비딩 beading비딩곡선 beading line갑판보 beam선폭 beam보굽히개 beam bender갑판보브래킷 beam bracket갑판보캠버 beam camber갑판보클램프 beam clamp보기둥 beam column 보기둥좌굴 beam column buckling빔컴퍼스 beam compass폭흘수비 beam draft ratio보요소 beam element폭길이비 beam length ratio보본 beam mold빔러너 beam runner횡파 beam sea갑판보받침대 beam shelf갑판보간격 beam space보이론 beam theory빔트롤러 beam trawler빔폭 beam width옆바람 beam wind밀리기 bear away비어딩라인 bearding line받침 bearer방위 bearing베어링 bearing방위정도 bearing accuracy베어링부시 bearing bush베어링캡 bearing cap방위컴퍼스 bearing compass방위용움직눈금 bearing cursor방위식별능 bearing discrimination방위오차 bearing error축기진력 bearing force베어링캡 bearing keep방위눈금 bearing marker베어링메탈 bearing metal베어링빼내기공구베어링면압방위분해능 bearing resolution베어링링 bearing ring울림 beat보퍼트풍력 Beaufort force보퍼트풍력등급 Beaufort wind scale받침판 bedplatebehind schedule클리트 belaying cleat빌레잉핀 belaying pin호종 bell타종부표 bell buoy벨마우스 bell mouth관끝성형공구 bell mouth forming tool

bearing metal removing devicebearing pressure 

공정지연

Page 20: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

누름단추 bell push종형기적 bell whistle표시등붙이 벨 bell with a pilot lamp주름통 bellows주름통식압력계 bellows pressure gauge

벨로즈식신축관이음쇠벨트컨베이어 belt conveyor벨트구동 belt driving벨트풀리 belt pulley벤치마크검사 benchmark test벤드 bend굽힘 bending굽힘모멘트 bending moment굽힘모멘트곡선 bending moment curve굽힘반지름 bending radius굽힘가공장비 bending roll벌집정반 bending slab굽힘응력 bending stress굽힘본 bending template굽힘시험 bending test굽힘진동 bending vibration

bent pipe fabrication베르누이정리 Bernoulli's theorem 선대 berth정박지 berth선대경사 berth declivity침대등 berth light선대사용예정표 berth schedule베서머전로 Bessemer converter베서머강 Bessemer steel우현큰닻 best bower갑판간 화물구역 between deck cargo space갑판간 구획실 between deck compartment갑판간 between decksbevel베벨 bevel베벨각도베벨판 bevel board베벨늑골 bevel frame베벨기어 bevel gearbevel groove angle베벨바퀴 bevel wheel베벨측정기 beveling frame베벨기계 beveling machine베벨지레 beveller양색등 bi-colored light비데 bidet하단부표 bifurcation buoy빌지 bilge선저만곡부 bilge빌지블록 bilge block빌지보드 bilge board빌지부원호 bilge circle빌지코드 bilge cord빌지 외판 bilge curvature빌지이젝터 bilge ejector빌지햇 bilge hat

bellows type expansion pipe joint

곡관제작

개선bevel angle    

개선각도

Page 21: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

빌지저장탱크 bilge holding tank빌지호퍼 bilge hopper빌지호퍼탱크 bilge hopper tank빌지흡입장치 bilge injection빌지킬 bilge keel빌지부내용골 bilge keelson빌지주관 bilge main pipe빌지관 bilge pipe선저만곡부 외판 bilge plate빌지마개 bilge plug빌지펌프 bilge pump선저만곡부 반지름 bilge radius빌지분리유탱크 bilge separated oil tank빌지분리기 bilge separator선저만곡부 받침목 bilge shore선저만곡부 외판 bilge strake빌지스트링거 bilge stringer빌지흡입관 bilge suction pipe빌지탱크 bilge tank선저만곡부재 bilge timber빌지수 bilge water빌지웰 bilge well침수구획 bilged compartment쌍선형보간법 bilinear interpolation선하증권 Bill of Lading (B/L)자재명세서 Bill Of Material (BOM)빌보드 billboard빌릿 billet빈 bin유체병용사이클 binary fluid cycle고착제 binder비너클 binnacle비너클 등 binnacle lamp쌍안경 binocular

생화학적산소요구량생물오손 bio-fouling생체보호차폐 biologic shield이각마스트 bipod mast창연 bismuth비트 bit물림형유니언 bite type union역청시멘트 bituminous cement역청탄 bituminous coal역청에나멜 bituminous enamel역청액 bituminous solution흑구 black ball블랙볼트 black bolt흑색원추형상물 black conical shape

흑심가단주철흑연 black lead블랙월히치 black wall hitch블랙아웃 blackout블랙아웃시험 blackout test단접이음 blacksmith welded joint단접 blacksmith welding단접성 blacksmith welding quality

Biochemical Oxygen Demand (BOD)

black heart malleable cast iron

Page 22: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

날개 blade배토판 blade날개각 blade angle날개각지시계 blade angle indicator날개면적비 blade area ratio날개배열 blade arrangement날개뒷면 blade back날개열간격 blade clearance날개효율 blade efficiency날개요소이론 blade element theory날개앞면 blade face날개뒷날 blade following edge날개입구각 blade inlet angle날개열 blade lattice날개앞날 blade leading edge날개손실 blade loss날개사이 blade opening날개출구각 blade outlet angle날개압력면 blade pressure side날개프로파일 blade profile날개레이크 blade rake날개단면기준선 blade reference line날개링 blade ring날개뿌리 blade root날개단면 blade section날개단면기준점 blade section날개고정쇠 blade stopper날개흡입면 blade suction side날개두께 blade thickness날개두께비 blade thickness fraction날개두께비 blade thickness ratio날개끝 blade tip날개끝단간극 blade tip clearance날개뒷날 blade trailing edge날개끝소용돌이흐름 blade vortex flow날개나비 blade width날개배열 blading맹플랜지 blank flange맹판 blank plate폭풍 blast분사공기 blast air분사공기병 blast air bottle분사공기압력계 blast air gauge분사공기관 blast air pipe분사공기여과기 blast air strainer용광로 blast furnace송풍가열기 blast heater공기분사 blast injection송풍관 blast pipe폭풍막이 blast screen탈색타르도료 bleached tar추기 bleed추기증기관 bleed steam pipe추기구멍 bleeder블렌드연료유가열기 blend oil heater블렌드연료유탱크 blended fuel oil tank블렌드유 blended oil배합기 blender

Page 23: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

가림덮개 blind cover가림커튼 blind curtain맹 플랜지 blind flange막음판 blind patch맹판 blind plate맹목구간 blind sector블리스터 blister침탄강 blister steel도르래 block블록 blockblock assembly블록건조 block building방형계수 block coefficient블록분할 block division블록검사 block inspection블록조인트 block joint블록적하 block loading블록의장 block outfitting블록검사 block survey블록식건조법 block system블록용접과정 block welding sequence위벽효과 blockage위벽효과수정 blockage correction분괴압연기 blooming millblow down

동압과급방식blowerblowhole블로램프 blowlamp분출콕 blowoff cock분출밸브 blowoff valve분출 blowout분출콕 blowout cock분출방지기 blowout preventer분출밸브 blowout valve블로파이프토치 blowpipe torch청열취성 blue brittleness푸른불꽃신호 blue flare출범기 Blue Peter목재용적단위 board measure단정 boat단정장치도단정도르래 boat block단정 촉 boat chock단정컴퍼스 boat compass단정덮개 boat cover단정대빗 boat davit단정갑판 boat deck단정갑판등 boat deck light단정데릭 boat derrick단정훈련 boat drill단정갑판등 boat embarkation light단정비품 boat equipment단정 폴 boat fall단정고정띠 boat gripe단정올림내림장치 boat handling gear단정호이스트 boat hoist

블록대조립

배출blow down turbo charging system송풍기용접기공

boat arrangement 

Page 24: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

단정훅 boat hook단정등 boat lamp단정진수장치 boat launching arrangement단정등 boat light비행정 boat seaplane보트스케이트 boat skate보트스키드 boat skid단정스파 boat spar단정적재 boat stowage단정시험 boat test보트윈치 boat winch갑판장 boatswain갑판장창고 boatswain store걸이식의자 boatswain's chair연직추 bob weight봅스테이 bobstay물체고정축 body axes정면도 body plan보일러 boiler보일러받침 boiler bearer보일러수빼기관 boiler blow off pipe보일러케이싱 boiler casing보일러주위간격 boiler clearance보일러피복 boiler clothing보일러청정제 boiler compound

보일러청정제주입펌프보일러청정제탱크 boiler compound tank보일러청정제용기 boiler compound vessel보일러동체 boiler drum보일러효율 boiler efficiency보일러급수 boiler feed water보일러부품 boiler fittings보일러지지대 boiler foundation보일러연료유가열기 boiler fuel oil heater보일러연료유 침전탱크보일러흑연 boiler graphite보일러마력 boiler horsepower보일러점화유탱크 boiler ignition oil tank보일러스케일 boiler incrustation보일러피복 boiler lagging보일러공장 boiler maker's shop보일러부품 boiler mountings보일러유 boiler oil보일러발 boiler pedestal보일러판 boiler plate보일러압력 boiler pressure보일러실 boiler room보일러실케이싱 boiler room casing보일러실격자 boiler room grating보일러실개구 boiler room opening보일러 침전물 boiler scale보일러받침 boiler seating보일러동체 boiler shell보일러공장 boiler shop보일러소다끓임 boiler soda boiling보일러실 boiler space보일러버팀 boiler stay

boiler compound injection pump

boiler fuel oil settling tank

Page 25: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

보일러용강재 boiler steel보일러받침 boiler stool보일러지주 boiler support보일러검사 Boiler Survey (BS)보일러시험 boiler test보일러시험펌프 boiler test pump보일러시험 boiler trial보일러튜브 boiler tube보일러수 boiler water보일러수순환관보일러수순환펌프보일러 시험용수 채취장치보일러 시험용수 채취밸브보일러수시험기비등점 boiling point비등수형원자로 boiling water reactor증발가스 Boil-Off Gas (BOG)증발가스 가열기볼러드 bollard볼러드당김 bollard pull볼러드시험 bollard test볼스터 bolster나사깍기기계 bolt cutter볼트머리 bolt head볼트머리깍기 bolt head trimming볼트끝 bolt point볼트로프 bolt rope접속재 bond접착제 bond본전곡선 Bonjean's curve보닛 bonnet갑판출입구 booby hatch붐 boom스팬가이 boom head guy붐받침대 boom rest붐시트 boom sheet붐받침대 boom support붐 당김줄 boom vang범킨 boomkin부스터 booster부스터가열기 booster heater부스터펌프 booster pump부스터방식 booster system수선부 boot topping수선부도장 boot topping paint안지름 bore조개류 borer보링 boring보링머신 boring machine보스 boss보스외판 boss plate내외 지름비 boss ratio보스늑골 bossed frame보싱 bossing보싱각 bossing angle

boiler water circulating pipeboiler water circulating pumpboiler water sampling deviceboiler water sampling valveboiler water testing apparatus

boil-off gas warm-up heater

Page 26: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

both-sides welding선저블록 bottom block선저내장 bottom board선저시멘트 bottom cement밑뚜껑 bottom cover하사점 bottom dead center선저늑골 bottom frame선저거더 bottom girder보텀헤비 bottom heavy하부라이너연장부 bottom liner extension선저종늑골 bottom longitudinal선저부재 bottom member선저도료 bottom paint선저목판 bottom plank선저외판 bottom plate선저플러그 bottom plug선저긁힘손상 bottom raking damage채니기 bottom sampler선저피복 bottom sheathingbottom shell plating선저계측 bottom sighting선저검사 bottom survey선저트랜스버스 bottom transverse선저밸브 bottom valve선복량 bottoms경계조건 boundary condition경계요소법

경계적분법경계면 boundary interface경계층 boundary layer경계층 유입 boundary layer ingestion경계층두께 boundary layer thickness외판선 boundary line

날개끝판 boundary plate

부르동관압력계선수 bow선수미구조 bow and stern construction선수부 bow area선수촉 bow chock선수바람막이천막 bow chock screenbow construction선수구조도 bow construction profile선수갑판 bow deck선수문 bow door선수를 아래로 bow down선수플레어 bow flare선수플레어슬래밍 bow flare slamming바우라인 bow line선수프로펠러 bow propeller바우롤러 bow roller선수타 bow rudder선수측면파 bow sea선수시브 bow sheave바우스윙태클 bow swing tackle선수스러스터 bow thruster바이저형 선수문 bow visor

양면용접

선저외판

boundary element method(BEM)boundary integral method (BIM)

Bourdon tube pressure gauge

선수구조

Page 27: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

구상선수주의등 bow warning light선수파 bow wave선수 앵커 bower anchor바우라인매듭 bowline knot바우스프릿 bowsprit상자형 보 box beam박스형 커플링 box coupling상자형 거더 box girder박스스패너 box spanner브레이스 brace브래킷 bracket브래킷붙임 bracket attachment브래킷고착 bracket connectionbracket floor브래킷늑골 bracket frame벽붙이등 bracket light브래킷방식 bracket system브래킷토 bracket toe브래킷단부연결 bracketed end connection무브래킷방식 bracketless-system땋은로프 braided rope땋은와이어 braided wire브레일 brail제동기 brake제동띠 brake band제동반 brake disc제동드럼 brake drumBrake Horse Power (BHP)브레이크라이닝 brake lining제동출력 brake output제동동력 brake power브레이크슈 brake shoe브레이크인방식 brake-in system보조앵커 branch anchor빌지지관 branch bilge pipe분기함 branch box보조체인 branch chain cable최종지회로 branch circuit분지관덕트 branch duct분지관 branch pipebrass황동주물 brass casting브레이톤사이클 Brayton cycle경납땜 brazing경납땜소켓 brazing socket경납땜유니언 brazing union폭 breadth폭깊이비 breadth depth ratio최대폭 breadth extreme박리성진동 break away flutter선루단격벽 break bulkhead파손 breakage파손 breakdown 물통 breaker적응기간 break-in period쇄파기준 breaking criterion브레이킹조인트 breaking joint파괴하중 breaking load

조립늑판

제동마력

황동

Page 28: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

파괴강도 breaking strength파괴시험 breaking test쇄파 breaking wave쇄파기 breakwater방파제 breakwater선저굽기 breaming브레스트훅 breast hook브레스트라인 breast line브리더밸브 breather valve호흡구 breathing apparatus호흡구 breathing device호흡가스장치 breathing gas system쌍가닥파이프 breeches pipe증식 breeding코르크벽돌 brick cork벽돌쌓기 brickwork선교 bridge선교후단격벽 bridge after bulkhead선교제어 bridge control선교루갑판 bridge deck선교설계 bridge design브리지게이지 bridge gauge선교갑판실 bridge house선교 원격조정 bridge maneuvering아치선미재 bridge piece브리지스폿용접 bridge spot welding

선교대선교통신 브리그 brig브리건틴 brigantine고휘도표시 bright display휘도조정 brightness control휘도조정 brilliance control브라인 brine브라인혼합기 brine agitator브라인냉각기 brine cooler브라인관 brine pipe브라인펌프 brine pump브라인식 brine system브라인탱크 brine tank브리넬경도 Brinell hardness연탄 briquette영국표준공업규격 British Standards영국식 열단위

brittle fracture브로칭 broaching넓은 바람각 broad reach넓은 이음매 broad seam현측 broadside현측어뢰발사관 broadside torpedo tube화물틈새 broken space화물틈새 broken stowage청동주물 bronze casting갈탄 brown coalbrush coating브러시홀더 brush holder버블캐비테이션 bubble cavitation기포군 bubble plume

bridge to bridge communication

British Thermal Unit(BTU)취성파괴

붓도장

Page 29: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

bubbling거품점 bubbling point버킷 bucket버킷식준설선 bucket dredger버킷엘리베이터 bucket elevator버킷가이드롤러 bucket guide roller버킷래더 bucket ladder버킷링크 bucket link버킷핀 bucket pin버킷펌프 bucket pump버킷휠식리클레이머호저파이프뚜껑 buckler좌굴 buckling좌굴계수 buckling factor좌굴하중 buckling load좌굴강도 buckling strength

완충기 buffer완충스프링 buffer spring버핑머신 buffing machinebuild strategy

조선소공급품건조자 증명서 builder's certificate건조자안벽시운전건조자해상시운전 Builder's Sea Trial (BST)건조자시운전 Builder's Trial (BT)선대건조독 building dock선대 building slip건조시방서 building specification조립도르래 built block

수중검사를 위한 마킹조립보 built-up beam조립크랭크축 built-up crankshaft조립늑골 built-up frame조립프로펠러 built-up propeller조립단면재 built-up section조립형 built-up type

built-up welding적층용접순서 built-up welding sequence벌브 bulb구평강 bulb angle벌브 용골 bulb keel구평강 bulb plate구평강 bulb sectionbulb tee구상선수 bulbous bow구상선수주의등 bulbous bow warning light벌지 bulge

구상선수 종단면적계수

기포발생

bucket wheel type reclaimer

작업완료분 예산시수 Budgeted Hours of Work Performed (BHWP)

작업미완료분 예산시수 Budgeted Hours of Work Scheduled (BHWS)

건조전략Builder Furnished Equipment (BFE)

Builder's Harbor Trial (BHT)

building berth  

Built for In-water Survey (BIS) mark

육성용접

벌브형 티(T)형강

bulge area coefficient for bulbous bow

Page 30: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

벌지외판 bulging shell

산적화물 bulk cargo산적화물선 bulk carrier체적탄성계수 bulk modulus격벽 bulkhead격벽블록 bulkhead block격벽갑판 bulkhead deck격벽늑판 bulkhead floor plate벽붙이등 bulkhead light격벽라이너 bulkhead liner격벽관통 피스 bulkhead piece격벽구조도 bulkhead plan격벽골 bulkhead recess격벽보강재 bulkhead stiffener격벽스툴 bulkhead stool격벽스톱밸브 bulkhead stop valve격벽패킹상자 bulkhead stuffing box격벽밸브 bulkhead valve패킹누름링 bull ring방탄판 bullet proof plate눈알유리 bull's eye꼬마전등 bull's eye lamp불워크 bulwark불워크배수구 bulwark freeing port불워크사다리 bulwark ladder불워크선 bulwark line불워크망 bulwark netting불워크판 bulwark plating불워크기둥 bulwark stanchion불워크지주 bulwark stay불워크스트레이크 bulwark strake접시형끝판 bumped head범킨 bumpkin연료고 bunker연료고격벽 bunker bulkhead연료고용량 bunker capacity연료탄 bunker coal연료유 bunker oil연료유가격 bunker price연료유적재 bunkering연료공급지 bunkering station번트라인 bunt line부이 buoy부표 buoy부표대빗 buoy davit부표훅 buoy hook부표계류 buoy mooring부표줄 buoy rope부표섀클 buoy shackle부표스키드 buoy skid부표설치선 buoy tender부력 buoyancy부력실 buoyancy chamber부력곡선 buoyancy curve부력플럭스 buoyancy flux부력탱크 buoyancy tank

Page 31: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

구명부기 buoyant apparatus부력재료 buoyant material발연부신호 buoyant smoke signal재화능력 burden침로유지선 burdened vesselBureau Veritas (BV)쌍꼬리깃발 burgee핵연료소모율 burn up소손 burned damage버너 burner버너마스터밸브 burner master valve버너팁 burner tip버너용청소대 burner work bench버너용청소대 burner working table연소로 burning furnace파열 bursting파열압 bursting pressure재화능력 burthen맞당김식하역법 burtoning method버스덕트 bus duct부시 bush버트 butt맞대기단접 butt forge weld맞대기이음 butt joint맞대기저항용접 butt resistance weld맞대기심용접 butt seam welding맞대기덧판 butt strap맞대기덧판이음 butt strap joint맞대기용접 butt weld나비형너트 butterfly nut나비형밸브 butterfly valve버터링 buttering버터워스가열기 butterworth heater버터워스 개구 butterworth opening버터워스펌프 butterworth pump수직종단면선 buttock line수직종단면 buttock plane버저 buzzer맞바람돛달기로 by the wind바이패스 bypass바이패스필터 bypass filter바이패스라인 bypass line바이패스관 bypass pipe바이패스청정 bypass purifying바이패스밸브 bypass valve바이패스 bypathby-product바이트 byte선실 cabin선실컴퍼스 cabin compass선실문 cabin door선실여객 cabin passenger선실배치도 cabin plan선실용품창고 cabin store선실용품 cabin stores케이블 cable전선밴드 cable band전선다발 cable bundle

프랑스선급

부산물

Page 32: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

케이블매설기 cable burying equipment케이블클렌치 cable clench케이블클립 cable clip케이블드럼 cable drum케이블덕트 cable duct장력계 cable dynamometer케이블도입구 cable entrance전선관통붙이 cable gland케이블그라이퍼 cable gripper전선지지붙이 cable hanger케이블인양장치 cable hauling gear케이블홀더 cable holder케이블부설선 cable layer케이블부설부선 cable laying barge케이블부설선 cable laying ship케이블길이측정장치체인홈바퀴 cable lifter케이블관통부 cable penetration

케이블부설기케이블선행절단 cable precutting케이블리세스 cable recess전로 cable run전선고정붙이 cable saddle케이블소켓 cable socket케이블멈추개 cable stopper케이블탱크 cable tank전선결속띠 cable tie케이블홈통 cable trough전로배치함 cable trunk전로 cable way케이블윈치 cable winch캡타이어 케이블 cabtyre cable실습생 cadet케이지마스트 cage mast케이슨 caisson

케이슨제작용작업부선점결탄칼슘브라인규산칼슘보온재검교정용레버검교정 calibration캘리퍼스코킹 calking코킹끌코킹홈코킹해머코킹끌코킹맬릿코킹피스코킹편코킹공구호출부호칼로리열용량발열량

cable length measuring device

cable picking and laying machine 

caisson fabricating barge       caking coal    calcium brine  calcium silicate heat insulating material calibrating lever 

calipers 

calking chisel  calking groove calking hammer calking iron    calking mallet  calking piece   calking strip   calking tool    call sign       calorie calorific capacity       calorific value  

Page 33: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

열발생온수기 calorifier열량계캠 cam캠간격캠선도캠레버캠롤러캠버 camber캠버곡선수중날개캠버캠버비위장 camouflage캠축 camshaft

캠축윤활유냉각기캠축윤활유펌프캠축윤활유탱크원통형부표원통형거르개원통형거르개원통연소실운하부선

양쪽열림독건조법운하용타운하통행료운하톤수통조림공장선통조림공장카누양면팽창식구명뗏목캐노피 canopy캐노피등 canopy light캔트보선미캔트부캔트늑골외팔보 cantilever외팔늑골선캔버스 canvas캔버스보트캔버스덮개 canvas cover캔버스호스캔버스공사캡너트정전용량액면계축전기 capacitor

capacity control용적도

calorification   

calorimeter     

cam clearance cam diagram   cam lever      cam roller     

camber line    camber of a hydrofoil  camber ratio   

camshaft lubricating oil cooler camshaft lubricating oil pump  camshaft lubricating oil tank   can buoy       can filter       can strainer    can type chamber      

canal barge    

canal dock building system     

canal rudder   

canal toll      canal tonnage  canning factory ship   canning plant  canoe  canopied reversible inflatable liferaft

cant beam     cant body      cant frame     

cantilever framed ship 

canvas boat    

canvas hose   canvas work   cap nut capacitance type level gauge   

용량제어capacity plan      

Page 34: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

케이프급 Cape size케이프급 산적화물선 Cape size bulk carrier모세관현상 capillarity모세관주력함전복 capsizing 캡스턴 capstan캡스턴 막대캡스턴 원통선장갑판선장창고선장선장실선장실켑타이어케이블 captyre cable

자동차운반선자동차갑판자동차도선자동차운반부선자동차겸 산적 화물선침수식아세틸렌가스발생기탄소아크 carbon arc탄소아크절단탄소아크가우징 carbon arc gouging탄소아크용접탄소브러시탄산가스용기탄산가스용기탄산가스소화기탄산가스소화장치탄산가스기록계탄산가스흡수장치탄소봉전극탄소봉집게일산화탄소 carbon monoxide탄소패킹탄소패킹글랜드탄소봉압력배관용탄소강관고압배관용 탄소강관고온배관용탄소강관배관용 탄소강관탄소강탄소섬유강화플라스틱탄화탄소첨가탄화염방위기점

capillary tube  capital ship    

capstan bar    capstan barrel captain deck   captain room store     captain captain's cabin captain's room 

car carrier     car deck       car ferry       car float       car/bulk carrier       carbide to water gas generator 

carbon arc cutting     

carbon arc welding     carbon brush   carbon dioxide bottle   carbon dioxide cylinder carbon dioxide fire extinguisher carbon dioxide fire extinguishing system       carbon dioxide recorder carbon dioxide scrubber carbon electrode       carbon holder  

carbon packing carbon ring gland  carbon rod     Carbon Steel Pipe for Pressure Service (SPPS)Carbon Steel Pipes for High Pressure Service (SPPH)Carbon Steel Pipes for High Temperature Service (SPHT)Carbon Steel Pipes for Orinary Piping (SPP)carbon steel   Carbon-glass Reinforced Plastic (CRP)carbonization   carburization   carburizing flame       cardinal points 

Page 35: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선창내장재하역용도르래재화용적톤수 cargo capacity tonnage하역제어실하역체인하역등화물격납장치 cargo containment system하역제어반하역제어반하역제어실하역줄하역장치 cargo gear하역장치검사 cargo gear survey하역장치하역기계 cargo handling machine하역설비 cargo handling system화물창구화물창 cargo hold화물창용적하역고리 cargo hook적하보험 cargo insurance하역등화물리프트하역등화물적재문 cargo loading door카고매니폴드하역망화물유 cargo oil

화물유집합펌프화물유가열관화물유관 cargo oil pipe 화물유관장치화물유펌프 cargo oil pump화물유펌프복수기 cargo oil pump condenser

화물유펌프자동흡기장치화물유펌프용 터빈 cargo oil pump turbine

화물유펌프터빈복수기화물유탱크적하배치도재화문 cargo port현측화물적재문화물창냉동기냉각수펌프하역줄화물고박지침서

cargo segregation하역섀클화물선 cargo ship

화물선안전구조증서화물선안전설비증서

cargo batten   cargo block    

cargo center   cargo chain    cargo cluster   

cargo control console  cargo control panel    cargo control room    cargo fall      

cargo handling gear    

cargo hatchway 

cargo hold capacity    

cargo lamp     cargo lift       cargo light     

cargo manifold cargo net      

cargo oil collecting pump      cargo oil heating pipe  

cargo oil piping system 

cargo oil pump self-priming system

cargo oil pump turbine condensercargo oil tank  cargo plan     

cargo port door cargo refrigerator cooling water pumpcargo runner   Cargo Securing Manual (CSM)화물격리cargo shackle  

cargo ship Safety Construction (SC) certificate       cargo ship Safety Equipment (SE) certificate 

Page 36: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

화물선안전무선전신증서화물하역고리 cargo sling화물구역하역윈치하역와이어로프하역와이어로프칼링카르노사이클목공 carpenter목공공사도래송곳목공창고 carpenter's store목공용품

Carpenter's workshop목공장 carpentry shop통로용양탄자해치빔받침 carrier배출손실직교좌표계익렬 cascade익렬영향다단탱크익렬풍동익렬전향각다단용접법case hardening케이싱 casing케이싱파이프사용후 핵연료수송용기주철주강주강품 castings캐슬너트해난 casualty앵커대빗캣폴촉매화학반응쌍동선 catamaran쌍동딩기 catamaran dinghy

쌍동형 준설선쌍동요트 catamaran yacht캐터펄트어로선음극선관음극선관방위측정기음극방식시스템 cathodic protection system가축운반선 cattle carrier가축우리상설보행로 catwalk코커 caulker코킹 caulking코킹 정 caulking chisel알칼리취성주의판

cargo ship Safety Radiotelegraphy (SR) certificate   

cargo space    cargo winch    cargo wire rope cargo wire runner      carling Carnot's cycle 

carpenter work carpenter's ring auger 

carpenter's stores    목공소carpet runner  

carry over loss Cartesian co-ordinate system

cascade effect cascade tank   cascade tunnel cascade turning angle  cascade welding sequence     표면경화casing pipe    cask      cast iron       cast steel      

castle nut      

cat davit       cat fall catalytic chemical reaction

catamaran type dredging vessel

catapult catcher boat   Cathode Ray Tube (CRT)  cathode-ray direction finder    

cattle stall     

caustic brittleness      caution plate   

Page 37: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

캐비테이션 cavitation공동현상 cavitation캐비테이션제어케비테이션부식 cavitation corrosion캐비테이션손상캐비테이션흐름캐비테이션이력현상캐비테이션초생캐비테이션수캐비테이션탱크캐비테이션반류공동 cavity캐비티 cavity캐비티길이캐비티압력캐비티두께내장판자 ceiling board내장선창천장등천장돌림테천장패널 ceiling panel셀가이드 cell guide셀중심법 cell-centered scheme셀구조 cellular constructioncellular double bottom시멘트운반선시멘팅펌프시멘트사일로시멘트칠침탄 cementation침탄법침탄강시멘팅유닛시멘타이트중심선내저판센터보드선저중심거더 center bottom girder중심선칸막이중간플랜지 center flange중심주파수중앙로센터게이지중심선거더중심선 내용골 center keelson중심선 center line중심선격벽

중심선종통판부심곡률중심풍압중심무게중심충격중심투영측면적중심횡저항중심동요중심충격중심

cavitation control      

cavitation damage      cavitation flow cavitation hysteresis   cavitation inception     cavitation number      cavitation tank cavitation wakes       

cavity length cavity pressure cavity thickness 

ceiling hold    ceiling light    ceiling molding 

구획식이중저cement carrier cement pump  cement silo    cement wash   

cementation process   cemented steel cementing unit cementite      center (line) strake  center board   

center division 

center frequency       center furnace center gauge   center girder   

center line bulkhead   center line through plate       center of buoyancy    center of curvature    center of effort center of gravity       center of impact       center of lateral area  center of lateral resistance     center of oscillation    center of percussion   

Page 38: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

압력중심대칭중심 center of symmetry중심면중심펀치중심찾기자중앙탱크 center tank중심내기 centering센터펀치중심선격벽 centerline bulkhead센티포이즈 centipoise센티스톡스 Centistocks중앙제어장소 central control station중앙제어장치 central control unit

중앙집중식청수냉각시스템집중난방중심선종단면중앙식잠금장치 central locking device집중주유중앙작동제어반 central operating console중앙동력실중앙처리장치원심주조원심압축기원심송풍기원심력원심조속기원심주유기원심청정기원심펌프원심분리기원심스핀들토크 centrifugal spindle torque

원심스핀들토크계수원심응력도심 centroid 세라믹 백킹 ceramic backing도자기타일특정부하 certain load증서 certificate

냉장설비증서선급증서

certificate of inspection만재흘수선증서선박국적증서여객 정원세탄가마모방지매트마모방지덧판마모방지띠체인 chain체인용 봉강체인블록

center of pressure     

center plane   center punch   center square  

centering punch 

central fresh water cooling systemcentral heating central lateral plane    

central lubrication      

central power station  Central Processing Unit (CPU)centrifugal casting     centrifugal compressor centrifugal fan centrifugal force       centrifugal governor    centrifugal lubricator   centrifugal oil purifier  centrifugal pump       centrifugal separator   

centrifugal spindle torque coefficientcentrifugal stress      

ceramic tile    

certificate for refrigerating installationcertificate of classification

선박검사증서certificate of load line certificate of ship's nationality certified number of passengerscetane number chafing mat    chafing plate   chafing strip   

chain bar steel      chain block    

Page 39: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

체인케이블체인콤프레서체인콤프레서체인구동체인홈바퀴체인구동장치체인호이스트체인훅병렬단속필릿용접쇄선체인로커체인파이프 chain pipe체인파이프뚜껑체인플레이트체인섀클체인용 강체인스토퍼체인시험기체인조임 휠 chain tightener wheel체인휠

chainlet분필시험체임버 chamber모따기끝모따기 chamfering모따기기계모따기공구 chamfering tool주문주사양변경요청 change order (C/O)전환피스전환스위치 change-over switch전환밸브수로 channel해협 channel해협연락선채널유동 channel flow해협연락선선급부호특성곡선목탄철목탄선철충전장치충방전용배전반샤르피충격시험 Charpy test해도 chart해도서랍해도실해도대 chart table해도대등용선 charter용선료용선계약용선료체이서채터링 chattering멈춤볼트체크헬름

chain cable    chain compressor      chain controller chain drive     chain drum  chain gearing  chain hoist     chain hook     chain intermittent fillet weld chain line      chain locker   

chain pipe cover       chain plate     chain shackle  chain steel     chain stopper  chain tester    

chain wheel    쇠사슬chalk test      

chamfered edge 

chamfering machine    

change over piece     

change-over valve 

channel boat   

channel steamer       character of classificationcharacteristic curve    charcoal iron   charcoal pig iron charging equipment    charging switchboard   

chart rack     chart room     

chart table light 

charter base   charter party   charterage     chaser 

check bolt     check helm    

Page 40: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

멈춤너트멈춤핀제한링체크밸브바둑무늬판검토기준 checking criteria점검항목 checkpoint 점검항목검토회의 checkpoint review meeting화학분석화학세정 chemical cleaning화학성분 chemical composition

청정제주입밸브화학탈수기화학소화기화학적산소요구량분말소화장치화학제품운반선 chemical tanker화학측심관화학적발광

cherry picker기관장 chief engineer어로장통신장주방장냉각주형냉장실뒷댐편냉각주물냉장실냉장실냉수기 chilling water plant

중국선급차인 chine

차인선칩 운반선 chip carrier치핑 chipping평면끌녹털이망치중추가이드중추탑촉 chock촉라이너촉패스트 chockfast

질식캐비테이션수촉라인질식흐름초킹 choking초킹코일현 chord

check nut      

check pin      check ring     check valve    checkered plate 

chemical analysis      

chemical compound injection valvechemical dehydrator    chemical fire extinguisher      Chemical Oxygen Demand (COD)chemical powder fire extinguishing apparatus   

chemical tube  chemo-luminescence    고소차chief fisherman 

1등 항해사 chief officer    chief radio officer      chief steward  chill mold      chill room      chill strip      chilled casting chilling chamber       chilling room   

China Classification Society (CCS)

chine line      

chipping chisel chipping hammer       chisel barrel   chisel suspension tower 

chock liner 

chocking cavitation number     choke line     choked flow    

choking coil    

Page 41: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

현길이 chord length코드선christening ceremony크리스마스트리 Christmas tree크리스마스트리포스트 Christmas tree post크리스마스트리윈치 Christmas tree winch

크리스마스트리와이어로프크롬피복크롬강크로노그래프크로노미터 chronometer척슈트쓰레기구멍회로차단기감속장치의경사각원호형뒷면원형실린더 circular cylinder원진동수호도법전선의 단면적단위 circular mils

고유원진동수원주피치원형톱원호꼴단면원형당김줄 circular vang순환윤활순환펌프순환수 circulating water

회류수조순환수관 circulating water pipe

순환수여과기circulation순환회로원주이음 circumferential joint원주피치원주이음매시스턴중앙부대갑판실클랙밸브clad steel클래드강관 clad steel pipe클램프 clamp클램프 판 clamp plate조임장치 clamping device

클램셸형그래브버킷클래리파이어클라크사이클클라크엔진클라시우스사이클

Class 1 pipe

chord line      명명식

Christmas tree wire rope   chrome plating chrome steel   chronograph   

chuck  chute  chute  circuit breaker circular angle of obliquity      circular back   

circular frequency      circular measure       

circular natural frequency      circular pitch   circular saw   circular section 

circulating lubrication  circulating pump       

Circulating Water Channel (CWC)

circulating water strainer       순환 circulator      

circumferential pitch   circumferential seam   cistern citadel deck house     clack valve    클래드 강

clamshell type grab bucket     clarifier Clark cycle    Clark engine   Clasius cycle   

1급관

Page 42: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Class A firesclass comment item선급규격재 class material선급부기부호 class notation 선급정기검사 class renewal survey선급증서선급부기부호선급부기부호선급규칙 classification rule선급협회

제조후등록검사제조중등록검사선급검사클로 claw물음클러치물음커플링못뽑이해머도자기타일클리딩클린밸러스트 clean ballast클린밸러스트펌프냉로청소선 cleaning ship클리어호저슬립클리어하이트 clear height가시 구간 clear sector선회스크린선회창 clear view window틈새 clearance틈새조정기틈새각헐거운맞춤절연간격틈새용적클리트클렌치볼트클루 clew 클루클링글클루가넷클루라인선주요구사항 client request item클렌치볼트클링커클리노미터클립연결 clip connection클립훅클리퍼 clipper클리퍼형 선수

close hauled좁은 바람각 close reach밀폐식재받이틈없는내장닫힌촉폐쇄회로 closed circuit

폐쇄회로 텔레비전

A급 화재선급지적사항

classification certificate classification character classification notation  

classification society   classification survey after constructionclassification survey during constructionclassification survey    

claw clutch    claw coupling  claw hammer   clay tile cleading 

clean ballast pump     clean reactor   

clear hawser slip       

clear view screen      

clearance adjuster      clearance angle clearance fit   clearance for insulation clearance volume      cleat   clenched bolt  

clew cringle    clew garnet    clew line       

clinched bolt   clinker clinometer     

clip hook      

clipper stem   상행 (역풍범주)

closed ash pit   closed ceiling  closed chock   

Closed Circuit Television (CCTV)

Page 43: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

밀폐사이클밀폐배기 closed exhaust밀폐배기밸브폐쇄형페어리더밀폐급수장치밀폐식보일러실밀폐형계측장치폐쇄연결밀폐식보일러실폐쇄선루밀폐식연료밸브밀폐형추력베어링맞바람돛달기로근접방어체계중실원형기둥최단접근점정밀검사 close-up inspection정밀검사 close-up survey폐쇄장치폐쇄장치 closing arrangement폐쇄장치 closing device막음판 closing plate폐쇄시간 closure time클로브매듭클러치이음 clutch coupling클러치클러치작동시험클러터탄산가스실린더탄산가스실린더탄산가스미터탄산가스기록계석탄파쇄기석탄고석탄보일러석탄운반선석탄슈트석탄소비량석탄파쇄기석탄보일러석탄해머재탄구양탄기석탄호퍼석탄계량기석탄적재문석탄적재구멍석탄슈트콜타르석탄윈치재탄문 coaling port코밍 coaming코밍판코밍스테이 coaming stay코밍보강재

closed cycle   

closed exhaust valve   closed fair-leader      closed feed system    closed fire room       closed gauging closed joint    closed stokehold       closed superstructure  closed type fuel valve closed type thrust bearing     close-hauled   Close-In Weapon System (CIWS)closely spaced pillar   closest point of approach(CPA)

closing appliance       

clove hitch     

clutch  clutching test  clutter CO2 bottle     CO2 cylinder   CO2 meter     CO2 recorder   coal beater    coal bunker    coal burning boiler     coal carrier    coal chute     coal consumption       coal crusher   coal firing boiler       coal hammer   coal hatchway  coal hoist      coal hopper    coal measure  coal port       coal scuttle    coal shoot     coal tar coal winch     

coaming plate  

coaming stiffener      

Page 44: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

성긴요소분할 coarse mesh성긴그물망 coarse mesh보통나사연안방위함연안경비대연안무선국해안국 coast station연해구역 coastal area연안유출수 coastal discharges연안경비정연안항법연안항로선연해구역연해구역항행연해항해선피복아크용접봉피복 직물 coated fabric도장 coating피복제 coating도장성능기준코팅스테이션동축케이블동축운전콕위치다각형코킹다운코킹업선미좌석코코아매트부호호출법신호기신호부호미국연방규격선각부재기호부여체계압축성계수팽창계수비척계수마찰계수 coefficient of friction

열대류계수열전달계수동점성계수투영측면적계수열통과율동작계수피토계수변동계수점성계수보자력 coercivity

coarse pitch thread    coast defense ship     coast guard    coast radio station     

coastal motorboat      coastal navigation      coaster coasting area  coasting service        coasting vessel coated electrode       

coating performance standardcoating station co-axial cable co-axial drive  cock   cocked hat     cocking down  cocking-up     cockpit cocoa mat     code calling system    code flag      code letters    Code of Federal Regulations (CFR)coding system of hull structure piececoefficient of compressibility   coefficient of expansion coefficient of fineness  

coefficient of heat convection  coefficient of heat transfer     coefficient of kinematic viscosity       coefficient of lateral area      coefficient of overall heat transmission coefficient of performance     coefficient of pitot tube Coefficient Of Variation (COV)coefficient of viscosity 

Page 45: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

코퍼댐코그휠응집코일 coil코일보일러코일스프링코일냉각기일치주파수 coincidence frequency동일루프배열야자매트야자밧줄야자깔개코크스선철코크스용석탄냉풍식냉간굽힘 cold bending냉간굽힘시험저온상태 cold condition 저온균열 cold crack상간인발관상온기름거르개냉간가공 cold forming

도금손상부 아연도포 cold galvanizing

냉로냉간압연 cold rolling저온시동시험 cold running test냉간취성시동용급수펌프

시동용분연펌프시동용연료유가열기상온시동시험 cold starting test 냉장 cold storage냉장선냉장고냉간가공붕괴 collapse붕괴압력접는보트칼라 collar칼라베어링칼라판칼라스러스트베어링집합호퍼집합관집전고리석탄운반선 collier

collision충돌방지 collision avoidance

레이더충돌예방장치

cofferdam      cogwheel      cohesion       

coil boiler      coil spring     coiled pipe cooler      

coincident loop configuration coir mat       coir rope      coir runner    coke pig iron  coking coal    cold air blast system   

cold bending test      

cold drawn pipe cold filter      

cold reactor    

cold shortness 

cold start feed water pump 

cold start fuel oil burning pump 

cold start fuel oil heater       

cold storage boat      cold store      cold working   

collapse pressure      collapsible boat 

collar bearing  collar plate    collar thrust bearing   collecting hopper       collecting pipe collector ring  

충돌collision avoidance radar system      

Page 46: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선수격벽방수매트콜로이드연료color scheme

지주 column

지주안정형 시추선전투정보실겸용선 combination carrier혼합기관혼합식추진방식복합식터빈합성날개화합탄소

종합효율조합등가응력 combined equivalent stress복합급수가열기혼합늑골식구조

복합충동터빈조합응력혼합늑골식구조복합식터빈가연성가스연소손실가연성재료연소 combustion

연소실 combustion chamber

압력연소실천장판연소노킹연소압력연소율탄산가스기록계연소행정연소기함장실 commanding officer room

commissary equipment시운전 commissioning engineering

공전식전화기 common battery telephone

collision bulkhead      collision mat   colloidal fuel   

배색column stabilized drilling unit  Combat Information Center (CIC)

combination machinery combination propulsion system combination turbine    combined blade combined carbon       

복합추진체계-CODAD Combined Diesel And Diesel (CODAD)

복합추진체계-CODOG Combined Diesel Or Gas turbine (CODOG)combined efficiency    

combined feed water heater combined framing system      복합추진체계-COGAG Combined Gas turbine And Gas turbine (COGAG)

복합추진체계-COGOG Combined Gas turbine Or Gas turbine (COGOG)combined impulse turbine      combined stress combined system       combined turbine       combustible gas combustible loss combustible material   

combustion chamber crown plate     combustion knock      combustion pressure   combustion rate combustion recorder   combustion stroke      combustor     

조리설비

Page 47: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

보통링크 공통구조규칙방송 공시청장치 communal aerial system

수신공중선공용장치통신 communication 통신관유럽조선공업협회정류극정류정류자 commutator정류자전동기 commutator motor

companion

승강구사다리승강구실전사적프로그램 company-wide program콤퍼레이터구획 compartment구획화 compartmentation컴퍼스 compass자차수정나침반 방위 장치 compass bearing device나침반볼나침반선교나침반카드나침반자차보정나침반침로나침반갑판나침반자차 나침반오차나침반스크린적합조건 compatibility condition

표준화물선환산톤수보정형전리상자

compensating device

자기나침반보정장치compensation for opening보강링보정탱크보상기 compensator승무원 정원 complement완전연소전사이클완전소모 complete depletion

완전용입이음전통선루선완성검사부품 component소조립 공장

common link   Common Structural Rules (CSR)

communal aerial system for receiver  

communication tube    Community of European Shipyards' Associations (CESA)commutating pole      commutation   

승강구실companion ladder      

companionway 

comparator     

compass adjustment    

compass bowl  compass bridge compass card  compass compensation compass course compass deck  compass deviation      compass error compass screen 

Compensated Gross Tonnage (CGT)compensating chamber 보정장치compensating device of magnetic compass     개구부보강compensation ring      compensation tank     

complete combustion   complete cycle 

Complete Joint Penetration (CJP)complete superstructure vessel   complete survey       

Component Assembly Shop (CAS)

Page 48: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

합성보콤퍼짓보일러복합형플랜지중첩격자계 composite grid system혼용이음복합소재 composite material연성항법 composite sailing목철선복장갑복권직류발전기복권발전기연성충격터빈복권전동기복합압력계 compound pressure gauge

연성반동터빈복합터빈압축공기 compressed air압축공기관압축코르크압축하중가압천연가스운반선압축행정압축성압축봉압축실린더압축효율압축착화기관압축재압축비압축냉동기압축온도 compression temperature압축시험압축변형률압축강도압축응력압축기

compulsory item의무선박국청취의무계산유체역학컴퓨터이용설계시스템컴퓨터이용생산시스템컴퓨터이용공정계획컴퓨터이용생산관리시스템

composite beam composite boiler       composite flange       

composite joint 

composite vessel       compound armor       compound dynamo     

2단팽창기관 compound engine      compound generator   compound impulse turbine      compound motor       

compound reaction turbine     compound turbine      

compressed air pipe   compressed cork       compressed load       Compressed Natural Gas (CNG) Carriercompressed stroke     compressibility compression bar       compression cylinder   compression efficiency compression ignition engine    compression member   compression ratio      compression refrigeration machine

compression test       compressive strain     compressive strength  compressive stress     compressor    필수항목compulsory ship station compulsory watch      Computational Fluid Dynamics (CFD)Computer Aided Design system(CAD)Computer Aided Manufacturing(CAM)Computer Aided Process Planning(CAPP) computer aided production management system(CAPM)

Page 49: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

컴퓨터통합제조시스템컴퓨터시뮬레이션컴퓨터수치제어컴퓨팅로거오목필릿용접집중하중동심리듀서 concentric reducer동심성

concept design개념설계승인 concept design approval콘크리트선동시공학보열동시조달부품복수펌프 condensate pump복수관복수복수기 condenser복수기도출밸브복수기관 condenser tube복수관페룰복수기진공 condenser vacuum복수관복수장치상태평가계획상태곡선전도도전부도전성 conductivity전도율도체도관원추클러치콘 커플링 cone coupling 콘게이지원추풀리좁은 구역 confined area등각사상 conformal mapping 거친바다혼잡 구역 congested area원추형부이원추형밸브공액경사도방법 conjugate gradient method접속벤드연락교연접봉 connecting rod연결섀클

connection diagram조종위치 conning position조종위치 conning stationconsequential damage하송인혼재수송 consolidated service

computer integrated manufacturing system(CIMS) computer simulation    Computerized Numerical Control (CNC)computing logger       concave fillet weld     concentrated load      

concentricity   개념설계concrete ship  Concurrent Engineering(CE) concurrent heating     Concurrent Spare Part (CSP)

condensate water pipe  condensation   

condenser relief valve 

condenser tube ferrule 

condenser water pipe  condensing plant       Condition Assessment Scheme (CAS)condition curve conduction     conductive part 

conductivity    conductor      conduit(tube) cone clutch    

cone gauge    cone pulley    

confused sea   

conical buoy   conical valve   

connecting bend connecting bridge      

connecting shackle     접속도

간접손해consigner      

Page 50: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

분담이행 협약 consortium agreement

정전력용접기일정피치 constant pitch일정피치프로펠러등반동날개연속운전급수방식정치제어정온사이클자동장력계선윈치 constant tension winch

정전압용접기정적사이클콘스탄탄와이어구성방정식 constitutive equation

constitutive equationconstruction period강재배치도 construction profile

강재배치도진찰실 consultation room소모품창고

consumables소비량contact conditioncontact damage접촉집개접촉장치접점정압사이클contact ratio접촉응력 contact stress접촉기

컨테이너고박장치컨테이너냉동기냉각청수펌프컨테이너냉동기냉각해수펌프컨테이너선격납용기격납용기 containment vessel 우발계획 contingency plan

연속필릿용접연속플랜지 continuous flange

연속단조흐름선체계속검사일체라이너기관계속검사연속부재연속청정연속정격부하

constant energy welding machine

constant pitch propeller constant reaction blade constant running water service systemconstant set point control      constant temperature cycle     

constant voltage welding machineconstant volume cycle constantan wire 

응력-변형률 관계식 건조기간construction profile and deck plan

consumable stores     소모품consumption   접촉상태접촉손상contact jaw    contact maker  contact point   contact pressure cycle 접촉률contactor      container lashing equipment    container refrigerator cooling fresh water pump container refrigerator cooling sea water pump    container ship  containment shell    

Continuous Fillet Weld (C.F.W.)

Continuous Grain F+A2676low (CGF)Continuous Hull Survey (CHS)continuous liner Continuous Machinery Survey (CMS)continuous member    continuous purifying    continuous rating       

Page 51: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

continuous survey

선박이력기록부 지속전파연속용접연속선원구역등고선윤곽역류콘트라타비대칭선미

contract design

해상운송계약contract review계약사양변경 contract work change축척현도수축 contractioncontraction coefficient수축부 contraction nozzle단면수축

단면수축률contraction scale

상반회전프로펠러제어 control제어용공기압축기제어공기제습장치제어용공기관제어용공기탱크제어반

control chart제어반제어기기관리용구멍 control drilling제어효율성 control effectiveness제어손잡이 control handle제어용유압관제어반운전대제어봉 control rod

제어봉구동장치제어봉장치제어실 control room

control span제어장소제어판 control surface제어판각제어판면적 방폭등용제어스위치제어계통제어테이블제어성

계속검사Continuous Synopsis Record (CSR)continuous wave continuous welding continuously manned spaces    contour line     contour contra flow     contra rudder  contra type stern      계약설계Contract Of Affreightment (COA)계약검토contracted mould       

수축계수contraction of area     contraction ratio of area       축척Contra-Rotating Propeller (CRP)

control air compressor control air dehydrator  control air pipe control air reservoir   control board  관리도표control console control device  

control oil pipe control panel   control platform 

control rod driving system     control rod system     

관리범위control station 

control surface angle   control surface area       control switch for explosion-proof lightcontrol system control table   controllability  

Page 52: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

가변피치프로펠러제어압연강 controlled rolled steel제어대상 controlled system

정위제어대상무정위제어대상제어량제어기조종장치대류 convection대류가열기대류방열기

convenient flag ship수렴노즐개조 conversionconversion project개장순양함변환기 converter볼록필릿용접컨베이어호송함냉각제 coolant냉각액펌프냉각액냉각제방사능냉각식터빈냉각기 cooler냉각공기재킷냉각면냉각식날개냉각코일냉각 cooling down냉각효과cooling fresh water

냉각용청수냉각기냉각용청수팽창탱크냉각용청수유수분리탱크냉각청수관냉각청수펌프냉각용청수저장탱크냉각관냉각속도냉각해수관냉각해수펌프냉각면냉각시험냉각탑 cooling tower냉각수 cooling water냉각수재킷 cooling water jacket냉각수펌프 cooling water pump

Controllable Pitch Propeller (CPP)

controlled system with self regulation  controlled system without self regulation       controlled variable     controller      controlling gear 

convection heater      convector      편의치적선convergent nozzle      

개조공사converted cruiser      

convex fillet weld      conveyor       convoy 

coolant pump  coolant quenching liquid coolants radioactivity   cooled turbine 

cooling air jacket      cooling area   cooling blade  cooling coil    

cooling effect  냉각용청수cooling fresh water cooler     cooling fresh water expansion tank    cooling fresh water oil separating tankcooling fresh water pipe       cooling fresh water pump      cooling fresh water storage tankcooling pipe    cooling rate    cooling sea water pipe cooling sea water pump cooling surface cooling test    

Page 53: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소도구창고음료품창고좌표축동합금동손백동 copper nickel백동관 copper nickel pipe복사기산호채취어선밧줄심재 core유심용접봉심재 재질 core material주상채니기심모래심선코어링코리올리력 Coriolis force코르크판코르크벽돌코르크카펫코르크가루코르크방현재코르크매트코르크페인트모서리덧댐판코너피팅 corner fitting모서리이음 corner joint모서리이음용접코너반사기수정유량보정곡선보정계수 correction factor

전류정격보정계수시정조치요구개량보전 corrective maintenance보정용자석상관수정계수상관계수 correlation factor대응속력통로 corridor통로격벽부식 corrosion부식추가 corrosion addition 부식여유 corrosion allowance부식조절부식균열부식피로부식억제제 corrosion inhibitor부식여유부식전위 corrosion potential방식 corrosion protection부식율 corrosion rate

방수보호피복

cooperage store cooper's store co-ordinate    copper alloy   copper loss    

copying machine       coral boat      cordage 

core electrode 

core sampler   core sand      core wire      coring 

cork board     cork brick     cork carpet    cork dust      cork fender    cork mat       cork paint      corner doubling 

corner joint welding    corner reflector corrected mass flow   correction curve       

correction factor for current ratingCorrective Action Request (CAR)

corrector magnet       correlation coefficient  

corresponding speed   

corridor bulkhead      

corrosion control       corrosion cracking     corrosion fatigue       

corrosion margin       

corrosion resistance protected cover   

Page 54: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

내식성합금강부식시험부식쇠모허용치부식 및 방식파형격벽파형로통 corrugated furnace주름창구덮개주름관모음주름외판주름외판선파형 corrugation초계함 Corvette (CC)스펙트럼실수부

cost accounting비용편익평가 cost benefit assessmentcost control진부화 손실 cost of obsolescence실비정산계획 cost reimbursable contract원가절감 cost savings

코터 cotter조립식받침목면캔버스면봉사선미돌출부 counter카운터보어역류 counter flow역류복수기역류식열교환기카운터싱킹선미목골재카운터형선미균형추식하역법카운터밸런스밸브 counter-balance valve중계축 countershaft접시머리리벳접시머리리벳끝커플링 coupling커플링볼트 coupling bolt축커플링볼트및너트커플링플랜지결합손실계수 coupling loss factor침로 course침로유지 course keeping

course keeping ability시운전항로진로기록기침로안정성평균침로선수상방표시보호유리피복아크용접봉피복 covering

Corrosion Resistant Alloy (CRA)corrosion test  corrosion wastage allowance corrosion and protectioncorrugated bulkhead    

corrugated hatch cover corrugated header      corrugated shell corrugated vessel      

co-spectrum   원가계산원가관리

운임·보험료 포함가격 Cost·Insurance and Freight (CIF)

cotter block    cotton canvas  cotton twine   

counter bore   

counter flow condenser counter flow heat exchanger    counter sinking counter timber counter type stern counter weight method 

countersunk head rivet 

countersunk point      

coupling bolt and nut  coupling flange 

침로유지성능course measured       course recorder course stability course steered course-up      cover glass    covered electrode      

Page 55: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

현연재덮판고깔형통풍통정장CPP oil cooler

가변피치프로펠러 작동유펌프 CPP oil pump

이동윈치 crab게가공선게잡이모선균열멈추개 crack arrester균열성장 crack growth균열발생 crack initiation

균열 발생 및 전파균열발생수명 crack initiation life균열전파 crack propagation균열감도 crack sensitivity

균열선단개구변위시험크래들소형선박 craft기중기 crane기중기부선기중기선기중기조종실크랭크 crank크랭크각크랭크암 crank arm크랭크암개폐량크랭크실 도출밸브 crank case relief valve크랭크실 소기크랭크실크랭크회전모멘트선도크랭크저널크랭크피트크랭크식펌프크랭크식셰이퍼크랭크스로 crank throw중두선크랭크실 crankcase무크랭크펌프크랭크핀 crankpin크랭크핀베어링크랭크핀볼트크랭크축 crankshaft크랭크축베어링크랭크축암개폐량 crankshaft deflection급속전진 crash ahead급속후진 crash astern급속후진시험 crash astern test

covering board covering plate  cowl head ventilator   coxswain       가변피치프로펠러

작동유냉각기가변피치프로펠러 작동유중력탱크 CPP oil gravity tank     

가변피치프로펠러 작동유저장탱크 CPP oil storage tank    

가변피치프로펠러 작동유섬프탱크 CPP oil sump tank      

crab factory ship       crab mother ship       

crack initiation and propagation

Crack Tip Opening Displacement (CTOD) testcradle  

crane barge    crane ship     craneman's house     

crank angle    

crank arm deflection   

crank case scavenging crank chamber crank effort diagram   crank journal   crank pit       crank pump    crank shaper   

crank vessel   

crankless pump 

crankpin bearing      crankpin bolt  

crankshaft bearing     

Page 56: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

급속정지 crash stopping비상역추진크레이터 crater크롤러기중기 crawler crane크롤러주행장치크리프 creep크리프한계크리프율크리프속력 creep speed크리페이지 creepage

연면거리틈새부식 crevice corrosion선원 crew해원명부선원실선원거주지역크링글재작업기준 criteria for rework

합격판정기준 criteria of acceptance

표준수 criterion numeral

용도표준수임계캐비테이션수임계기둥좌굴 critical column buckling임계감쇠 critical damping

위험회전수임계점임계압력임계레이놀즈수임계속력 critical speed위험회전수구역임계응력 critical stress주요구조부구역 critical structural area핵심성공요소임계온도임계비틀림진동임계속도횡보십자비트크로스벙커크로스콤파운드터빈복원력교차곡선도크로스갑판 cross deck교차침수 cross flooding교차침수설비 cross flooding arrangement

crash-back 

crawler unit    

creep limit     creep rate     

creepage distance for insulation 

crew list       crew space    

crew's quarter 

cringle 

criterion numeral of service    critical cavitation number      

critical number of revolution   critical point   critical pressure       critical Reynolds number       

critical speed range    

Critical Success Factor (CSF)critical temperature    critical torsional vibration      critical velocity cross beam    cross bitt      cross bunker   cross compound turbine cross curves of stability       

Page 57: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

직교흐름형열교환기십자표횡단소기역파 cross sea횡단면크로스튜브보일러해협연락선

crosscut홈파기끌가로켜기톱크로스헤드 crosshead크로스헤드형기관 crosshead engine크로스헤드가이드크로스헤드윤활유펌프크로스헤드핀크로스헤드슈횡단선크로스잭

crossover way크로스타이크로스트리스쇠지레정부 crown망대도가니로도가니강십자형 볼라드 cruciform bollard십자형 이음부 cruciform connection십자형 이음부 cruciform joint

원유 crude oil

원유운반선원유운반선 crude oil tanker원유세정 Crude Oil Washing (COW)크루즈선 cruise ship순양함 cruiser순양함형선미 cruiser stern순항권순항거리cruising range순항속력순항터빈순항요트 cruising yacht분쇄기 crusher압괴강도압괴응력압괴시험극저온 cryogenic temperatureCS1 type membrane입체조립 cubic assembly재화용적cubical cavity누적손상도 cumulative damage ratio

누적확률밀도함수

cross flow heat exchanger     cross mark     cross scavenging       

cross section  cross tube boiler       cross-channel vessel   병렬2단팽창기관 cross-compound engine 교차 crosscut chisel crosscut saw   

crosshead guide crosshead lubricating oil pump crosshead pin  crosshead shoe crossing vessel crossjack      교차통로crosstie crosstrees     crowbar 

crow's nest   crucible furnace crucible steel  

crude oil carrier       

cruising circle  cruising distance       순항거리cruising speed cruising turbine 

crushing strength      crushing stress crushing test   

CS1형식 멤브레인cubic capacity  

3차원 캐비티Cumulative Probability Density Function (CPDF)

Page 58: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

식기선반 cupboard

전류용량유속계정류판조류발전 current power generation조류항법변류기도전부커튼판곡률 curvature곡률증분 curvature increment 곡교정작업 curve fairing곡가공 curve forming

부심곡선감멸곡선도가침장곡선메타센터곡선굽은 면재 curved face plate곡선운동부양공기 cushion air부양면적 cushion area (Ac)부양실 cushion chamber부양압력 cushion pressure완충밸브세관감시선 custom boat관세차단 cutoff차단밸브차단 cutout차단장치커터 cutter커터모터커터실링장치커터축커터흡입준설선 cutter suction dredger절단선 cutting dragline

cutting drawing절단변절단염절단팁 cutting tip절단토치꺾어올림클리퍼형선수물가르게행정 cycle사이클 cycle주기적변동률주기적 하중 cyclic load연직축프로펠러실린더 cylinder실린더배럴실린더블록실린더안지름 cylinder bore실린더안지름게이지

current carrying capacity       current meter  current plate   

current sailing current transformer    current-carrying part  curtain plate     

curve of center of buoyancy   curve of extinction     curve of floodable length       curve of metacenter   

curvilinear motion      

cushion valve  

customs duty  

cutoff valve    

cutout gear    

cutter motor   cutter sealing equipment       cutter shaft    

절단도면cutting edge   cutting flame   

cutting torch   cut-up cutwater stem  cutwater       

cyclic irregularity      

cycloidal propeller     

cylinder barrel cylinder block  

cylinder bore gauge    

Page 59: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

실린더바닥실린더컬럼실린더상수실린더커버실린더컷오프시험실린더가스실린더커버실린더재킷냉각수펌프실린더보온피복실린더라이너실린더윤활펌프실린더유 cylinder oil

실린더유계량탱크실린더유서비스펌프실린더유저장탱크실린더유이송펌프실린더축 cylinder shaft실린더용적 cylinder volume실린더벽 cylinder wall원통형보일러원통형보강재 cylindrical stiffeners

D type end shackle데크론 Dacron데일리서비스탱크보수서 Damage Control Book (DCB)손상도면손상부위 수리 damage repair손상복원성 damage stability손상복원성 규정손상검사 damage survey손상검사보고서 damage survey report손상상태 damaged condition습한장소 damp space감쇠진동감쇠파댐퍼 damper댐퍼도어댐퍼장치감쇠 damping감쇠계수감쇠율감쇠모멘트위험각위험통보위험화물위험화학품 dangerous chemical위험화물위험장소 dangerous space위험구역 dangerous zone저인망어선다뉴브규칙암실

cylinder bottom cylinder column cylinder constant       cylinder cover cylinder cut off test    cylinder gas   cylinder head  cylinder jacket water pump    cylinder lagging cylinder liner  cylinder lubricating pump       

cylinder oil measuring tank    cylinder oil service pump      cylinder oil storage tank       cylinder oil transfer pump      

cylindrical boiler       

디(D)형 엔드 섀클daily service tank   

damage plan   

damage stability regulation

damped oscillation     damped wave  

damper door   damper gear   

damping coefficient    damping factor damping moment       danger angle   danger message dangerous cargo       

dangerous goods       

Danish trawler Danube rule    dark room     

Page 60: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

암적열물막이판대시폿데이터베이스 data base

데이터베이스관리시스템데이터북 data book자료흐름도데이터로거자료모형자료처리진수일자

datum line대빗 davit대빗소켓대빗스팬주간근무 day shift고휘도표시주간신호등 daylight signaling lamp주간신호등일광신호거울속임채색법직류아크용접

DC reversed polarityDC straight polarity정온데드아이데드플랫추측항법데드쉽 dead ship데드쉽상태최저속무효공간dead stock막다른복도 dead-end corridor데드후론트형배전반안덮개 deadlight선저기울기중량화물중력식압력계시험기중사시험중력식안전밸브재화중량척도재화중량톤수재화중량데드우드탈기급수가열기탈기공기분리기 deaerator밸러스트 배출용량 deballasting capability청소선붕괴열제거계데카방식감속영역dechlorinating데시벨갑판 deck

dark-red heat  dash plate     dash pot       

Data Base Management System(DBMS)

data flow diagram      data logger    data model     data processing date of launch 기준선davit socket    davit span     

daylight display 

daylight signaling light daylight signaling mirror       dazzle system  DC arc welding 역극성정극성dead calm      dead eye      dead flat       dead reckoning 

dead ship condition    dead slow      dead space    사장재고dead-front type switchboard

deadrise       deadweight cargo     deadweight gauge tester      deadweight measurement deadweight safety valve      deadweight scale       deadweight tonnage    deadweight(DWT) deadwood      deaerating feed water heaterdeaeration     

debris collecting vessel decay heat system     Decca system  deceleration zone      탈염소decibel (dB)

Page 61: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

데크부선 deck barge갑판보갑판의자갑판블록 deck block갑판볼트갑판버킷갑판화물갑판중심선갑판콤퍼지션갑판피복 deck covering갑판피복도갑판기중기선상감압실갑판부목갑판막음판갑판끝롤러갑판상구조물갑판배기관deck fittings갑판플랜지갑판포말장치 deck foam system갑판거더상부갑판 deck head갑판높이갑판훅갑판속구목록갑판사다리갑판채광유리갑판선갑판하중 deck load항해일지deck longitudinal갑판기계항해사deck opening갑판여객갑판기둥갑판상배관갑판구조도 deck plan목갑판대패갑판채광프리즘갑판장갑갑판펌프갑판하종통재갑판배수구갑판의자갑판피복갑판현측선갑판기둥갑판증기관갑판스토퍼갑판창고 deck store갑판창고지기갑판적재 deck stowage갑판스트링거갑판스트립 deck strip갑판탱크갑판트랜스버스

deck beam     deck bench    

deck bolt      deck bucket    deck cargo     deck center line       deck composition      

deck covering plan     deck crane     deck decompression chamber  deck department       deck end plate deck end roller deck erection  deck exhaust pipe     갑판의장품deck flange    

deck girder    

deck height    deck hook     deck inventory deck ladder    deck light      deck line       

deck logbook  갑판종통재deck machinery deck officer    갑판개구부deck passenger deck pillar     deck piping    

deck planer    deck prism light       deck protection deck pump     deck runner    deck scupper  deck seat      deck sheathing deck side line  deck stanchion deck steam pipe       deck stopper   

deck store keeper     

deck stringer  

deck tank      deck transverse 

Page 62: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

갑판청소관갑판청소펌프갑판시계 deck watch갑판가스역류방지장치 deck water seal갑판침수유갑판정갑판실 deckhouse

갑판수밀기기보안선언서 declaration of security감압챔버 decompression chamber오염제거 decontamination제독실 decontamination room

체감피치프로펠러해양수산부령 Decree of MOMAF디덴덤 deddendum이뿌리원전용배전반전용해수밸러스트탱크흘수제한표시등심층혼합처리부선양면개선깊은용입용접깊은 용입용접 deep penetration weld심해 deep sea심해측심추심해측심기잠수함구난정심해잠수정디프탱크 deep tank디프탱크격벽잠수펌프최대구획만재흘수선탱크내부설치 펌프 deep-well pump디폴트지정처짐 deflection처짐각개폐량계측기

deflection plate처짐계편침의변형 deformation

창구변형연료빼내기소자 degaussing소자장비실 degaussing room소자장치열화 degradation

degreasing고정도 degree of fixation자유도외피의보호등급

deck wash pipe deck wash pump       

deck wetness  decked boat    

deck-watertight apparatus      

decreasing pitch propeller      

deddendum circle      dedicated distribution boarddedicated seawater ballast tankdeep draft vessel light      deep mixing barge     deep penetration double bevel weld

deep sea lead  deep sounding machine Deep Submarine Rescue Vehicle (DSRV)Deep Submergence Vehicle (DSV)

deep tank bulkhead    deep well pump deepest subdivision load line

default setting 

deflection angle deflection gauge       반사판deflectometer  deflector       

deformation of cargo hatch     defueling       

degaussing system     

탈지degree of freedom     degree of protection of enclosures

Page 63: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

반동도탈습dehumidifier얼음제거 deicing탈빙해석 deicing analysis지발중성자전달마력 Delivered HorsePower (DHP)전달출력전달동력인도 delivery송출콕송출수두납품소요기간 delivery lead time송출관송출압력송출밸브상자송출밸브소자수요율광물질제거기순수장치시연 demonstration체선료 demurrage디오일러deoxidation practice영국통산성 Department of Trade (DOT)

미국운수성출항 departure동서거리 departure출항상태 departure condition의존도 dependability감극화

deposit metal용착부용착금속 deposited metal

용착금속부용착률용착속도모함감가상각폭뢰깊이측정기 depth gauge용입깊이틈새깊이화물창깊이용입깊이디레이팅출력구서면제증서디레이팅데릭 derrick데릭붐데릭크레인데릭포스트데릭장치

degree of reaction     dehumidification 제습기delayed neutron 

delivered output delivered power 

delivery cock  delivery head  

delivery pipe   delivery pressure      delivery valve box     delivery valve  demagnetization demand factor demineralizer  demineralizing  

de-oiler 탈산방법Department of Transportation (DOT)

depolarization  용착금속deposit zone   

deposited metal zone   

deposition efficiency   deposition rate depot ship     depreciation    depth charge   

depth of fusion depth of gap   depth of hold  depth of penetration     derated output derating exemption certificatederating 

derrick boom  derrick crane  derrick post    derrick rigs    

Page 64: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

데릭슈데릭소켓데릭테이블기복장치de-rustingdesiccant구획별설계 design by zone설계범주 design categorydesign changedesign condition설계계약업자 design contractordesign criteria

Design Data Sheet (DDS)

design details설계흘수 design draft설계피로수명 Design Fatigue Life (DFL)생산고려설계 design for production설계수두 design head 설계수명 design life design load계획만재흘수 design load draft계획만재흘수선 design load water line설계적하기준 design loading criteriadesign model설계최적화 design optimization설계요구사항 design requirementsdesign review설계나선 design spiraldesign standard

설계정수중굽힘모멘트설계파 design wave계획만재흘수 designed load draft소멸캐비테이션목표값탁상등구축함 destroyer구축함모함완열증기관과열완화기노르웨이선급착탈가능 detachable조립식날개부분선루상세설계상세도상세도소일정계획 detail scheduling세부조립절차서상세응력평가 detailed stress assessment탐지기 detector계면활성제 detergent저하 deterioration디튜너 detuner 독일공업규격전개면적 developed area

derrick shoe   derrick socket derrick table   derricking gear 녹제거건조제

설계변경설계조건설계기준설계기준 및 절차서 (미 해군)설계상세

설계하중

설계모형

설계검토설계표준

design still water bending moment

desinent cavitation     desired value  desk light      

destroyer tender       desuperheated steam pipe      desuperheater  Det Norske Veritas (DNV)    

detachable blade       detached superstructure detail design   detail drawing  detail plan     

detailed assembly procedure

Deutche Industrie Norm (DIN)

Page 65: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전개면적비날개전개넓이deviation항로이탈 deviation항로이탈경보자차곡선

반원자차수정장치자차수정장치데블클로

dew point배수시스템 de-watering system 탈아연다우대각선판붙임대각선맞댐식판붙임diagonal line빗댐판도표 diagram선도효율선도계수약도다이얼게이지다이얼스위치다이얼온도계내외지름비다이아몬드매듭다이아몬드판

다이어프램 diaphragm다이어프램판규조토보온재정장석다이 die형단조다이스톡다이캐스팅절연내력 dielectric strength절연내력시험디젤사이클디젤전기추진디젤전기추진선디젤전기추진디젤기관디젤기관구동발전기디젤유 diesel oil디젤유청정기디젤파일해머디젤선디젤요트위도차차동도르래디퍼렌셜드레인트랩

developed area ratio   developed blade area  편차deviation alarm deviation curve device for correcting semicircular deviation    device for correcting deviation  devil's claw  이슬점dezincing       dhow  diagonal built  diagonal carvel built   대각선diagonal tie plate      

diagram efficiency     diagram factor diagrammatic sketch     dial gauge     dial switch     dial thermometer       diameter ratio  diamond knot  diamond plate  

다이아몬드 수트블로어 diamond soot blower       

diaphragm plate diatomaceous earth heat insulating material    dicky  

die forging     die stock      die-casting      

dielectric strength test diesel cycle    diesel electric drive    diesel electric motor ship      diesel electric propulsion       diesel engine   diesel generator        

diesel oil purifier      diesel pile hammer     diesel ship     diesel yacht    difference of latitude   differential block       differential drain trap  

Page 66: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

차동기어정밀위성항법방치

differential pressure

차압계차압식유량계차압식액면계확산음장디퓨저 diffuser확산펌프확산성수소 diffusible hydrogen디지털 목업 digital mock-up

디지털선택호출장치디지털신호이면각차원치수차원해석무차원감소량 diminution광도가감기 dimmer눈금밝기조정밝기조정밝기조정스위치 dimmer switch딩기딥브레이징딥로프디퍼암디퍼붐디퍼버킷디퍼준설선독립빌지관독립빌지흡입직접계산 direct calculation 직류직결구동직접팽창식직화연관보일러직접노무비 direct labor cost직접법 direct method

직접수치모사직접인쇄전신 direct printing telegraphy

자기역전디젤기관자기역전장치 direct reversing gear직접강도해석 direct strength analysis직접강도평가 direct strength assessment

직접강도계산직접흡수관 direct suction방향탐지기방향검출장치

differential gear Differential Global Positioning System (DGPS)차압differential pressure gauge     differential pressure type flow meterdifferential pressure type level gaugediffuse sound field     

diffuser pump  

Digital Selective-Calling (DSC)systemdigital signal   dihedral angle  dimension      dimension      dimensional analysis   dimensionless  

dimmer for scale       dimmer illumination    

dinghy dip brazing     dip rope       dipper arm     dipper boom   dipper bucket  dipper dredger direct bilge pipe       direct bilge suction    

Direct Current(DC) direct drive    direct expansion system       direct fire tube boiler  

Direct Numerical Simulation (DNS)

direct reversible diesel engine 

direct strength calculation      

direction finder direction finding system 

Page 67: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

방향지시등 direction indicating light방향지시기방향제어밸브 directional control valve방위오차 directional error방향불안정성방향스펙트럼 파 directional spectrum waves침로안정성가름밸브비행기구disassemble분해공구 disassemble tool디스크 disc

면적비원판면적원판클러치원판크랭크디스크커터원판로터디스크밸브방전 discharge배출구 discharge배출플랩 discharge flap방전기간 discharge period배출관배출밸브원판윤활식베어링disconnection불연속

이산푸리에변환이산화 변수 discrete variable선택차단접시형경판접시형끝판붕괴날개차 disk날개차

dismantling 진찰실 dispensary진료등배수용적배수중량배수량 displacement변위 displacement배수량계수용적식압축기배수량곡선배수량길이비변위법 displacement method배수량눈금배수량형 선박 displacement ship배수톤수표시 display

display unit폐기물처리 disposal of garbage이종금속 dissimilar metals

direction indicator      

directional instability   

directional stability     director valve  dirigible balloon 분해

디스크-드럼터빈 disc and drum turbine  disc area ratio disc area      disc clutch     disc crank     disc cutter     disc rotor      disc valve      

discharge pipe discharge valve disc-oiled bearing      분리discontinuity   Discrete Fourier Transform (DFT)

discriminative trip      dished end plate       dished head    disintegration  

disk wheel     해체dispensary light displaced volume       displaced weight       

displacement coefficient displacement compressor displacement curve     displacement length ratio       

displacement scale     

displacement tonnage  

표시장치

Page 68: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용해아세틸렌용존산소계최단접근거리절연거리항정지시기거리눈금디스턴스피스 distance piece거리분해능증류수 distilled water증류수관증류수탱크증류기증류복수기조수장치 distilling plant

조수장치해수펌프조수장치순환펌프조수장치청정제탱크조수장치증류수펌프조수장치이젝터펌프호출부호선박번호일그러짐 distortion변형제어법 distortion control method조난 distress조난경보제어반 distress alarm panel 조난경보 distress alerts조난화염신호 distress flares조난통보조난신호제어반 distress panel조난신호분산 컴퓨팅 distributed computing

분산자료처리분포하중 distributed loads분배관머리분배밸브분전 distribution분전함잠수부 선발산노즐발산파부등률분류터빈디바이더잠수종잠수챔버수평타잠수작업지원선칸막이벽독 dock독케이슨

dissolved acetylene    dissolved oxygen meter Distance at Closest Point of Approach(DCPA) distance for insulation  distance indicator      distance marker 

distance resolution     

distilled water pipe    distilled water tank    distiller distilling condenser    

distilling plant brine pump    distilling plant circulating pump       distilling plant compound tank  distilling plant distillate pump distilling plant ejector pump  distinctive letter       distinctive number     

distress message       

distress signal 

distributed data processing     

distributing header     distributing valve       

distribution box 분전반 distribution panel       diver boat     divergent nozzle       diverging wave diversity factor divided flow turbine    dividers diving bell     diving chamber diving rudder  diving support vessel  division wall   

dock caisson  

Page 69: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

갑문독 하우스독 진수독마스터독 문턱독 시험독 사용료입거 docking입거 브래킷 docking bracket선미선교 docking bridge선미선교갑판도킹용골입거배치도 docking plan

입거선박위치검지장치입거검사도킹텔레그래프조선소항해선교내다지도그 dog멈춤지주풍향기도그워치조임 핸들 dogs돌핀 dolphin돌핀스트라이커돔천창내항선보조보일러 donkey boiler문매트문지방도플러로그도플러소너복동기관쌍좌정양좌밸브양면 개선 double bevel쌍도르래이중저 double bottom이중저구조 double bottom construction

이중저구조도이단침상양면덧판양용캘리퍼스체인용 이륜활차양면연속필릿용접양면연속용접 double continuous weld새집모양비트이중곡률쌍기통기관이중문 double door

복효증류기양면보일러양두기관시스템 double ender system

dock gate      dock house    dock launching dock master    dock sill       dock trial      dockage 

docking bridge deck   docking keel   

docking ship position indicator Docking Survey (DS)docking telegraph      dockyard       dodger 

dog shore      dog vane      dog watch     

dolphin striker dome skylight  domestic vessel 

door mat       door sill       Doppler log    Doppler sonar  double acting engine   double banked boat    double beat valve      

2인용선실 double berth cabin     

double block   

double bottom construction profile     double bunk    double butts strap      double calipers double chain sheave   double continuous fillet welding

double cross bitt       double curvature       double cylinder engine 

double effect evaporator       double ended boiler    

Page 70: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이중증발보일러

양면필릿용접 double fillet weld분류터빈복합늑골양면홈 개선 두줄난간이중나선톱니바퀴이중선각 double hull이중선체 double hull이중선체구조복식인젝터이중절연이중너트 double nut

이중관브라인냉각기이중관복수기복판타쌍극

겹판타양좌밸브양면보호임펠러양면흡입날개이중선측구조 double skin construction양면덧판연결이중나사쌍크랭크축쌍투스위치이언식케이형홈쌍립문 double-leaf door

이중판 doubler이중선측외판 double-side skin더블릿덧댐 doubling이중판도브테일 dovetail도브테일이음도브테일홈도브테일판다월 dowel다월핀다월이음국부조명등 down light하향행정세류 down wash세류각강하관모음강수관

double evaporation boiler      

2단팽창기관 double expansion engine       

double flow turbine    double frame   double groove preparationdouble handrail double helical gear   

double hull structure   double injector double insulation       

double pipe brine cooler       double pipe condenser double plate rudder    double pole    

2단감속장치 double reduction gear  2열리벳이음 double riveted joint    2열리벳박기 double riveting 

double rudder  double seat valve      double shrouded impeller       double sided impeller  

double strapped joint   double threaded screw double throw crank-shaft      double throw switch   double wire system    double-bevel groove   양면제이(J)홈 double-J groove       

2극스위치 double-pole switch     

doublet 

doubling plate  

dovetail joint   dovetail mortise dovetail plate  

dowel pin      doweling       

down stroke   

down wash angle      downcast header       downcast pipe 

Page 71: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

강수관하향용접 down-hand welding다운홀downstream비가동시간 downtime다운톤펌프하향유동 downwash풍하향 downwind통풍 draft흘수 draft송풍로흘수계통풍계흘수지시장치 draft indicating system흘수사다리흘수표흘수눈금통풍정지판 draft stop흘수검사 draft survey송풍로제도사항력 drag

드래그암 drag arm

드래그암조작반드래그암모양지시기드래그암윈치제동체인항력계수항력 drag force드래그헤드심도계드래그헤드드래그래더서스펜션로드드래그석션준설선드래깅항양비드레인탱크드레인콕드레인집합탱크드레인냉각기배수구 drain hole드레인관드레인플러그드레인폿드레인펌프선저플러그드레인분리기드레인소음기드레인탱크드레인트랩배수밸브

downcomer    

downhaul      후속공정downton pump 

draft air duct  draft gauge  draft gauge    

draft ladder draft marks    draft scale     

draft trunk draftsman      

drag arm control panel     drag arm figure indicator       drag arm winch drag chain     drag coefficient 

drag head depth meter 

drag head      

drag ladder    drag link       drag suction hopper dredger   dragging       drag-lift ratio  drain cistern   drain cock     drain collecting tank   drain cooler    

drain pipe      drain plug      drain pot       drain pump     drain screw    drain separator drain silencer  drain tank      drain trap      drain valve     

Page 72: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

배수장치 drainage배수관드로카드장력조절기드로바이스도면출도 일정계획 drawing issue schedule인발관드로워크초대형전함준설조작판준설토사수유량계준설관준설펌프 dredge pump

준설펌프실링장치준설흡입관준설밸브준설선 dredger

준설토량계준설심도계편류각표류력 drift force유망유망어선훈련 drill시추 drill드릴비트 drill bit시추데릭드릴프레스시추선시추탑부선형 시추선시추날개시추기드릴링머드 drilling mud드릴링플랫홈 drilling platforms

drilling rig시추보급선 drilling tender드릴시험시추장치 drilling unitdrinking water fountain

음료수압력탱크음료수압력탱크음료수펌프음료수탱크방적형기름받이 drip tray피동바퀴두드려맞춤선수침하 drop중추윈치낙하단조낙하해머드롭킬드롭판

drainage pipe  draw card      draw off holdback gear       draw vice      

drawn tube    drawworks     dreadnaught    dredge control panel   dredge flow meter     dredge pipe    

dredge pump sealing equipment dredge suction pipe    dredge valve   

dredging capacity indicator     dredging depth meter  drift angle     

drift net       drifter 

drill derrick    drill press     drill ship    drill tower     drilling barge  drilling blade   drilling machine 

시추선drilling test    

냉식수기drinking water hydrophore tank drinking water pressure tank   drinking water pump   drinking water tank    drip proof type 

driven wheel   driving fit      

drop chisel winch      drop forging   drop hammer   drop keel      drop strake    

Page 73: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

낙하시험분리형웨이트드럼 drum드럼로터드럼스테이지건식공기펌프건연식보일러건산적화물 dry bulk cargo건화물 dry cargo건화물선 dry cargo ship건연식보일러건식연소실건식나침반건식 독 dry dock건식독물넣기건식낙하시험 dry drop test건도막 두께 dry film thickness건조마찰 dry friction

분말소화기건식보일러보존법건조식량고마른썩음건구역 dry space건증기입거 dry-docking입거계획도 dry-docking plan건조제건조실세탁물건조기 drying tumbler복합공기펌프복합사이클쌍덕트이중연료디젤기관이중연료기관

범포 duck범포범포덮개듀콜강덕트 duct상자형 용골 duct keel덕트손실덕트프로펠러 duct propeller연강연성 ductilityductility test만기일 due date납기우선순위규칙 due date priority rule암적열덤카드소화물용승강기 dumbwaiter가짜굴둑더미링가짜굴둑덤프시험

drop test       droppable weight       

drum rotor     drum stage    dry air pump   dry back boiler 

dry combustion chamber boilerdry combustion chamber       dry compass   

dry dock flood 

dry powder fire extinguisher   dry process    dry provision store    dry rot 

dry steam      

dryer  drying room    

dual air pump  dual cycle     dual duct      Dual Fuel Diesel Engine (DFDE)dual fuel engine 듀얼탠덤아티큘레이티드형감속

장치 dual tandem articulated type reduction gear       

duck canvas   duck cover     Ducol steel    

duct loss       

ductile steel 

연성시험dull-red heat   dumb card     

dummy funnel  dummy ring    dummy stack   dump test      

Page 74: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

과잉증기복수기 dumping condenser화물깔개 dunnage화물깔개판자화물깔개매트화물깔개판자복식여과기복식인젝터복식노즐복식펌프복식여과기이중급전이중장비 duplicated equipment내구성 durability듀랄루민듀로스코프먼지막이격벽집진기미분탄집진기코르크가루먼지막이먼지막이염색침투탐상시험 dye penetrant inspection액체침투탐상시험 dye penetrant test동적평형시험 dynamic balance test동적평형 dynamic balancing동적특성운동특성보정모델링충격설계해석법동하중 조합 계수자동위치유지장치동적압력 dynamic pressure동복원력동적응력동적탱크압력 dynamic tank pressure동적시험동흡진기 dynamic vibration absorber

동적파랑압력 dynamic wave pressure

동적지지정

발전기 dynamo

발전용기관동력계이벤드이어링

dunnage board dunnage mat   dunnage wood duplex filter   duplex injector duplex nozzle  duplex pump   duplex strainer duplicate supply 

duralumin      duroscope      dust bulkhead  

dust catcher   

dust coal       dust collector  dust cork      dust proof     dust tight      

dynamic characteristics dynamic compensation modelingDynamic Design Analysis Method (DDAM)Dynamic Load Combination Factor (DLCF)Dynamic Positioning System (DPS)

dynamic stability       dynamic stress 

dynamic test   

dynamically supported craft    

dynamo engine dynamometer   E bend earing  

Page 75: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수입능력 earning capacity접지 earth누전검출기earth fault누전검출등접지선

접지식배전방식밸브개폐장치썰물에보나이트편심하중편심리듀서 eccentric reducer편심봉편심슬리브편심륜편심 eccentricity편심률에코 echo에코박스음향측심기 echo sounder음향측심수신기음향측심송신기음향측심송신기음향측심 echo sounding음향측심기 echo sounding device레이더단면적경제적주문량 economic order quantity경제속력 economical speed이코너마이저 economizer와류 eddy와전류 eddy current와류탐상법 Eddy current Test (ET)와류저항와류방지판가장자리 edge변 계수 edge factor경계함수 edge function곧은결널판변두리이음 edge joint변두리이음용접가장자리대패개선 edge preparation자유변 보강 edge stiffening변 응력비 edge stress ratio가장자리덧판가장자리용접 edge welding배기관이덕터 eductor에드워드펌프유효전진각유효받음각유효굽힘스팬 effective bending span유효폭 effective breadth유효통달거리

earth detector 전기누전earth lamp     earth wire     earthed distribution system     easing gear    ebb (tide) ebonite eccentric load  

eccentric rod  eccentric sleeve       eccentric wheel 

eccentricity ratio       

echo box      

echo sounder receiver echo sounder transducer       echo sounder transmitter       

echoing area  

eddy making resistance eddy plate     

edge grain     

edge joint welding     edge planer    

edge strip      

eduction pipe  

Edwards pump effective advance angle effective angle of attack       

effective communication 

Page 76: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

유효갑판유효효율유효마력유효용접길이유효피치 effective pitch유효피치비유효동력유효압력유효단면적 effective sectional area 유효행정유효선루 effective superstructure

유효열효율유효목두께유효반류 effective wake유효반류계수유효파경사유효폭 effective width

열교환율효율 efficiency효율곡선 efficiency curve유출각이젝터 ejector이젝터복수기이젝터펌프선수미갑판끝받침대탄성후기효과탄성좌굴탄성커플링탄성컵형와셔탄성변형탄성한도탄성계수탄성변형에너지탄성안정성탄성변형에너지탄성변형률탄성응력탄성지지 elastic support탄성진동탄성 elasticity탄소성영역 elasto-plastic domain엘보 elbow

전기식도킹텔레그래프전기설비 electric apparatus아크용접 electric arc welding전기접지 electric bonding전기브레이징전선관 electric cable pipe전기전도율전기도체전류전기식도킹텔레그래프전기식흘수계

effective deck  effective efficiency     Effective Horse Power (EHP) effective length of weld 

effective pitch ratio    effective power effective pressure      

effective stroke 

effective thermal efficiency    effective throat thickness      

effective wake fraction effective wave slope   

effectiveness of regenerator   

efflux angle    

ejector condenser      ejector pump   ekeing elastic after-effect     elastic buckling  elastic coupling elastic cup washer     elastic deformation     elastic limit    elastic modulus elastic resilience       elastic stability elastic strain energy   elastic strain   elastic stress  

elastic vibration 

electric anchor and lookout telegraph

electric brazing 

electric conductivity    electric conductor       electric current electric docking telegraph      electric draft gauge    

Page 77: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전기식비상용엔진텔레그래프전기식엔진텔레그래프 electric engine telegraph

전기식엔진텔레그래프로거전기식엔진텔레그래프리피터전기로전기식징전기혼전기점화기관전기부하분석 electric load analysis전기로그전동기 electric motor

전기식프로펠러축회전계전기추진 electric propulsion전기추진선전기방식법전기방열기전기저항용접저항선스트레인게이지전기식타각지시기전기안전등전기충격 electric shock전기식매연지시기전기로강전동조타기전동조타장치전기식조타텔레그래프전기창고전기식온도조절기전기용접기전기용접전동윈치전동양묘기전기적위해요소 electrical hazard전기설비 electrical Installation전기식시동장치 electrical starting system급전장치 electrical supply system

electrical work전기적 연속 electrically continuous 일렉트로가스용접 Electro Gas Welding (EGW)전자사진마킹 electro photo marking용접봉 electrode전극 electrode

용접봉 집게전극팁전동유압 electro-hydraulic

전동유압조타장치

electric emergency engine telegraph

electric engine telegraph logger electric engine telegraph repeaterelectric furnace electric gong   electric horn   electric ignition engine 

electric log    

electric propeller shaft revolution indicator     

electric propulsion ship electric protection      electric radiator electric resistance welding     electric resistance wire strain gaugeelectric rudder angle indicator electric safety lamp    

electric smoke indicator electric steel   electric steering engine electric steering gear  electric steering telegraph     electric store  electric thermostat     electric welder electric welding electric winch  electric windlass       

전장공사

electrode holder       

electrode tip   

electro-hydraulic steering gear 

Page 78: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전동유압장치 electro-hydraulic system전기분해전해질전기부식전해효과전자석전자기식제동기전자파 적합성전자기식커플링전자장 electromagnetic fields

전자기유량계전자파간섭현상전자식선속측정장치 electromagnetic log전자파펄스전자밸브 electromagnetic valve전자빔용접전자식움직눈금전자부저전자해도 간이전자해도시스템 electronic chart system전자식움직눈금전파항법전자표시장치 electronic plotting aids전자식 트레이서전파식액면계전기도금 electroplating전기도금조전기식사진마킹 electro-print marking정전기 electrostatic charge정전기적위해요소 electrostatic hazard요소판패널고가통로 elevated passageway

elevation타원법칙타원형날개타원형선미연신율 elongation

승정장치승정갑판승정용사다리승정등

embarkation light승정장소 embarkation station압출프레스취화특성노출쐐기비상용공기압축기비상용공기탱크비상용빌지관

electrolysis    electrolyte     electrolytic corrosion   electrolytic effects     electromagnet  electromagnetic brake  ElectroMagnetic Compatibility (EMC)electromagnetic coupling       

electromagnetic flow meter    ElectroMagnetic Interference (EMI)

ElectroMagnetic Pulse (EMP)

electron beam welding electronic bearing maker       electronic buzzer       Electronic Chart Display and Information System (ECDIS)

electronic cursor       electronic navigation   

electronic tracer       electronic wave type level gauge      

electroplating bath     

Elementary Plate Panel (EPP)

측면도ellipse law     elliptical blade elliptical stern 

embarkation arrangement       embarkation deck      embarkation ladder     embarkation lamp      승정등embossing press       embrittlement characteristicemerged wedge emergency air compressor     emergency air reservoir        emergency bilge pipe  

Page 79: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

비상빌지펌프비상용빌지흡입밸브비상단정비상상태 emergency condition

비상배전회로emergency door

비상조명장치비상전원비상전기설비비상부하 emergency electrical load비상엔진텔레그라프 emergency engine telegraph비상탈출장치 emergency escape system비상탈출용 트렁크 emergency escape trunk비상탈출구 emergency exit비상급전선비상소화펌프 emergency fire pump비상발전기 emergency generator

비상발전기용디젤기관비상발전기용연료유탱크비상발전기실 emergency generator room비상발전기구역 emergency generator space비상용조속기 emergency governor비상등 emergency light긴급전달사항 emergency message비상계류 emergency mooring경계윈치경계와이어로프비상작동 emergency operation

비상조난위치발신기비상전원공급장치 emergency power supply비상식량비상차단시험비상차단밸브용공기탱크비상정지시험비상정지장치 emergency stopping device 비상배전반비상스위치비상예인장치비상밸브비상급수시스템이민선이미터공창 empty hold유화작용유화성 emulsify폐위구역 enclosed space

emergency bilge pump 

emergency bilge suction valve emergency boat 

emergency distribution circuit  비상문emergency electric lighting systememergency electric power sourceemergency electrical appliance 

emergency feeder      

emergency generator diesel engine     emergency generator engine fuel oil tank      

emergency mooring winch      emergency mooring wire rope  Emergency Position Indicating Radio Beacon(EPIRB) emergency ration      emergency shutdown test     emergency shut-off valve air reservoir emergency stop test   

Emergency Switch Board (ESB)emergency switch      emergency towing arrangementemergency valve       emergency water supply systememigrant ship  emitter 

emulsification  

Page 80: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

밀폐형그래브버킷둘레막이격벽파만남진동수단부브래킷 end bracket단부연결부 end connection단말링크경판 end plate끝판 효과 end plate effect단말 새클 end shackle축단 추력맞은편에항속거리 endurance피로한도 endurance limit내구시험 endurance test에너지 energy에너지선도에너지 방정식 energy equation

와류실손실기관베드기관베드실린더컬럼기관제어콘솔 engine control console기관제어실 engine control room

기관제어실공기조화장치기관제어실냉방장치기관효율기관기진력기관실 engine room기관실배치도 engine room arrangement기관실격벽기관실위벽기관실구멍기관실통풍기기관베드엔진공장 engine shop기관창고엔진텔레그라프 engine telegraph기관무인화운전시험기관당직기관사거주구역 기관사기관사호출장치 engineer's alarm 기관사실 engineers' cabin기관일지 engineer's log book기관사공용실 engineers' public room검사강화제도확대링크선미깃대상선기엔탈피 enthalpy엔탈피 방법 enthalpy method갇힌기체함유량

enclosed type grab bucket     enclosure bulkhead     encounter frequency   

end link 

end thrust     endon  

energy diagram 

energy loss in exit volute      engine bearer  engine bed     engine column 

engine control room air conditionerengine control room unit cooler engine efficiency       engine exciting force   

engine room bulkhead  engine room casing    engine room opening   engine room ventilating fan    engine seat    

engine store   

engine unmanned control testengine watch   engineer officers' accommodationengineer   

Enhanced Survey Program(ESP)enlarged link   ensign staff    ensign 

entrained gas content  

Page 81: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

유입류 entrainment물가름부 entrance물가름각엔트로피 entropy엔트로피선도entry angle입구유동 entry flow포락선 envelope포락선 결과 envelope results유성기어감속장치에폭시 epoxy등변형강 equal angle시차율평형상태수선 equilibrium water line평형의장품 equipment호밍설비장비목록표 equipment list의장수장비대체 equipment replacement등퍼텐셜선등가폭 equivalent breadth

등가소음레벨등가기준 equivalent criteria등가설계파등가증발량등가길이등가노치응력 equivalent notch stress등가반지름등가거칠기등가단면적 equivalent sectional area

등가응력등가비틀림모멘트탑재 erection

erection inspection탑재연결일정 erection network schedule탑재일정계획 erection scheduleerection sequenceergonomics에릭슨사이클침식 erosion난류부식 erosion corrosion침식보호비상탈출용 보호구 escape hood비상사다리도출관탈출로 escape route탈출구

탈출 트렁크 escape trunk

도출밸브선미선명판

entrance angle 

entropy chart  유입각

epicycle reduction gear 

equation of time       

equilibrium     

equipment for homing  

equipment number     

equipotential line       

equivalent continuous sound level

equivalent design wave (EDW)equivalent evaporation equivalent length       

equivalent radius       equivalent sand roughness     

equivalent stress       equivalent twisting moment     

탑재검사

탑재순서인간공학Ericsson cycle 

erosion shield  

escape ladder  escape pipe    

escape scuttle 

escape valve   escutcheon     

Page 82: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

중요보기중요용도추정인력부하 estimated labor load추정중량 estimated mass

도착예정시간출발예정시간부식시험에칭유럽해사안전청공정점공정용접대안평가 evaluation of alternatives현행방법평가생산실적분석증발 코일 evaporating coil증발 evaporation증발력증발계수증발력증발기 evaporator이븐킬 even keel사건수목분석 Event Tree Analysis (ETA)진화전략 evolution strategies굴삭기 excavator

초과배율창구초과적량여자기 exciter기진기 exciter가진시험 exciter test여자전류기진진동수 exciting frequency강제모멘트배타적경제수역전임검사원 exclusive surveyor회유선공작법면제증서배기 exhaust배기캠배기가스 exhaust gas배기가스보일러배기가스이코노마이저 exhaust gas economizer

배기가스이코노마이저급수펌프배기가스관배기가스소음기배기가스터빈배기손실배기 매니폴드 exhaust manifold배기노즐배기관배기구

essential auxiliary machinery   essential service       

Estimated Time of Arrival (ETA)Estimated Time of Departure (ETD)etch test       etching European Maritime Safety Agency (EMSA)eutectic point  eutectic welding       

evaluation of current methodsevaluation of production performance

evaporative capacity   evaporative factor      evaporative power     

excess multiplication factor    excess of hatchway    

exciting current 

exciting moment       Exclusive Economic Zone (EEZ)

excursion boat execution of work     exemption certificate   

exhaust cam   

exhaust gas boiler     

exhaust gas economizer feed water pump  exhaust gas pipe       exhaust gas silencer   exhaust gas turbine    exhaust loss   

exhaust nozzle exhaust pipe   exhaust port   

Page 83: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

배기받이배기구배출증기 exhaust steam

배기유분분리기배출증기관배기행정배기밸브 exhaust valve

배기밸브개방장치배기밸브개방장치배기통풍기현존선유출각출구면적준자오선고도확장면적 expanded area확장면적비날개 전개넓이인장철망판 expanded metal인장철망판격자전개 expansion팽창 expansion신축조절용곡관팽창계수디퍼렌셜드레인트랩팽창기관팽창해치팽창창구신축환신축이음 expansion joint신축루프 expansion loop신축관이음전개도팽창비신축환팽창행정팽창탱크확장시험팽창트렁크 expansion trunk

팽창트렁크식창구expansion U band팽창밸브 expansion valve기대하중이력 expected load history 모형실험수조 experimental model basin시험탱크 experimental tank전문가시스템 expert system전문가시스템셸폭발 explosion폭발실폭발등급방폭형구조explosion risk폭발행정폭발시험방폭기기 explosion-proof apparatus방폭천장등

exhaust receiver       exhaust slot    

exhaust steam oil separator    exhaust steam pipe    exhaust stroke 

exhaust valve easing gear     exhaust valve lifting   exhaust ventilating fan existing ship     exit angle      exit area       exmeridian altitude     

expanded area ratio    expanded blade area   

expanded metal grating 

expansion bend expansion coefficient   expansion drain trap   expansion engine       expansion hatch expansion hatchway    expansion hoop 

expansion pipe joint    expansion plan expansion ratio expansion ring expansion stroke       expansion tank expansion test 

expansion trunk hatchway      유(U)자형 신축관이음

expert system shell    

explosion chamber     explosion class explosion proof type   폭발 위험explosion stroke       explosion test  

explosion-proof ceiling light

Page 84: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

explosion-proof lamp방폭형전동기 explosion-proof motor폭발위험구역 explosive atmosphere

폭발성가스지수함수실험노출심노출갑판노출금속부 exposed metal part노천갑판 exposed weather deck바람맞이면적연장부 extension주물자신장계

extent of work

외연기관external design agency외부완열기외연보일러외압감멸계수소화제 extinguishing medium부급수밸브과당치수비extra work추출펌프extraction tower외삽법 extrapolation최대폭최대흘수전장극치압출알루미늄압출재압출판재 extruded plating압출기압출형재 extrusion압출법아이플레이트 eye plate아이슬릿 eye slit 아이스플라이스아이볼트eyebrow눈구멍직물 fabric가공 송선계획 fabrication line plan

제작절차서가공공장 fabrication shop면재 face앞면 face면재앞면캐비테이션면재 face flat표면경화

방폭등

explosive gas  

exponential experiment exposed core  exposed deck  

exposed wind area     

extension scale extensometer  작업범위external combustion engine    설계용역external desuperheater external firing boiler   external pressure      extinction coefficient   

extra feed valve       extra proportion       추가공사extraction pump 추출탑extreme breadth       extreme draft  extreme length extreme value       extruded aluminum     extruded material      

extruding machine     

extrusion process      

eye splice     eyebolt 물받이eyelet hole     

Fabrication Sequence Diagram (FSD)

face bar       face cavitation 

face hardening 

Page 85: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

마스크용접면앞면피치면재손얼굴가리개치폭 face width표면굽힘시험편표면굽힘시험

facilities layout자리고르기 facing와셔맞비빔맞춤팩시밀안전계수 factor of safety구획계수 factor of subdivision

인수자 공장시운전공장자동화 factory automation공모선고장대비형 fail-safe이중안전 홀드백장치 fail-safe hold-back unit고장대비원리 fail-safe principle고장 failure파손 failure

고장모드영향분석failure rate순정류순정곡선순풍순정작업 fairing페어리더 클리트 fairlead cleat페어리더항로 fairway항로입구부표플레어썰물폴 fallsfalse bottom가천장 false ceiling가상가상용골보호판선수재보호판송풍기 fan송풍기케이싱공기조화기 Fan Coil Unit (FCU)송풍부양기관fashion plate

군수지원함패스트푸리에변환조임볼트가열공구고착못패덤 fathom

face mask      face of weld   

face pitch    

face plate      face shield     

face-bend specimen    face-bend test 설비배치facing ring     facing up      facsimile       

Factory Acceptance Trial (FAT)

factory ship    

Failure Mode Effect Analysis (FMEA)고장율fair current    fair curve      fair wind       

fairleader     

fairway buoy   fall out falling tide     

가저false echo     false image    false keel      false stem     

fan casing     

fan engine     선수재 판Fast Combat Support Ship (AOE)Fast Fourier Transform (FFT)fastening bolt heating device   fastening nail  

Page 86: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

피로 fatiguefatigue allowance피로해석 fatigue analysis피로검토 fatigue check피로부식 fatigue corrosion피로균열 fatigue crack피로균열발생 fatigue crack initiation피로균열전파 fatigue crack propagation피로손상 fatigue damage피로한계피로 노치계수 fatigue notch factor피로강도 fatigue resistance fatigue strength피로시험수도꼭지 faucet스피것이음고장 fault고장조건 fault condition고장수목분석 Fault Tree Analysis(FTA)페잉플랜지접합면페더키날개수차수평유지디딤판되먹임급수펌프 feed pump

급수조절밸브캐스케이드탱크급수가열기급수넘침탱크급수관급수펌프급수조절 밸브급수조절기급수탱크역급전 feedback operation피더장치 feeder급전반피더운송 feeder service틈새 게이지 feeler gauge암로터방현재 fender펜더타워페라이트 ferrite페라이트입도페룰 ferrule도선 ferry도선핵연료전환물질파이버 fiber유리섬유 fiberglass

유리섬유강화플라스틱피드 fid피드구멍피들도르래

피로여유

fatigue limit    

피로강도fatigue test    

faucet joint    

faying flange   faying surface  feather key    feathering paddle wheel feathering step feed back      

feed water control valve       feed water filter tank  feed water heater      feed water overflow tank      feed water pipe feed water pump       feed water regulation valvefeed water regulator   feed water tank 

feeder panel   

female rotor   

fender tower   

ferrite grain size       

ferry boat      fertile material 

Fiberglass Reinforced Plastics (FRP)

fid hole fiddle block    

Page 87: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선수장식보일러실 통풍구 fiddly opening필드 fieldfield engineerfield fabrication현업생산계획 field plan현장용접 field welding돌출난간선수상장갑관통계수줄솔줄솔용가재필릿 fillet

전달필릿용접옆면필릿용접필릿용접크기필릿용접선수충전재주입수높이 filling height적재수준 filling level 주입관적하율 filling ratio필름배지필름냉각 film cooling필름냉각날개필름냉각구멍유막윤활필터 filter핀 fin핀 용골 fin keel

fin stabilizer핀 붙이관 fin tube핀튜브형열교환기겉칠최종손상수선 final damage water line완성도 final drawing완성검사 final inspectionfinal sighting최종지회로완성검사 final surveyfine control세립 fine grain상세요소분할 fine mesh가는나사비척도 fineness마감도장 finish paint다듬질기호 finish symbol마감검사유한익렬

유한차분법유한요소법유한체적법 Finite Volume Method (FVM)화재경보 fire alarm화재경보장치 fire alarm system

fiddle head     

현장기사현장제작fife rail figure head    figure of merit file brush      file card       filler metal     

fillet weld in normal shear     fillet weld in parallel shear       fillet weld size fillet welding   filling chock    

filling pipe     

film badge     

film cooling blade      film cooling hole       film lubrication 

핀 안정기fin tube type heat exchangerfinal coating   

최종축심투시final subcircuit 

미세조정fine thread     

finish-turn inspection  finite cascade  Finite Difference Method (FDM)Finite Element Method (FEM)

Page 88: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소방도끼불격자봉 fire bar불격자받침소방버킷fire classification내화점토화재제어도소화제어실방화댐퍼화재위험구역 fire dangerous zone선수역재화재탐지장치화재탐지기방화문 fire door방화문 표시기패널 fire door indicator panel화재훈련 fire drill내화성 fire endurance소화기소화설비

소화설비소화설비소화장치 fire extinguishing system소방설비포말소화제불격자소화호스 fire hose소화호스상자소화노즐

fire insulation소화주관 fire main소화주관소화마스크방사총화재순찰소화관발화점화재 예방 fire precaution화재 방지 fire preventionfire protection

방화구조소화펌프 fire pump불갈퀴내화성케이블 fire resistance cable내화격벽내화구획 fire resisting division내화도료내화시험내화목재난연성페인트 fire retardant paint방화구획방화문난연재보일러실격자

fire axe 

fire bar bearer fire bucket     화재 분류fire clay       fire control plan       fire control station     fire damper    

fire deadwood  fire detecting system  fire detector   

fire extinguisher       fire extinguishing apparatusfire extinguishing appliance    fire extinguishing equipment

fire fighting system    fire foam       

fire grate      

fire hose box  fire hose nozzle 방화재fire main pipe  fire mask      fire monitor    fire patrol      fire pipe       fire point      

방화fire protection construction     

fire rake       

fire resisting bulkhead 

fire resisting paint     fire resisting test      fire resisting wood     

fire retarding division  fire retarding door     fire retarding material  fire room grating       

Page 89: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

화재 안전 장치 코드화재시뮬레이션 fire simulation불갈퀴봉소화제어실연관보일러소화줄소방선내화벽돌사격통제체계 Fire-Control System (FCS)소방 fire-fighting소방선 fire-fighting boat소방원장구방화격벽내화시험내화자유낙하구명정 fire-protected free-fall lifeboat내화구명정 fire-protected lifeboat진화가스착화순서발화점연소압력점화봉부삽우현큰닻초벌칠

first moment

응급의료구 first-aid kit선입선출법 first-in first-out method일선감독자 first-line supervisor톱날형날개어획물운반선은점어군탐지기활어창어류가공선활어창어업시험선어업지도선어로감시선어로감시선어업조사선어업실습선

fishing boat어로장어구어로등낚시대판어업제한어선덧댐판핵분열 fission핵분열계수관핵분열생성물

Fire Safety Systems (FSS) code

fire slice       fire station     fire tube boiler fire wire       fireboat firebrick      

fireman's outfit       fireproof bulkhead      fireproof test 

fire-smothering gas    firing order    firing point     firing pressure firing rod      firing shovel   first bower anchor    first coat       

1등기관사 first engineer  1등항해사 first mate      단면1차모멘트1등항해사 first officer    

fir-tree blade  fish carrier    fish eye fish finder     fish hold       fish meal factory ship  fish well       fisheries examination boat      fisheries guidance boat      fisheries inspection boat       fisheries patrol boat    fisheries research boat fisheries training boat  어선fishing chief   fishing gear    fishing light    fishing platform fishing restriction      fishing vessel  fishplate       

fission counter fission product 

Page 90: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

핵분열수율맞춤 fit완성공완성공장부착물 fitting의장 fitting부착길이 fitting length선구고의장부두완성공장선행부착 fit-up공간고정축고정식갑판포말장치 fixed deck foam system고정단 fixed end고정단모멘트 fixed end moment 고정식화재탐지장치 고정식소화장치고정식가스시료채취관장치 fixed gas sampling system

고정식가스경보장치 fixed gas warning system고정식크레인고정지그 fixed jig고정원형창고정라이너불휘발성기름고정식거리눈금고정식거리눈금고정식드래그헤드고정식 사수소화장치

fixture기상자기상자편의치적 flag of convenience기서랍기국 flag state흰반점플레이킹 flaking불꽃조정불꽃어닐링불꽃막이불꽃청소불꽃심불꽃절단 flame cutting불꽃절단자국 flame cutting flash불꽃꺼짐 flame failure불꽃홈파기불꽃경화불꽃절삭플레임플레이너화염판화염전파난연성 flame retardant난연성전선난연성재료내연소시험

fission yield    

fitter   fitter's shop  

fitting locker   fitting out basin fitting shop    

fixed axes     

fixed fire detection systemfixed fire-extinguishing system

fixed jib       

fixed light     fixed liner     fixed oil       fixed range marker    fixed range ring       fixed type drag head   fixed water fire-extinguishing system고정구flag chest      flag locker     

flag rack       

flakes  

flame adjustment       flame annealing flame arrester flame cleaning flame cone     

flame gouging  flame hardening flame machining flame planer   flame plate     flame propagation      

flame retardant cable  flame retardant material flame retardant test on bunched cables

Page 91: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

화염스카핑화염차폐그물망 flame screen방폭기기 flame-proof apparatus

방폭격벽등방폭천장등 flame-proof ceiling light폭발등급가연성 flammable가연성가스 flammable gas가연성가스 탐지기 flammable gas detector가연성액체창고 flammable liquid locker인화성가스 flammable mixture가연성 증기 flammable vapor플랜지 flange면재 flange플랜지커플링플랜지이음플랜지브래킷플랜지끝용접끝꺾음판플랜지기계플랜지품질플랜지시험플랩 flap덮개문나비형밸브플레어 flare플레어각 flare angle플레어형유니언불꽃플레어 flaring확관시험 flaring test인화점인화점시험기역화섬광등 flashing light

거대선표시등위험물적재선박표시등섬광신호섬광비틀림동력계인화점평판 flat평강 flat bar평강격자평강일반보강재평저 flat bottom선수선저평편부 flat bottom forward area평면끌평철평판베이스 flat panel base하향용접 flat position welding평강플랫밸브하향용접편평도 flatness

flame scarfing  

flame-proof bulkhead light     

flame-proof grade     

flange coupling flange joint    flanged bracket flanged edge weld     flanged plate   flanging machine       flanging quality flanging test   

flap door       flap valve      

flare type union flare-up light  

flash point     flash tester    flashback      

flashing light for huge vessel  flashing light for vessel carrying dangerous cargo flashing light signal    flashing light torsion meter     flashing point  

flat bar grating flat bar ordinary stiffeners

flat chisel      flat iron 

flat steel       flat valve      flat welding     

Page 92: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

편평시험흠탐지기선대 fleet선대보험 fleet insurance선단경기 fleet race플레트너식 타유연성 flexibility유연베어링유연성전선유연성전선유연연결플렉시블호스플렉시블조인트유연 생산체계플렉시블 거치 flexible mounting플렉시블관 flexible pipe플렉시블관이음플렉시블축유연날개 flexible wing굽힘강성비행갑판 flight deck연직변위각플린더스바장치플로트 float부양이탈진수플로트게이지 float gauge플로트액면계float on/off ship공정여유시간 float time플로트트랩플로트 밸브 float valve플로터 floater유동도르래부유체 floating body기중기선부양식 독유동축받이베어링부유잔교유동레버

콘크리트믹서부선부분진수 floating out부유잔교부유식생산설비선부유식생산저장하역설비선유동링부표신호부유식저장하역설비선부유식저장재기화설비선부유식저장설비선침수 flood수문

flood light침수성 floodability

flattening test  flaw detector  

Flettner's rudder     

flexible bearing flexible cable  flexible cord   flexible coupling       flexible hose   flexible joint   flexible manufacturing system

flexible pipe joint      flexible shaft   

flexural rigidity   

flight path angle       Flinders bar    

float free launching    

float level gauge       플로트 온/오프 선float trap      

floating block  

floating crane  floating dock   floating frame bearing  floating landing stage  floating lever  floating mixing plant barge     

floating pier    Floating Production Unit (FPU)Floating Production, Storage and Off-loading (FPSO) unitfloating ring    floating sign   Floating Storage and Off-loading (FSO) unitFloating Storage Regasification Unit (FSRU)Floating Storage Unit (FSU)

flood gate      투광등

Page 93: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

가침장침수상태침수 flooding침수계산침수수위 flooding level침수관침수시험침수시간 flooding time늑판 floor현도못바닥판 floor plate바닥판받침늑재목플루어링플로틸러리더흐름 flow흐름도표 flow chart유량계수유동제어 flow control흐름도표 flow diagram유동플럭스 flow fluxflow measurement유량계유동가공방식유량유동상태범람방법 flow through method유동위상 flow topology

유동가시화장치연도 flue연도가스 flue gas연도가스분석연도가스소화장치유체 fluid

fluid borne noise액체나침반유체커플링액체소화기유입각액면레벨 fluid level유출각형광등형광페인트 fluorescent paint평갑판 flush deck평갑판선 flush deck ship평갑판선평갑판선평면필릿용접접시머리리벳평갑판구 flush scuttle평면판붙임평면용접플러싱플럭스 flux조수간만 flux and reflux

floodable length flooded condition       

flooding calculation     

flooding pipe   flooding test   

floor pin       

floor plate bearer      floor timber    flooring flotilla leader  

flow coefficient 

유량측정flow meter     flow pattern    flow rate       flow regime    

flow visualization installation

flue gas analysis       flue gas fire extinguisher      

유체전달소음fluid compass  fluid coupling  fluid fire extinguisher  fluid inlet angle   

fluid outlet angle       fluorescent lamp       

flush deck vessel      flush decker   flush fillet weld flush head rivet 

flush system   flush weld     flushing 

Page 94: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

플럭스석면뒷댐법flux cored arc welding용융제분사식절단비행정최상층선교 flying bridge최상층선교갑판플라잉지브플라잉패시지비행갑판플라이휠 flywheel플라이휠펌프포말방사기거품 캐비테이션foam concentrate supply포말 소화기

포말소화장치터릿노즐포말원액포말분사장치 foam monitor포말스프링클러푀팅거수력커플링안개종안개호각분무노즐안개신호무중표적날개폭포일스트레인게이지접는세면대추종제어추종장치순조류 following current

following operation선미파 following sea반류순풍구난식량 food ration음식쓰레기 food wastes풋 벨트 foot belt풋 로프풋 밸브발판강제맞춤압상펌프강제순환 forced circulation강제통풍 팬 forced draft fan강제통풍아궁이강제 송풍로 forced draft trunk강제윤활강제윤활기강제동요장치강제횡동요강제진동종돛장치 fore and aft rigged

Flux Asbestos Backing (FAB) method플럭스 코어드 아크 용접flux injection cutting   flying boat     

flying bridge deck      flying jib       flying passage flying-off deck 

flywheel pump foam applicator foam cavitation 포말 원(농축)액 공급foam extinguisher   foam fire extinguishing system foam gun      foam liquid     

foam sprinkler Foettinger hydraulic coupling   fog bell fog horn       fog nozzle     fog signal      fog target      foil span       foil strain gauge       folding lavatory follow up control       follow up mechanism   

후속공정following wake following wind 

foot rope      foot valve      늦추기 footing footstep force fit       force pump    

forced draft front      

forced lubrication      forced lubricator       forced oscillator       forced rolling  forced vibration 

Page 95: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

종범선종통재세로돛종돛스쿠너창구덮개받이종통재선수블록 fore block선수방사형늑골선수구조도 fore construction예냉기포어코스선수데드우드용골단부전부선창최선수 fore peak선수수선 fore perpendicular (FP)선수포핏포어톱갤런트마스트선체전반부선수루 forecastle선수루후단격벽선수루갑판선수루현측외판

foreign matter포어록직장선수마스트 foremast선수격벽선수피크탱크앞돛포어시트앞당김줄앞당김줄돛포어톱마스트foreward풀무단접단강단조 forging단조해머단조기단조비단조공장가압테르밋쌍발끝포크 판 fork plate지게차 forklift truck

형상흘수형상계수형상건현형상저항공식안전평가

forming 포뮬러 급 formular class

fore and aft rigged vessel     fore and aft runner    fore and aft sail       fore and aft schooner  fore and afters 

fore cant frame 

fore cooler     fore course    fore deadwood fore foot       fore hold       

fore poppet    fore top gallent mast   forebody       

forecastle bulkhead    forecastle deck forecastle side plate   이물질forelock foreman 

forepeak bulkhead     forepeak tank  foresail foresheet      forestay forestaysail    fore-topmast   선수방향forge and bellow forge welding  forged steel    

forging hammer forging machine forging ratio   forging shop   forging thermit fork end       

form draft     

form factor    form freeboard form resistance Formal Safety Assessment(FSA)성형

40피트컨테이너 등가적재량 Forty-feet Equivalent Unit (FEU)

Page 96: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

앞으로굽은날개선수흘수선수수선 forward perpendicular (FP)앞쪽스퍼드선미관전부실링유냉각기선미관전부실링유펌프선미관전부실링유탱크전부선루 forward superstructure전진용접닻줄엉킴오손거치볼트주물공장

네바퀴도르래푸리에변환 Fourier transform부분범장 fractional rig부분범장 슬루프 fractional sloop다단계 방법 fractional step method프랙토그래피 fractography 파괴 fracture파단면파단면시험파괴인성값늑골 frame늑골재늑골정면도늑골브래킷늑골세우기늑골선늑골라이너늑골단면계수늑골번호늑골단면늑골간격늑골재정보흐름 체계늑골정면도제일수늑골방식 framing system자유굽힘 free bend자유굽힘시험 free bend test

자유굽힘시험편자유감쇠시험 free decay test자유변 free edge자유낙하진수자유유동면적 free flow area자유기체함유량수출항 본선인도 가격 Free On-Board (FOB)자유동요자유항자유회전프로펠러자유음장

forward curved vane   forward draft  

forward spud   forward stern tube sealing oil coolerforward stern tube sealing oil pumpforward stern tube sealing oil tank 

forward welding foul anchor    fouling foundation bolt foundry 

4행정디젤기관 four cycle diesel engine 4점방위법 four point bearing      

four-fold block 

fracture surface fracture test   fracture toughness     

frame bar      frame body plan       frame bracket  frame erection frame line      frame liner     frame modulus frame number  frame section  frame space   frame timber   framework of information flowframing body plan      framing number 

free bend test specimen       

free fall launching      

free gas content       

free oscillation free port       free rotating propeller free sound field 

Page 97: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

자유유선흐름자유수면 free surface자유수면효과 free surface effect자유수면유동 free surface flow자유진동자유소용돌이자유수 free water자유수면효과건현 freeboard건현지정건현폭건현갑판건현길이만재흘수선표지건현비건현규칙자유낙하식 구명정 free-fall lifeboat

공기자급식자유낙하식구명정방수구냉동선냉동실빙점 freezing point

냉동실냉동고화물콘테이너 freight container운임률운임계산중량톤 freight ton프레온가스주파수 frequency진동수 frequency빈도 frequency주파수밴드주파수변환기주파수필터주파수계주파수변조주파수분해능주파수응답 frequency response

주파수응답함수주파수보정레벨생식품청수여과기조수장치해수펌프조수장치순환펌프조수장치증류수펌프조수장치이젝터펌프조수장치

free streamline flow   

free vibration  free vortex    

free water effect       

freeboard assignment  freeboard breadth      freeboard deck freeboard length       freeboard mark freeboard ratio freeboard rule 

free-fall lifeboat with a self-contained air support systemfreeing port    freezing carrier freezing chamber       

freezing room  freezing store  

freight rate    

Freon  

frequency band frequency changer     frequency filter frequency meter       Frequency Modulation (FM)frequency resolution   

Frequency Response Function(FRF) frequency weighted sound level fresh provision fresh-water filter      fresh-water generator brine pump fresh-water generator circulating pumpfresh-water generator distillate pumpfresh-water generator ejector pumpfresh-water generator  

Page 98: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

청수가열기청수압력탱크담수만재흘수선청수압력탱크청수펌프청수여과기청수탱크프레팅부식 fretting corrosion마찰 friction마찰브레이크마찰클러치마찰계수 friction coefficient마찰수정마찰커플링마찰저항감소 friction drag reduction마찰수두 friction head마찰손실마찰톱마찰교반용접마찰반류마찰바퀴마찰저항 frictional resistance

마찰저항계수호위함 Frigate (FF)프리깃선전단격벽앞기둥정면도전단필릿용접전부헤더거품일기프루드수프루드의 상사법칙 Froude's similitude냉동화물냉동육류프륄링형드래그헤드과일운반선연료 fuel핵연료집합체핵연료피복 fuel canning핵연료피복재연료소비량 fuel consumption연료소비량시험연료조절핸들연료차단장치 fuel cut-off device연료절약핵연료체연료가스핵연료취급캐스크연료분사펌프연료분사밸브연료유 fuel oil조연제주입펌프조연제탱크연료유블랜더장치

fresh-water heater     fresh-water hydrophore tank   fresh-water load line   fresh-water pressure tank      fresh-water pump      fresh-water strainer    fresh-water tank       

friction brake  friction clutch  

friction correction      friction coupling 

friction loss    friction saw    Friction Stir Welding (FSW)friction wake   friction wheel  

frictional resistance coefficient 

frigate ship    front bulkhead front column   front elevation front fillet weld front header   frothing Froude number 

frozen cargo   frozen meat    Fruhling type drag head fruit carrier    

fuel assembly  

fuel canning material   

fuel consumption test  fuel controlling handle 

fuel economy  fuel element   fuel gas fuel handling cask      fuel injection pump     fuel injection valve     

fuel oil additive pump  fuel oil additive tank   fuel oil blender 

Page 99: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

연료유가압펌프연료유중간탱크분연펌프연료유전환시험연료유순환펌프연료유소모량 fuel oil consumption연료유분배함연료유드레인탱크연료유여과기연료유중력탱크연료유넘침탱크연료유관연료유전처리시스템시동연료펌프연료유청정기연료유리턴체임버 fuel oil return chamber연료유리턴탱크연료유서비스관연료유서비스펌프연료유서비스탱크 fuel oil service tank연료유슬러지탱크연료유여과기연료유공급펌프연료유탱크 fuel oil tank

연료유탱크비상차단밸브연료유이송관연료유이송펌프연료유펌프 fuel pump연료재처리연료차단장치 fuel shut-off device연료분무 fuel spray연료밸브 fuel valve

연료밸브냉각청수냉각기연료밸브냉각청수펌프연료밸브냉각청수탱크연료밸브냉각유냉각기연료밸브냉각유펌프연료밸브냉각유탱크연료분사밸브 래핑공구연료분사밸브 시험장치풀크럼축전속후진 full astern만재흘수 full draft만선장식완전필릿용접만재 full load전부하 full load전하중 full load

fuel oil booster pump  fuel oil buffer tank     fuel oil burning pump  fuel oil change over test       fuel oil circulating pump       

fuel oil distributing box fuel oil drain tank      fuel oil filter   fuel oil gravity tank    fuel oil overflow tank  fuel oil pipe    fuel oil pretreatment system   fuel oil priming pump  fuel oil purifier 

fuel oil return tank       fuel oil service pipe    fuel oil service pump  

fuel oil sludge tank   fuel oil strainer fuel oil supply pump   

fuel oil tank emergency shut-off valve fuel oil transfer pipe   fuel oil transfer pump  

fuel reprocessing      

fuel valve cooling fresh water cooler  fuel valve cooling fresh water pump   fuel valve cooling fresh water tank    fuel valve cooling oil cooler    fuel valve cooling oil pump    fuel valve cooling oil tank     fuel valve lapping tool fuel valve testing device   fulcrum shaft   

full dressing ship      full fillet weld  

Page 100: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

만재적하상태 full load condition

전부하전류 full load current

만재배수량만재흘수완전용입용접 full penetration weld 전출력 full power전출력시운전최대정격출력 full rated power전회전 용골 full rotate keel현척 full scale중구선전선구조해석full size현척현도전속중용접다듬이다듬이표토풀리그드선

실선 및 모형선자료완전평형타완전캐비테이션프로펠러완성캐비티만재 fully loaded압력식가스운반선연무배출 fume extraction

fumigation연돌 funnel자연통풍연돌비상차단장치연돌마크노통 furnace노브레이징노천장노통변형측정기노아궁이문노앞면노게이지노앞면노용적퍼링퓨즈 fuse퓨즈판퓨즈상자퓨즈스위치가융합금가융합금가융플러그 fusible plug용해용접융합부

full load displacement  full load draft      

full power trial 

full scantling vessel    full ship structural analysis현척full size mold full speed      full welding    fuller  fullering tool   Fuller's earth full-rigged ship full-scale and model test datafully balanced rudder   fully cavitating propeller       fully developed cavity  

fully pressurized gas carrier

훈증소독funnel draft    funnel emergency shut-off devicefunnel mark    

furnace brazing furnace crown furnace deformation indicator  furnace door   furnace front   furnace gauge  furnace mouth furnace volume furring 

fuse board     fuse case      fuse switch    fusible alloy    fusible metal   

fusion welding fusion zone    

Page 101: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

퍼턱 futtock퍼턱리깅개프 gaff개프 리그 gaff rig개프캣개프커터개프슬루프개프욜gaff schooner riggaff sloop이득 gain이득조정갤러킨기법 Galerkin method난간 gallerygalley갤리선갤러웨이튜브갤로스전식작용 galvanic action이종금속간부식 galvanic corrosion아연도금 galvanize아연도금강아연도금감마선검사갱현문 gangway 보도다리현문돌쩌귀현측사다리현문등현문갠트리크레인간격효과폐기물배출구 garbage chute폐기물기록부 garbage record book가스분석기가스풀림가스브레이징가스운반선 gas carrier가스크로마토그라피 gas chromatography가스용석탄

가스농도계측기기체함유량 gas content

포화액기체함유량가스절단가스탐지장치 gas detection system가스탐지기가스이젝터가스기관가스프리 gas free가스프리팬가스발생로가스가우징가스마스크가스측정 gas measurement가스금속 아크용접 gas metal arc welding

futtock rigging 

gaff rigged cat gaff rigged cutter      gaff rigged sloop       gaff rigged yawl       개프·스쿠너 범장개프·범장gain control   

조리실galley  Galloway tube  gallows 

galvanized steel galvanizing     gamma ray inspection  gang   

gangway bridge gangway hinge gangway ladder gangway light  gangway port  gantry crane   gap effect      

gas analyzer   gas annealing  gas brazing    

gas coal       gas concentration measurement instrument  

gas content of the saturated liquidgas cutting     

gas detector   gas ejector    gas engine     

gas free fan   gas generator  gas gouging    gas mask      

Page 102: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

가스감시기가스 유 gas oil가스관가스압력용접가스발생기 gas producergas purging가스제거장치가스채취관 gas sampling pipe가스실드가스표가스성분검사 gas testing가스토치가스트라이얼가스텅스텐아크용접 gas tungsten arc welding가스터빈 gas turbine가스터빈선가스배기관가스경보장치가스용접가스연료 gaseous fuel가스화개스킷가솔린기관가스차폐 아크용접 gas-shielded arc welding기밀 gastight기밀격벽기밀문기밀조명등 탕구 gate

압탕문형전단기게이트밸브게이지 gauge

gauge board게이지계수수면계유리 gauge glass수면계유리보호장치표점간거리표점계기용 관게이지시험기거즈소독기가는눈철망기어커플링 gear coupling기어 펌프 gear pump톱니수의 비 gear ratio기어휠기어드디젤기관기어드트롤리전동장치가이스링거커플링 Geislinger coupling비상경보일반배치도 general arrangement

gas monitor    

gas pipe       gas pressure welding  

가스정화gas removal equipment 

gas shield      gas table       

gas torch      gas trial       

gas turbine ship gas vent pipe  gas warning system    gas welding    

gasification     gasket gasoline engine 

gastight bulkhead      gastight door gastight lighting enclosure

gate riser      

gate shear     

gate valve     

계기판gauge factor   

gauge glass protector  gauge length   gauge mark    gauge pipe     gauge tester   gauze sterilizer gauze wire     

gear wheel     geared diesel engine   geared trolley  gearing 

general alarm  

Page 103: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

기관실전체배치도공동해손일반화물 general cargo일반화물선 general cargo ship총비상경보 general emergency alarm일반의장공사 general outfitting 일반무선통신 잡용공기관잡용펌프잡용증기관일반저장자재 general stock item일반공구발전장치발전선증발관발전기 generator

발전기용 기관청수냉각기발전기용 기관냉각청수펌프발전기용 기관냉각해수펌프발전기용 기관연료유가열기발전기용 기관윤활유침전탱크발전기용 기관윤활유저장탱크발전기용 기관윤활유섬프탱크제작기준선발전기실발전기용 증기터빈복수기발전기용 증기터빈직선모선일반화 모델 generic model유전 알고리즘 genetic algorithm

전자해류계기하학적부정확 geometric inaccuracy형상흘수형상건현기하학적응력집중계수형상 geometry지문항법상사모형독일선급 Germanischer Lloyd (GL)살균램프 germicidal lamp분비작용머리달린키기그 gig유자망어선짐벌 gimbal짐벌이음

general arrangement of engine roomgeneral average 

general radio communicationgeneral service air pipe  general service pump  general service steam pipe     

general tools   generating set generating ship generating tube 

generator engine cooling fresh water cooler    generator engine cooling fresh water pump    generator engine cooling sea water pump      generator engine fuel oil heater generator engine lubricating oil settling tank   generator engine lubricating oil storage tank   generator engine lubricating oil sump tank     generator line  generator room generator steam turbine condensergenerator steam turbine    generatrix      

geomagnetic electrokinematograph

geometrical draft    geometrical freeboard  geometrical stress concentration factor

geo-navigation geosim 

geyser action  gib-headed key 

gill netter      

gimbal joint    

Page 104: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수평유지기구 Gimbals mechanism진블록거더 girder거더블록거더간격거더스테이거더구조거스 girth 거스길이패킹누르개 gland글랜드패킹 배기송풍기글랜드패킹 누설증기관글랜드패킹 실증기관글랜드패킹 복수기유리섬유 glass fiber

유리섬유강화플라스틱선유리창틀유리수면계유리섬유 glass wool

유리섬유보온재유리직물진입각지시등전체변위벡터 global displacement vector

전세계 해상조난 및 안전 시스템위성항법시스템전체강도 global strength전선진동해석 global vibration analysis글로브밸브 globe valve용융금속방울옹이후진목적기반기준 Goal Based Standards (GBS)보호안경황금분할탐색 Golden section search골리아스크레인동라 gong징부표표시등붙이징전파방위계화물차량 goods vehicle구즈넥 gooseneck구즈넥브래킷구즈넥 통풍통 gooseneck ventilator구멍끌가우징 gouging조정플런저조속기 governor조속장치조속기모터그랩 grab그랩버킷 grab bucket

gin block      

girder block    girder space   girder stay     girder work    

girth length    

gland exhaust fan      gland leak-off steam pipe      gland sealing steam pipe       gland steam condenser 

glass fiber reinforced plastic shipglass holder    glass water gauge     

glass wool heat insulating materialglass woven fabric     glide slope indicating lamp     

Global Maritime Distress & Safety System (GMDSS)Global Positioning System(GPS)

globule gnarl   go astern      

goggles 

goliath crane   

gong buoy     gong with a pilot lamp goniometer     

gooseneck bracket     

gouge  

governing plunger      

governor gear  governor motor 

Page 105: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

그랩버킷식리클레이머그랩준설선그랩히치그레이더선기울기기반 최적화법

gradual failure눈금 graduation입자 grain낱알용적낱알화물 grain cargo낱알화물용량곡물운반선대형블록조립 grand-block joining입자코르크도식법도시패널그래픽 심볼 graphic symbol도식법그래픽사용자인터페이스흑연 graphite흑연패킹흑연페인트흑연화 graphitization네발닻불격자면적불격자봉격자 grating격자받침건식 독중력가속도중력식 아크용접 gravity arc welding중력식대빗중력주입량중력식탱크 gravity tank

중력식탱크급수방식중력파회선철그리스제거기그리스주입구 grease nipple그리스펌프 grease pump대권 great circle대권항법오대호형 산적화물선근해구역근해구역선우현등그린파랑하중 green sea그린파랑하중 green sea forces그린파랑하중온실가스 greenhouse gas

grid격자 grill선객식당

grab bucket type reclaimer     grab dredger     grab hitch      grader vessel  gradient-based optimization method열화고장grain capacity  

grain cargo capacity   grain carrier   

granulated cork graphic method graphic panel  

graphical method       Graphical User Interface(GUI) graphite packing graphite paint  

grapnel anchor grate area     grate bar      

grating bearer graving dock   gravitational acceleration       

gravity davit   gravity injection flow rate

gravity tank water service systemgravity wave   gray pig iron   grease extractor       

great circle sailing     Great Lake type bulk carriergreater coasting area  greater coasting vessel green light     

green water    

격자grill room      

Page 106: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

그릴리지해석 grillage analysis격자구조그라인더연마기홈 groove홈각도홈용접홈파기 grooving암수꼴이음홈파기기계총적량총 제공 두께 gross offered thickness총 부재치수 gross scantling총 두께 gross thickness제공총두께 gross thickness offered요구총두께 gross thickness required총톤수 Gross Tonnage (GT)접지 ground선체연결체인검루기대지속력정박용구좌초다섬광등다명암등전동기종합기동반 group starter panelGT No.96 type membrane보증기사guarantee period보증속력guarantee work보호봉보호판보호난간 guard rail경보눈금환거전 gudgeon거전핀적용지침 guidance안내봉굽힘시험지그틀굽힘시험안내날개슬라이드블록안내면가이드라인텐셔너가이드 피스 guide piece안내판안내풀리안내롤러슬라이드블록슬라이드블록유도깃 guide vane

틀절단장치유도탄탑재 순양함유도탄탑재 구축함유도탄탑재호위함

grillage construction   grinder grinding machine       

groove angle   groove weld   

grooving and tonguing grooving machine      gross capacity 

ground chain   ground detector ground speed  ground tackle  grounding      group flashing light    group occulting light   

GT96형식 멤브레인guarantee engineer     보증기간guarantee speed       보증공사guard bar      guard plate    

guard ring     

gudgeon pin    

guide bar      guide bend jig guide bend test guide blade    guide block    guide face     guide line tensioner    

guide plate     guide pulley    guide roller    guide shoe     guide slipper   

guided cutting apparatus       Guided Missile Cruiser (CG)Guided Missile Destroyer (DDG)Guided Missile Frigate (FFG)

Page 107: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

판절단기 guillotine포금포좌포보호판포지지대건태클포함건다이오드거널포수통로거널 gunwale현단 gunwale거널형강거널탱크거싯형강거싯판거싯버팀돌풍거터형강거터 바 gutter bargutter pipe거터배수로가이 guy가이윈치gybing운동실체인홈바퀴자이로컴퍼스 gyrocompass자이로컴퍼스 리피터자이로컴퍼스실회전수도시기자이로파일럿자이로스코프자이로작용자이로안정기

갑판시계미세균열반보반매듭반쪽모형반주기 half period반환봉 half round bar반속 half speed반폭선도반늑판반감기반원단면강평저부반폭하프스퍼드형와이어가이드장치하프타인형그래브버킷핼리어드상하양부문마룻줄함부르크커스텀등해머마감질

gun metal      gun platform   gun shield     gun support    gun tackle     gunboat Gunn diode       gunnel gunner's bridge       

gunwale angle  gunwale tank   gusset angle   gusset plate    gusset stay    gust   gutter angle    

배수관gutter water way      

guy winch     돛돌리기 (자이빙)gymnasium     gypsy wheel   

gyrocompass repeater     gyrocompass room gyrograph      gyropilot      gyroscope      gyroscopic action      gyrostabilizer  에이치(H)벤드 H bend hack watch    hair crack      half beam      half hitch      half model     

half-breadth plan       half-floor frame   half-life half-round bar steel   half-siding     half-spud type wire guide device      half-tine type grab bucket     halliard halved door    halyard Hamburg custom light  hammer dressing       

Page 108: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

해머헤드크레인전기점화단접해머시공리벳타격식쇄석기해머링시험해먹수동빌지펌프수동드릴 hand bore machine수동급탄수기 hand flag수기신호신호홍염 hand flare수동장치손구멍수동지그 hand jig측심추핸드로그수동펌프 hand pump핸드리베팅핸드스파이크수동조타장치수동급탄손회전계수동용접손잡이 handhold난간 handrail난간지주핸디막스 handy-max핸디사이즈 handy-size핸디급 산적화물선 handy-size bulk carrier격납고 hangar비행기격납고hanger point매달린나침반행잉니현수식 타항구 harbor항만 harbor 항내상태 harbor condition하버갑판항세항내제한속력항장항박도항만레이더항만규칙대피정박지항내속력강체요소 hard corner하드오버하드패치전타좌회전경화보호도장 hard protective coating전타우회전담금강담금질 hardening경도 hardness

hammer head crane    hammer spark ignition hammer welding       hammered point rivet  hammering rock breaker       hammering test hammock       hand bilge pump       

hand firing     

hand flag signal 

hand gear      hand hole      

hand lead      hand log       

hand riveting   hand spike     hand steering gear     hand stroking  hand tachometer       hand welding   

handrail stanchion      

hangar shed    지지점hanging compass       hanging knee  hanging rudder 

harbor deck    harbor dues    harbor limit speed     harbor master  harbor plan    harbor radar   harbor regulation       harbor shelter  harbor speed   

hard over      hard patch     hard port      

hard starboard hardened steel 

Page 109: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

hardness test위해 harm 유해물질 harmful substance조화곡선도하핀포경포걸쇠 hasp해치 hatch해치바해치배튼해치빔해치덮개판창별화물목록창구측면종통재해치바해치클리트창구코밍창구덮개무개형컨테이너창구단보창구끝연재창구격자해치로킹바창구구멍창구덮개판받침해치링창구옆코밍창구옆거더해치타폴린해치쐐기손도끼화물창구 hatchway창구코밍 hatchway coaming홀링캐리지홀링머신호저파이프호저팀버호저 hawser호저드럼호저홀 hawser holes호저릴위해성 hazard위해성분석 HAZard Analysis (HAZAN)

위해성 및 운전성위해성식별 위험위치 hazard location

유해위험물질위험구역 hazardous area위험물질 hazardous substance

H-beam수두 head헤드 보드 head board창구끝연재헤드라인윈치바우라인

경도시험harmonic diagram      harpin  harpoon gun   

hatch bar      hatch batten   hatch beam    hatch board    hatch cargo list hatch carline   hatch clamping beam   hatch cleat     hatch coaming hatch cover    hatch coverless container      hatch end beam hatch end coaming     hatch grating   hatch locking bar      hatch opening  hatch rest      hatch ring      hatch side coaming    hatch side girder       hatch tarpaulin hatch wedge   hatchet 

hauling carriage hauling machine hawse pipe    hawse timber  

hawser drum   

hawser reel    

HAZard and OPerability (HAZOP)HAZard IDentification (HAZID)

hazardous and noxious substances

에이치(H)형강head ledge     head line winch head line       

Page 110: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수두수두펌프최대정지거리헤드로프선수파 head sea선수좌판헤드시트주방장송출밸브역풍 head wind헤더 header헤더판선수 및 항적조정장치 침로각 heading angle진행방향 수정계수 heading correction factor선수선선수선선수선선수선

headroom선수상방표시 head-up

던지기 줄 hearing line하트불판열영향부열평형 heat balance열평형선도 heat balance diagram열용량열전도heat conductivity열용량열감지기열낙차열기관열교환기보온판보온시멘트보온재보온매트리스열절연열부하열복사열소비율열회수축열식열교환기열발생열제거 heat removal내열성페인트 heat resistant paint열간교정 heat straightening히트트레이스열전달 heat transfer열전달률열처리난방기난방장치

head of water  head pump     head reach     head rope      

head seat      head sheet     head steward  head valve     

header plate   heading and track control system

heading flash  heading indicator       heading line    heading marker 상부공간

보건·안전·환경 Health, Safety and Environment (HSE)

heart   hearth Heat Affected Zone (HAZ)    

heat capacity  heat conduction 열전도도heat content   heat detector  heat drop      heat engine    heat exchanger heat insulating board   heat insulating cement heat insulating material heat insulating mattress heat insulation heat load      heat radiation  heat rate       heat recovery  heat regenerator       heat release   

heat trace     

heat transfer rate      heat treatment heater heating arrangement   

Page 111: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

난방보일러가열코일 heating coil가열코일점화기가열불꽃예열구heating method전열면난방방식가열토치 heating torch

공기조화히트싱크 heat-sink상하동요 heave최저속력안전운항히빙라인헤비 밸러스트 상태 heavy ballast condition중량화물 heavy cargo중량물운반선대형주물중순양함중갑판선중갑판선중량물데릭 heavy derrick중량물데릭붐헤비데릭장치대형단조품중질유 Heavy Fuel Oil (HFO)중질유청정기중질유저장탱크중질유침전탱크중질유탱크 Heavy Fuel Oil Tank (HFOT)

중질유이송펌프중량물운반선 heavy lift cargo ship중량물운반선중질유 heavy oil중질유기관황천묘박중용접횡경사 heel힐거전힐디스크힐거전힐니힐피스힐핀틀경사상태힐링펌프헬리아크용접나선각나선기어나선형스프링나선면헬기항모 Helicopter Carrier (CVH)

헬리콥터갑판조명등

heating boiler  

heating coil igniter     heating flame  heating gate   가열방법heating surface heating system 

Heating, Ventilating and Air Conditioning (HVAC)

heave-to       heaving line    

heavy cargo ship       heavy casting  heavy cruiser  heavy deck vessel     heavy decker  

heavy derrick boom    heavy derrick rigs     heavy forging  

heavy fuel oil purifier  heavy fuel oil service tank     heavy fuel oil settling tank     

heavy fuel oil transfer pump   

heavy lifter    

heavy oil engine       heavy sea anchoring   heavy welding 

heel brace     heel disc       heel gudgeon  heel knee      heel piece     heel pintle     heeled and trimmed conditionheeling pump  heliarc welding helical angle   helical gear    helical spring  helicoidal surface      

helicopter deck surface flood light

Page 112: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

헬리콥터갑판 helideck타륜 helm타각 helm angle

보침타각타각지시기조타명령조타위치 helm position헬멧 helmet

헬멧형잠수호흡기조타수 helmsman반타원형경판 hemi-elliptical end plate반구 hemispherical대마심대마로프헤링본기어

Hertz (Hz)체험적지식 heuristic knowledge육각머리 볼트 hexagon head bolt육각렌치 hexagon wrench

계층별입력처리출력표계층도표고합금강고탄소강고사이클피로 high cycle fatigue고밀도 화물 high density cargo 고압가스압축기 high duty gas compressor

고팽창 포말 소화 장치고화재위험구역 high fire risk area

고주파발전기고주파전동발전기고파지력앵커 high holding power anchor고양력타 high lift rudder

고압급수가열기고압증기관고압터빈고위해수흡입밸브

high stress zone 상부흡입구 high suction상부흡입밸브고온청수냉각기고온냉각청수펌프고온냉각수시스템고온부식고압점화만조고티탄계

helm angle for course keeping helm indicator  helm order     

helmet type diving apparatus   

hemp core     hemp rope     herringbone gear       주파수

hierarchy and input-process-output chart(HIPO) hierarchy chart high alloy steel high carbon steel      

high expansion foam fire-extinguishing system

high frequency generator       high frequency motor generator 

high pressure feed water heater   high pressure steam pipe      high pressure turbine  high sea suction valve 고응력부high suction valve     high temperature cooling fresh water cooler   high temperature cooling fresh water pump    high temperature cooling water systemhigh temperature corrosion     high tension ignition   high tide       high titanic type       

Page 113: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

고속배출장치고점성유체 high viscous fluid내전압시험 high voltage test만조 high water고수위경보 high water level alarm고장력강 higher strength steel고장력강 higher tensile steel고스큐프로펠러고응력영역 highly stressed area

고속선 high-speed craft

고속선안전증서고속내연기관고속여객선 high-speed passenger ship고속회전속력계힌지 hinge

여닫이문현창안쪽덮개 hinged inside deadlight경첩이음경첩식타유사실적선자료호브호빙기계호깅호이스트호이스팅드럼올림속력선창내장재창내보창내격벽창내용적창내디프탱크창내늑골창내내용골창내사다리화물질량곡선 hold mass curves창내기둥창내기둥창내종통재스트링거화물창점검대 hold watching step창내물고임통홀드백 holdback개방고정용후크 holdback hook홀더지지력 holding capacity거치볼트양묘기유지하중 holding load of windlass파지력뒷댐해머도장누락부 holiday파저 hollow중공날개

high velocity vent      

Highly Skewed Propeller(HSP)

고차 스펙트럴/경계요소법 high-order spectral/boundary element method

high-speed craft safety certificatehigh-speed internal combustion engine 

high-speed tachometer 

hinged door    

hinged joint    hinged rudder  historical data for similar vesselhob    hobbing machine       hogging hoist   hoisting drum  hoisting speed hold batten    hold beam     hold bulkhead  hold capacity   hold deep tank hold frame     hold keelson   hold ladder    

hold pillar      hold stanchion hold stringer   

hold well       

holder 

holding down bolt      

holding power  holding up hammer     

hollow blade   

Page 114: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

중공문파저선중공기둥중공축갑판숫돌균일적하 homogeneous loading벌집형 심재 honeycomb core호닝가공 honing호닝기계차양 hood훅 hook갈고리도르래훅볼트갈고리스카프보강봉 hoop원환응력호퍼 hopper호퍼부선호퍼커버 hopper cover호퍼도어호퍼준설선적재토량계진흙적재통진흙흡입관호퍼탱크 hopper tank수평지시등수평연결수평기관수평필릿용접수평거더수평연결수평면운동시험수평용접수평링 horizontal ring수평 링 프레임 horizontal ring frame수평롤러수평타수평접합

horizontal shaft수평보강재수평진동 horizontal vibration

수평진동방지장치수평파랑굽힘모멘트수평용접경적 horn경적버저 horn buzzer

표시등붙이경적버저혼클리트말굽형추력베어링

hollow door    hollow line     hollow pillar   hollow shaft    holy stone     

honing machine 

hook block     hook bolt      hook scarf     

hoop stress    

hopper barge    

hopper door   hopper dredger hopper load indicator  hopper loading trough  

hopper suction pipe    

horizon indicating lamp horizontal coupling     horizontal engine       horizontal fillet welding horizontal girder       horizontal joint Horizontal Planar Motion Mechanism (HPMM) testhorizontal position of welding 

horizontal roller horizontal rudder       horizontal scarf 수평축horizontal stiffener     

horizontal vibration stopper    horizontal wave bending moment horizontal welding      

horn buzzer with a pilot lamp  horn cleat      horse shoe type thrust bearing 

Page 115: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

코킹끌호스 hose호스연결호스커플링살수기호스감개 hose reel

호스릴윈치호스릴형탄산가스소화기호스받침대 hose rest호스서포트사수시험호스밸브병실 hospital병원선온기난방열기건조소구 hot bulb소구기관소구식점화핫코일 hot coil 고온균열 hot cracking고온균열시험 hot cracking test열간가공 hot forming열간압연강열간압연적열취성평균핫스폿응력 hot spot mean stress핫스폿응력 hot spot stress 온수보일러온수순환펌프온수난방온수관열수처리온수관장치온수조 hot well온수탱크열간가공열간가공 hot-pressed하운드시간각항행시간선주기호버크라프트

허브 hub허브캐비테이션허브지름허브비허브보텍스캐비테이션대형선박표시등 huge vessel light선각 hull선체 hull선체부가물

horsing iron    

hose connection hose coupling  hose director  

hose reel handling winch       hose reel type carbon dioxide fire extinguisher 

hose support   hose test      hose valve     

hospital ship   hot air heating hot air seasoning      

hot bulb engine hot bulb ignition       

hot rolled steel hot rolling     hot shortness  

hot water boiler        hot water circulating pump     hot water heating      hot water pipe hot water process      hot water service system      

hot well tank  hot working    

hound  hour angle     hours underway house flag     hovercraft      에이치(H)형여과기 H-type filter   에이치(H)형여과기 H-type strainer 

hub cavitation  hub diameter   hub ratio       hub vortex cavitation   

hull appendage 

Page 116: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선각공장선체블록건조법

hull block painting선각구조선체처짐선체붙이디스턴스피스선체효율선체의장 hull fitting선체의장공사선형 hull formhull form coefficient선형설계 hull form design선형개발 hull form developmenthull fouling선체거더 hull girder

선체굽힘강도hull girder inertia

선체전단강도선체거더강도 hull girder strength

선체수평굽힘강도선형 hull line선체상태감시장치 hull monitoring system선체고유진동수선체중립면선번

hull openinghull outfit선체평행부선각부재표 hull parts list선체관통부구조도 hull penetration planshull pipinghull preservation선체치수 hull scantling선체횡단면계수선체붙이밸브선체부명세서hull steel선체강도 hull strength선체응력감시장치선체비틀림강도선체비틀림진동선체횡단면 hull transverse section

선체진동대수감쇠율선체진동응답선각중량선체귀선방식

human engineering조습기험프 hump험프저항 hump drag험프속력추종장치허리케인 hurricane

hull assembly shop     hull block construction method선체블록도장hull construction       hull deflection  hull distance piece     hull efficiency  

hull fitting work 

선형계수

선체오손hull girder bending strength    선체거더 단면2차모멘트hull girder shear strength      

hull horizontal bending strength 

hull natural frequency  hull neutral plane      hull number    선체개구선체의장hull parallel part       

선체배관선체보존hull section modulus   hull side valve     hull specification       선각강재hull stress monitoring systemhull torsional strength  hull torsional vibration 

hull vibration logarithmic decrementhull vibration response hull weight     hull-return system     인간공학humidistat      

hump speed    hunting gear   

Page 117: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

허리케인갑판폭풍용등하이브리드기법 hybrid approachhybrid VOF method소화전 hydrant소화전상자소화밸브 hydrant valve유압 hydraulic유압식축압기 hydraulic accumulator유압커플링유압크레인유압실린더유압 준설선 hydraulic dredger유압동력계유압식변속장치유압잭 hydraulic jackhydraulic lift유압기계유압작동유 hydraulic oil유압관유압파워유닛유압피스톤펌프유압발생장치 hydraulic power pack유압프레스수압유압램

유압감속장치유압리베터유압리베팅유압시동장치 hydraulic starting system 유압조타장치유압탱크유압텔레모터 hydraulic telemotor수압시험유압전동장치유압방아쇠유압윈치유체역학적평활면수력학유탄성 응답 hydro elastic response수중조도계

hydro pneumatic test수상비행기hydrochloric acid

동유체전진각동유체력 hydrodynamic force

동유체력성분동유체피치 hydrodynamic pitch

동유체피치각동적수압 hydrodynamic pressure유체동압력 hydrodynamic pressure동유체스핀들토크

hurricane deck hurricane lamp 

하이브리드 VOF법hydrant box    

hydraulic coupling      hydraulic crane hydraulic cylinder      

hydraulic dynamometer hydraulic gear 

고소차hydraulic machine      

hydraulic oil pipe      hydraulic oil power unit hydraulic piston pump  

hydraulic press hydraulic pressure     hydraulic ram  hydraulic reduction gear       hydraulic riveter       hydraulic riveting      

hydraulic steering gear hydraulic tank  

hydraulic test  hydraulic transmission gear    hydraulic trigger       hydraulic winch hydraulically smooth surface   hydraulics      

hydro illuminometer     수압-공기압 시험hydroaeroplane 염산hydrodynamic flow angle       

hydrodynamic force components 

hydrodynamic pitch angle      

hydrodynamic spindle torque

Page 118: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

동유체스핀들토크계수동유체스핀들토크지수유체역학전동유압조타장치수중익 hydrofoil수중익선 hydrofoil craft수중날개단면수소포집기수소시험수로국 hydrographic office수로업무 hydrographic services수로측량하이드로키네터비중계하이드로날륨소수성수중청음장치압력탱크장치 hydrophore unit하이드로플레인하이드로스코프유체정력학적평형 hydrostatic balance배수량등곡선도정수압수압이탈장치정수압시험

hygrometer쌍곡선항법이력손실히스테리시스 아이빔착빙 ice accretion얼음앵커빙대쇄빙선냉장고내빙선규칙 ice class rules쇄빙기빙하탐지레이더 ice detection radar대빙이중외판대빙방현재대빙이중외판빙하중 ice load제빙기유빙감시선빙저항 Ice resistance빙해 ice sea아이스토크쇄빙선 icebreaker부동항제빙능력제빙기대빙구조화물선대빙보강구조

hydrodynamic spindle torque coefficient hydrodynamic spindle torque indexhydrodynamics hydroelectric steering gear     

hydrofoil section       hydrogen collecting apparatus  hydrogen test  

hydrographic survey   hydrokineter  hydrometer    hydronalium    hydrophobic    hydrophone    

hydroplane     hydroscope    

hydrostatic curve      hydrostatic pressure   hydrostatic release unit hydrostatic test  습도계hyperbolic navigation   hysteresis loss hysteresis I-beam 

ice anchor     ice belt ice breaker    ice chamber    

ice crusher    

ice doubling    ice fender     ice lining       

ice making machinery       ice patrol      

ice torque     

ice-free-port  ice-making capacity    ice-making machinery       ice-strengthened cargo vesselice-strengthening construction  

Page 119: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이상받음각이상효율이상유동피아식별기식별부호유동기어무부하운전 idle running

idle time유동바퀴공회전 idling점화성점화기 igniter점화캠점화 ignition발화 ignition소구착화지연착화지연점화플러그발화온도발화원 ignition source발화온도점화시기조정취류등조명 illumination

illumination level침수부최대폭침하쐐기부가상경계법방수복침지시험 immersion test주수대기시간 immersion time국제해사기구 의정서 IMO Resolution

impact analysis

충격경도시험기충격하중 impact load충격시험충격시험기충격렌치임펠러 impeller임펠러상자임펠러상자초기변형 imperfection불투명피복충격부식

implementation budget

외부전원식음극방식장치 충격 impulse충격소음충반동터빈

ideal angle of attack   ideal efficiency ideal flow      Identification Friend or Foe (IFF)identification signal     idle gear       

유휴시간idle wheel     

ignitability     

igniter cam    

ignition ball    ignition delay  ignition lag     ignition plug   ignition point   

ignition temperature    ignition timing adjustment      illuminated windsock   

조도 immersed maximum beam      immersed wedge       Immersed-Boundary Method (IBM)immersion suit 

IMO 선박식별번호 IMO ship identification number

IMO 톤수 IMO tonnage   영향분석impact hardness testing machine

impact test     impact testing machine impact wrench 

impeller box   impeller casing 

impervious sheath      impingement corrosion 실행예산Impressed Cathodic Current Protection (ICCP)

impulse noise  impulse reaction turbine 

Page 120: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

충동행정충동터빈충격력선체내측 inboard선내개방장치 inboard opening선내측면도안쪽회전내측축incandescent lamp발화성스파크 incendiary sparking

초생캐비테이션수입사각소각기초기쇄파 incipient breaking waves초생캐비테이션경사식파일타워경사사다리경사시험경사시험홈각도개재물불연성재료불완전용입 incomplete penetration비압축성 incompressible비압축성유동 incompressible flow

안전증가방폭기기확장스터드링크 increased stud link

점증피치프로펠러

물때잠복영역흠집 indent압입시험독립빌지관독립빌지흡입독립제어계통독립 절점 independent point독립형탱크도시평균유효압력지시동력 indicated power표시등레이더표시방식지압기 indicator표시기 indicator지압선도용지지압기콕지압선도

impulse stroke impulse turbine impulsive force 

inboard profile inboard rotation inboard shaft   백열등inception cavitation number    incident angle  incinerator     

incipient cavitation     inclinable pile driving tower    inclined ladder inclining experiment    inclining test   included angel inclusion       incombustible material  

increased safety apparatus     

increasing pitch propeller      

증분-반복절차 incremental- iterative procedure

모형선-실선상관저항증가계수 incremental resistance coefficient for model-ship correlation   incrustation    incubation zone 

indentation test independent bilge pipe independent bilge suction      independent control system

independent tank       indicated mean effective pressure

indicating lamp indication method of radar     

indicator card  indicator cock  indicator diagram 

Page 121: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

도시마력지시등지압기파이프간접형계측장치간접노무비 indirect labor cost개별난방유도통풍유도항력유도방사능유기유동 induced streaminduction유도브레이징유도가열유도전동기industrial engineering불활성 가스 용기 inert gas cylinder불활성가스덱실 inert gas deck-seal

불활성가스덱실펌프불활성가스디미스터불활성가스송풍기불활성가스발생장치 inert gas generator

불활성가스용접불활성가스관불활성가스세척기 inert gas scrubber

불활성가스세척기해수펌프불활성가스소화장치불활성가스장치관성시동기 inertia starter관성력 inertia force타력시험관성압 inertial pressure무한익렬가연한계가연성재료가연성가스 inflammable gas가연성 가스 검출기 inflammable gas detector인화점팽창식보트 inflatable boat팽창식구명뗏목팽창식구명부기팽창식구명동의 inflatable type lifejacket팽창식구조정 inflated type rescue boat정보검색 시스템적외선신호 InfraRed (IR) signature

infrared ray

적외선추적장치잉곳 ingot잉곳강외피보호등급 Ingress Protection (IP)당김줄고유결함고장 inherent weakness failure

inhibit circuit

indicator horse power  indicator lamp  indicator pipe  indirect gauging 

individual heating      induced draft   induced drag   induced radioactivity   

유도(감응)induction brazing       induction heating       induction motor 산업공학inert gas deck-seal water pump inert gas demister     inert gas fan   

inert gas metal arc welding     inert gas pipe  

inert gas scrubber sea water pumpinert gas smothering system   inert gas system       

inertia test     

infinite cascade inflammability limit     inflammability material 

inflammation point      

inflatable liferaft       inflatable type buoyant apparatus

information retrieval system

적외선InfraRed Search and Track (IRST)

ingot steel     

inhaul  

억제회로

Page 122: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

억제제초기설계초기적하상태 initial loading condition초기압력초기복원력초기변형률초기응력최초검사 initial survey초기사건 initiating event분사 injection분사캠분사간격 injection interval분사지연 injection lag분사손실분사지연 injection time delay분사노즐 injector내수면 선박흡입구 inlet흡입구와 배출구 inlet and discharge날개입구각흡입구흡입밸브직렬기관 in-line engine

INMARSAT identities

내저종늑골내저판내측클램프내측문 inner door내항내측선각 inner hull이너지브내측판내측축내측외판 inner skin내측판무기질아연실리케이트 inorganic zinc silicate공정중검사 in-process inspection공정중자재관리방충망문삽입블록 insert block삽입판 insert plate내해경기 inshore race항내 항해 inshore sailing내측덧판안쪽선실안지름캘리퍼스원형창속덮개내측랩안치수내측판검사 inspection제조후검사검사증서 inspection certificate검사뚜껑제조중검사

inhibition       initial design   

initial pressure initial stability  initial strain    initial stress   

injection cam   

injection loss   

inland water ship      

inlet blade angle       inlet port      inlet valve     

국제해사위성통신장치 식별부호

inner bottom longitudinal       inner bottom plate    inner clamp    

inner harbor   

inner jib       inner plating  inner shaft     

inner strake    

in-process material controlinsect net door 

inside butt strap       inside cabin    inside calipers inside deadlight     inside lap      inside measure inside strake   

inspection after construction

inspection door inspection during construction

Page 123: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

관찰해치검유탱크검사원installation drawing설치매뉴얼 installation manual

유분순간배출률순간변형률런던보험자협회화물약관미국전기전자학회지침서 instruction취급설명서 instruction manual지시판기기 instrument계기조명등

instrumentation계측기회로 instrumentation circuit단열 연돌 insulated funnel단열화물창방열재절연재절연거리절연레벨감시절연저항절연시험무개구 격벽 intact bulkhead비손상상태 intact condition비손상복원성유입관 intake duct흡입다기관일체형탱크 integral tank

통합선교시스템통합구성요소 integrated components

통합군수지원통합항해시스템적분기휘도조정손상도상호작용전자화문서대화식언어호환성중간복수기중간접속피더연결관연결밸브중간접속피더 interconnector feeder중간냉각기중간냉각단절판 intercostal

inspection hatch inspection tank inspector       설치도instantaneous rate of discharge of oil content  instantaneous strain    Institute Cargo Clauses (ICC)Institute of Electrical and Electronic Engineers (IEEE)

instruction plate 

instrument light 계장insulated hold  insulating material      insulating material      insulation distance     insulation level monitoring deviceinsulation resistance   insulation test  

intact stability  

intake manifold 

integrated bridge system (IBS)

선각·의장및 도장 종합관리 Integrated Hull, Outfitting and Painting (IHOP)Integrated Logistic Support (ILS)Integrated Navigation System (INS)integrator      intensity control intensity of damage    interaction     Interactive Electronic Technical Manual (IETM)interactive language    interchangeability      intercondenser inter-connecting feeder interconnection pipe    interconnection valve   

intercooler     intercooling    

Page 124: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

단절부재상호간섭점검인터페이스관리 interface management부분노출프로펠러간섭 interference억지끼워맞춤 interference fitting인터그래프중간제품 interim-product연동안전장치연동안전장치중간보이중판 intermediate flat중간늑골중압실린더중압터빈중간축 intermediate shaft

중간축베어링중간차단밸브중간검사불연속캐비테이션단속체인용접 intermittent chain welding

intermittent failure

단속필릿용접단속 사용 intermittent operation

단속지그재그형용접단속용접간헐식폭기장치내부부력실내등 internal canopy light내연기관 internal combustion engine

내연기관선선내통신장치안지름 internal diameter내부효율내부확대기내부 관성압력내부제트내부손실계수 internal loss factor안쪽증기관내부응력

국제대기오염방지증서국제선급연합회

intercostal member     Inter-Discipline Check (IDC)

interface propeller     

intergraph      

interlock arrangement  interlocking gear       intermediate beam     

intermediate frame     intermediate pressure cylinderintermediate pressure turbine  

intermediate shaft bearing      intermediate stop valve Intermediate Survey (IS)   intermittent cavitation  

간헐고장intermittent fillet welding       

intermittent staggered weldingintermittent welding    intermittent-hydraulic-gun-aeratorinternal buoyancy      

internal combustion engine ship internal communication equipment

internal efficiency      internal expander      internal inertial pressure internal jets    

internal steam pipe     internal stress 

국제 항 공·해 상 수색 및 구 조 지침

International Aeronautical & Maritime Search & Rescue (IAMSAR) ManualInternational Air Pollution Prevention (IAPP) CertificateInternational Association of Classification Societies(IACS)

Page 125: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

국제독립탱커선주협회국제원자력기구국제해운회의소국제민간항공기구

국제 액화가스 산적운반선 코드

국제고속선코드국제신호서해양오염방지협약

해상인명안전협약

어선의안전에관한국제협약

국제톤수협약국제전기기술위원회

국제용접학회국제노동기구국제구명설비코드국제만재흘수선증서국제만재흘수선협약국제만재흘수선면제증서국제해상위험물코드국제해사기구

International Association of Independent Tanker Owners (INTERTANKO)International Atomic Energy Agency (IAEA)International Chamber of Shipping (ICS)International Civil Aviation Organization (ICAO)

국제 위험화학품 산적운반선 코드

International Code for the Construction and Equipment of Ships carrying Dangerous Chemicals in Bulk (IBC)International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk(IGC)International Code of Safety for High Speed Craft (HSC)international code of signal    International Convention for the Prevention of Pollution from Ships (MARPOL) International Convention for the Safety of Life at Sea(SOLAS)International Convention on Safety of Fishing Vessels(1977)

선원의 당직·교육 및 훈련에 관한 협약

International Convention on Standards of Training Certification and Watchkeeping for Seafarers (ITCW)International Convention on Tonnage Measurement of shipsInternational Electrotechnical Commission(IEC)

국제수로기구 International Hydrographic Office (IHO)International Institute of Welding (IIW)International Labor Organization (ILO)international Life Saving Appliance (LSA) codeInternational Load Line CertificateInternational Load Line Convention (ILLC)International Load Line Exemption Certificate  International Maritime Dangerous Goods (IMDG) CodeInternational Maritime Organization(IMO)

Page 126: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

국제도선사협회국제해사위성통신장치국제복합운송국제나브텍스업무국제기름오염방지증서국제표준화기구국제무선통신자문위원회국제해상충돌예방규칙

국제하수오염방지증서

국제선박해양구조회의국제선박및항만시설보안코드국제안전관리코드국제선박관리자협회국제선주협회국제육상시설연결구국제신호기국제통신연맹국제수조회의국제해상보험연합국제항해

interpolation method보극 interpole

단속지속파단속급섬광단속점용접인터스캔단간밸브인터스위칭본질안전 배리어 intrinsic safety barrier

intrinsically safe

International Maritime Pilots' Association (IMPA)INternational MARitime SATellite communication apparatus(INMARSAT)International Multimodal Transport (IMT)international NAVTEX service  International Oil Pollution Prevention (IOPP) CertificateInternational Organization for Standardization(ISO) International Radio Consultative Committee (CCIR)International Regulations for Preventing Collisions at Sea (COLREG) International Sewage Pollution Prevention (ISPP) CertificateInternational Ship and Offshore Structures Congress(ISSC) International Ship and Port Facility Security (ISPS) CodeInternational Ship Management (ISM) Code International Ship Managers' Association (ISMA)International Shipowners' Association (INSA)international shore connection  international signal flag International Telecommunication Union (ITU)International Towing Tank Conference(ITTC) International Union of Marine Insurance(IUMI) international voyage    보간법Interrupted Continuous Wave(ICW)interrupted quick flashing light interrupted spot welding       interscan       interstage valve inter-switching 

본질안전

Page 127: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

본질안전방폭기기본질안전회로인바강 invar비품목록 inventory재고유지비용 inventory carrying cost

inventory control재고유지비용 inventory holding cost재고소요량 inventory requirement역시한

인버터정밀주조송장 invoice송장면중량인벌류트톱니안쪽회전주철 iron cast주조공장철선철재중실기둥불규칙변동 irregular variation불규칙파 irregular wave비가역기관비회전유동이셔우드식등압팽창등시성조속기등시성횡동요등엔트로피효율등엔트로피팽창 isoentropic expansionisolating transformer차단밸브 isolating valveisometric drawing등온변화등온압축등온팽창등온선중량구분선수기 jack잭 볼트 jack bolt줄사다리잭나사선수깃대재킷 jacket

재킷냉각청수냉각기재킷냉각청수펌프잭스테이

jack-up test줄사다리잼너트잼리베터일본표준공업규격제트캐비테이션

intrinsically safe apparatus     intrinsically safe circuit 

재고관리inverse time limit      엘(L)형강 inverted angle 역와이(Y)형기둥 inverted Y-type column inverter investment casting     

invoice weight involute tooth  inward rotation 

iron foundry   iron ship       iron solid pillar 

irreversible engine     irrotational flow Isherwood system      isobaric expansion     isochronous governor  isochronous rolling     isoentropic efficiency  

절연변압기입체도면

isothermal change      isothermal compression isothermal expansion   isothermal line itemize of weight      

Jack ladder    jack screw     jack staff      

jacket cooling fresh water coolerjacket cooling fresh water pumpjackstay 잭-업 시험Jacob's ladder jam nut jam riveter     Japanese Industrial Standard (JIS)jet cavitation   

Page 128: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

제트복수기제트기관제트노즐제트프로펠러제트추진제트펌프제트추력분무식 jet type화물비상투기돌출제방볼들이도르래지브 jib지브붐지브크레인지브 날개 jib foil지브 감개 jib furler지브핼리어드지브돛지브시트 jib sheet지브 조정줄 리더 jib sheet leader지브 조정줄 궤도 jib sheet track지브당김줄지그 jig지그 및 고정구 jig and fixture선광장치지거붐지거개프지거마스트턱붙임 joggling턱붙임 겹침이음턱붙임기계정밀목수 joiner선실목공도정밀목공사연결용섀클연결함이음부상세 joint detail이음효율이음부길이 joint length이음부개선 joint preparation

조이스트 joist주코스키프로파일저널 journal저널베어링조이스틱중량물데릭붐jumboization점프소기불꽃점화수평당김줄점핑스토퍼접속상자 junction box삼각주부표하급사관정크대용마스트

jet condenser  jet engine      jet nozzle      jet propeller   jet propulsion  jet pump       jet thrust      

jettison jetty   jewel block    

jib boom       jib crane       

jib halyard     jib sail 

jib stay 

jig drive       jigger boom    jigger gaff     jigger mast    

joggling lap joint    joggling machine       

joiner plan     joiner work    joining shackle joint box       

joint efficiency 

시간-주파수 해석법 joint time-frequency analysis method

Joukowski profile      

journal bearing joy stick       jumbo boom    선박연장개조jump scavenging       jump spark ignition     jumper stay    jumping stopper 

junction buoy  junior officer   junk   jury mast      

Page 129: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

대용타황마 jute

와유량계카르만와류한국형멤브레인화물격납설비 KC1 type membrane

작은닻용골 keel선저직선보기용골굽힘기계용골반목용골보트 keel boat용골경사용골거치 keel laying최초탑재블록 keel laying block용골선킬피스평판용골 keel plate선저직선보기용골날개 keel wing내용골누름쇠 keep누름판부활켈리켈빈소스켄터섀클커프 kerf절단부절취량 kerf allowance 등유 kerosine케치Keulegan-Carpenter number키 key키코일 key coilkey plan

키홈파기밀링기키홈절삭기키붙이프로펠러키홀 keyhole키리스프로펠러키홈바깥밀린거리킬드강

동점성 kinematic viscosity운동학키네틱공기펌프키네틱펌프키네틱탱크킹포스트 kingpost킹스톤밸브꼬임 kink간이취사장 kitchenette키친식타

jury rudder    

케이(K)형홈 K groove      Karman vortex flow meter     Karman vortex 

kedge anchor  

keel alignment keel bender    keel block     

keel grade     

keel line       keel piece     

keel sight      

keelson 

keep plate     keep-alive     kelly   Kelvin source  kenter shackle 

ketch  크리건-카펜터수

기본도key seating milling machine    key way cutting machine       keyed propeller 

keyless propeller       keyway      kick    killed steel     제1종축 kind 1 shaft    제2종축 kind 2 shaft    

kinematics     kinetic air pump       kinetic pump   kinetic tank    

kingston valve 

Kitchen's rudder      

Page 130: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

클라이스트론니 knee니라이더나이프스위치나이트헤드녹오프노킹노트매듭지식습득지식베이스지식공학지식표현너클 knuckle너클이음너클선너클몰딩너클포인트 knuckle point

한국무선국관리사업단한국산업규격한국선급한국수조회의코트노즐주코스키프로파일

labor costlaboratory래빌린스더미래빌린스팩킹래비린스 씰 labyrinth seal레이싱그로밋누름쇠융합부족 lack of fusion산소결핍 lack of oxygen사다리 ladder사다리갠트리사다리웰사다리윈치사다리와이어로프laden voyage래깅 lagging늦은전류래깅재호수기선람다비 Lambda ratio라멜라균열 lamellar tearing층류경계층얇은층캐비테이션층류유동 laminar flow층류저층적층기준 laminate reference합판선적층전등 lamp

klystron 

knee rider     knife switch    knight head    knock off      knocking       knot   knot   knowledge acquisition  knowledge base knowledge engineering knowledge representation      

knuckle joint   knuckle line    knuckle molding 

Korea Radio Station Management Agency (KORA)Korean Industrial Standard (KS)Korean Register of Shipping (KR)Korean Towing Tank Conference (KTTC)  Kort nozzle    Kutta-Joukowski profile 노무비실험실labyrinth dummy       labyrinth packing       

lacing grommet lacing wire     

ladder gantry  ladder well     ladder winch   ladder wire rope       적하항해lagging current lagging material lake steamer   

laminar boundary layer laminar cavitation      

laminar sublayer       

laminated wooden ship lamination      

Page 131: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

등소켓육상보일러육상기관육상시운전상륙용주정중형상륙정대형상륙정비행갑판다목적 강습상륙함헬기상륙 강습함도크형 양륙함 Landing Ship Dock (LSD)상륙함 Landing Ship Tank (LST)상륙용주정랜딩랭식꼼랜야드겹치기 이음 용접 lap joint welding겹침 연결 lapped joint랩핑 lapping대관형보일러레이저 급 laser class레이저 가공 laser machining래싱 lashing

축자유회전방지장치래싱줄래싱줄 lashing wire걸쇠 latch

latent defect잠열투영측면적횡굽힘면외좌굴모드 lateral buckling mode횡수축가로힘면외하중 lateral load횡하중 lateral load면외압력횡방향안정성 lateral stability수중측면적횡진동 lateral vibration선반 lathe선반척북극성위도법위도오차래티스주정 launchlaunch preparations

착수양수장치진수 launching진수장치 launching appliance진수용 부선진수계산

lamp socket    land boiler     land engine    

land trial       

landing craft   Landing Craft, Mechanized (LCM)Landing Craft, Utility (LCU)landing deck   Landing Helicopter Dock (LHD)Landing Platform Helicopter (LPH)

landing ship    landing Lang's lay    lanyard 

large tube type boiler  

lashing gear for propeller free rotation lashing line    

잠재불량latent heat     lateral area    lateral bending 

lateral contraction      lateral force   

lateral pressure 

lateral underwater area 

lathe chuck    latitude by pole star   latitude of error lattice  

진수준비launch/retrieval system       

launching barge launching calculation   

Page 132: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

진수식진수크래들 launching cradle진수곡선진수드래그진수치수진수식대진수대진수중량laundrylavatory비교법칙상사법칙꼼조선현도화법계선납 lead납피복선납망치측심줄납축전지 lead storage batterylead time납땜줄납피복리더 leader유도도르래 leading block유도체인 leading chain앞날 leading edge유도표 leading marks측심대 leadman's platformleak detection누설멈추개 leak stopper기밀시험 leak test누설배출손실레지판옆밀림 방지판 lee board선수밀림 lee helm풍하측 lee side 리치 leech리치라인리치로프풍하측풍압변위왼편꼬임좌회전프로펠러왼나사 left-handed screwleg length필릿용접의다리용접각장 leg size

수선간길이프루드의길이계수갑판보받침팔길이갑판보받침팔길이용착부길이 length of the weld deposit수선상길이전장

launching ceremony    

launching curve launching drag launching particulars   launching platform     launching way  launching weight       세탁실화장실law of comparison     law of similarity       lay     laying off      lay-up 

lead covered wire      lead hammer   lead line       

조달기간lead wire      lead-alloy-sheathing   

누설탐지leak-off leaving loss    ledge plate     

leech line      leech rope     leeward side   leeway left hand lay   left-handed propeller   

용접각장leg of fillet weld       

Length Between Perpendiculars (LBP)length coefficient of Froude    length of beam arm    length of side arm     

length on water line   Length Over All(LOA)

Page 133: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선체연장개조 lengthening닻연결체인렌즈반사기투묘유독가스 lethal gasLetter Of Credit (LOC)

발주 의향서 Letter Of Intent (LOI)

액면조절기액면계 level gauge액면계기판다목적크레인레벨스위치지레식안전밸브 lever safety valve지렛대비 leverage라이투 lie to

구명정승강시험구명부환라이프사이클 life cycle구명동의 life jacket구명동의등 life jacket light구명동의용선반라이프재킷구명부환 life ring구명동의 life vest구명정 lifeboat구명정 비품공기자급식구명정구명줄 lifeline구명뗏목 liferaft구명설비구명설비 lifesaving equipment구명신호 lifesaving signal승강기 lift

lift활대줄 lift선미부양양력계수부양송풍기 lift fan흡입펌프하역장치 lifting appliance 달아올림보달아올림볼트밸브개폐장치달아올림안내기구 lifting guide 보트걸이훅탑재용 러그 lifting lug달아올림볼트리프트온/리프트오프 방식리가먼트효율 ligament efficiency등 light경합금선등표

lengthening piece      lens reflector  let go anchor  

신용장

level controller 

level gauge board      level luffing crane     level switch    

life boats throwing and lowering test   life buoy       

life jacket rack life preserver  

lifeboat equipment     lifeboat with a self-contained air support system

lifesaving appliance   

양력lift by the stern    lift coefficient  

lift pump       

lifting beam    lifting bolt     lifting gear     

lifting hook    

lifting screw   lift-on/lift-off system(LO/LO system) light alloy ship       light beacon    

Page 134: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

등부표연속경용접경하배수량 light displacement발광 다이오드 Light Emitting Diode (LED)경유 light gas oil라이트 라인 속력 light line speed경금속선경유탱크경구조선경하흘수 light ship draft경하중량 light ship weight경용접 light welding경감 lightening경감구멍 lightening hole

래시선경부선최소선수흘수 lightest forward draught등대 lighthouse등대표등대관리선조명기구 lighting fitting조명장치 lighting system조명장치 lighting unit피뢰기피뢰침피뢰기피뢰기피뢰기등대선 lightship

lightweight경하중량 분포도 lightweight distribution리그넘바이티림버 limber림버보드오수구 limber hole측내후판한계게이지 limit gauge탄성한도비례한도 limit of proportionality제한링한계상태 limit state리미트스위치 limit switch한정적 접지장치 limited earth system한계평균흘수 limiting mean draft공정간 균형화 line balancing주낙줄감개선상가열선분 line segment구명줄발사기선형누적손상 linear cumulative damage선팽창 linear expansion선팽창계수리넨실정기선선도 lines선도 lines plan라이닝 lining

light buoy      light continuous welding 

light metallic ship      light oil tank   light scantling vessel   

Lighter Aboard SHip(LASH) lighter barge   

lighthouse list  lighthouse tender      

lightning arrester      lightning conductor     lightning discharger    lightning guard lightning protector     

경하중량lignum vitae     

limber board   

limber strake  

limit of elasticity       

limit ring       

line hauler     line heating    

line throwing appliance 

linear expansion coefficientlinen locker    liner   

Page 135: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

라이너링크 link링크운동텀블러스위치링크운동linoleum립 실 lip seal액화 liquefaction액화가스 liquefied gas액화가스운반선 liquefied gas carrier액화천연가스액화석유가스액체화물액체나침반액정표시장치액체연료 liquid fuel액체 개스킷 liquid gasket액화산소 liquid oxygen액체침투탐상시험 liquid penetrant test액체가감저항기횡경사 list

리스트프로그래밍청음봉대전 live활어운반선활하중가축운반선 livestock carrier거주구역 living quarter

액화천연가스운반선

엘엔지 스프레이펌프 LNG spray pump액화천연가스운반선 LNG tanker엘엔지 기화기 LNG vaporizer부하 load하중 load

하중저항계수설계load balancing하중계산점하중전달방향 load carrying direction하중상태 load case하중조합 load combination하중조합계수하중곡선하중반복속도 load cycle적재흘수부하 평준화 load evening

lining piece    

link motion     link switch     link work      리놀륨

Liquefied Natural Gas (LNG)Liquefied Petroleum Gas (LPG)liquid cargo    liquid compass Liquid Crystal Display (LCD)

liquid rheostat 

list programming(LISP) listening rod   

live fish carrier live load       

영국선급 Lloyd's Register of Shipping (LR)LNG carrier    

엘엔지 FPSO LNG Floating Production Storage and Offloading

엘엔지 FSO LNG Floating Storage and Offloading Unit

엘엔지 FSRU LNG Floating Storage Regasification Unit

엘엔지 RV LNG Regasification Vessel (LNG-RV)

엘엔지 SRV LNG Shuttle and Regasification Vessel

load and resistance factor design부하평준화 Load Calculation Point (LCP)

Load Combination Factor (LCF)load curve     

load draft      

Page 136: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

부하계수부하율부하지시계부하 평준화 load leveling만재흘수선 load line만재흘수선지정만재흘수선증서만재흘수선원표식건현용길이 load line length만재흘수선표시하중시나리오 load scenario부하차단장치 load shedding만재흘수선 load water line하중부담능력 load-carrying capacity평균응력변형률곡선 load-end shortening curves적하 loading 하중폭 loading breadth적하검사증명서적하지침기기적하상태하역설비 loading equipment적하지침기기적하지침서적하속도 loading rate로딩스테이션 loading station적하검사로비로브근거리통신망기측제어국부상세 local detail국부변위벡터 local displacement vector국부양력계수 local lift coefficient국부정하중 local static load국부강도국부지지보강재 local support stiffener국부계 local system국부진동국부중량국부접지장치 locally earth system수색 locating멈춤너트자물쇠붙이콕회전자구속 locked rotor

갇힌응력 locked-in stress로킹바 locking bar로킹레버로킹핀틀로킹축로징니현도 loft현도공거리계 log목재운반선 log carrier로그줄

load factor     load fraction   load indicator  

load line assignment   load line certificate    load line disc  

load line mark 

loading certificate      loading computer       loading condition       

loading instrument     loading manual 

loading survey lobby  lobe   

Local Area Network(LAN) local control   

local strength  

local vibration  local weight    

lock nut locked cock    

듀얼탠덤아티큘레이티드형감속장치 locked train type

reduction gear

locking lever   locking pintle  locking shaft   lodging knee   

loft man       

log line 

Page 137: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

대수속도대수감쇠율항해일지정지각장거리식별추적시스템장단식늑판 long and short armed floor

장단식늑골방식장선교루장염탄장늑판늑골장선수루장거리국제항해장기납기자재 long lead time material주낙어선장선미루로란장파정불규칙파장파정파종통재 longitudinal (LONGI.)종방향보종격벽 longitudinal bulkhead종격벽판종부심종중심세로이송컨베이어종늑골종늑골식구조선체종굽힘강도종이음선종부재종메타센터종통재간격 longitudinal space (L.S)종안정성종보강재종강도종늑골식구조종진동선상하역작업장

long-term effects장기응답 long-term response

장기응력빈도분포곡선선미방향으로 봄 looking after선수방향으로 봄 looking forward망보기죔손실루프소기법조립식날개헐거운볼트헐거운커플링헐거운맞춤

log speed      logarithmic decrement  logbook loll     Long - Range Identification and Tracking (LRIT) system

long and short armed floor systemlong bridge    long flame coal long floor frame       long forecastle long international voyage       

long liner      long poop      LOng RAnge Navigation (LORAN)long-crested irregular waveslong-crested seas      

longitudinal beam      

longitudinal bulkhead plateLongitudinal Center of Buoyancy (LCB)Longitudinal Center of Gravity (LCG)longitudinal conveyor   longitudinal frame      longitudinal framing system    longitudinal hull girder bending strength   longitudinal joint seam longitudinal member    longitudinal metacenter 

longitudinal stability    longitudinal strake     longitudinal strength   longitudinal system     longitudinal vibration   longshoreman  장기효과long-term stress distribution curve

lookout loop loss       loop scavenging loose blade    loose bolt      loose coupling loose fit       

Page 138: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

치수조정관들판조립식날개

로란해도로란수신기로란수신기 loran receiver로란수신기로란국로란방식로란표손실계수 loss factor

부력소실법통풍능력상실 부력소실법소멸에코소멸에코헛돌기소멸에코라운지 lounge루버 louver저액면경보 low level alarm저합금강저탄소강간이자동화 Low Cost Automation (LCA)저사이클피로 low cycle fatigue저사이클하중 low cycle load저압가스압축기 low duty gas compressor저수소계저압식탄산가스소화장치저압급수가열기저압가열기 low pressure heater저압증기발생기저압증기발생기보조급수펌프저압증기발생기복수기저압증기발생기드레인냉각기저압증기발생기급수펌프저압증기관저압터빈 low pressure turbine하부해수흡입밸브하부흡입저온냉각청수냉각기저온냉각청수펌프저온취성저온응력제거

loose pipe     loose plate     loose propeller blade   로란에이(A) loran A 로란시(C) loran C loran chart     loran indicator 

loran receiver indicator loran station   loran system   loran table     

loss of buoyancy method       loss of ventilation capacitylost buoyancy method  lost constant   lost echo      lost motion     lost target     

low alloy steel low carbon steel       

low hydrogen type     low pressure carbon dioxide fire extinguishing system low pressure feed water heater

low pressure steam generatorlow pressure steam generator auxiliary feed water pump   low pressure steam generator condenser       low pressure steam generator drain cooler     low pressure steam generator feed water pump   low pressure steam pipe       

low sea suction valve  low suction    low temperature cooling fresh water cooler    low temperature cooling fresh water pump     low temperature embrittlement low temperature stress relieving

Page 139: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

저온용접간조저압전지방식저수위 low water저수위경보하부 부착판 lower attached plate하층선교저위발열량관리하한선 lower control limit하층갑판삼각주하단부표폭발하한계 lower explosion limit폭발하한계하한주파수 lower frequency하부용골하부마스트저차진동하부당김줄하부슈라우드하부스테이하부판 lower strake하부톱갤런트돛하부톱갤런트가로막대하부톱세일 lower topsail하부톱세일가로막대하부텀블러만곡부하부하부중갑판하부가로막대유도등 low-location lighting액화석유가스운반선액화석유가스운반선

윤활제윤활장치윤활유 lubricating oil윤활유냉각기윤활유더티탱크윤활유드레인탱크윤활유여과기윤활유중력탱크윤활유관윤활유프라이밍펌프윤활유펌프윤활유청정기윤활유예비탱크윤활유잔류탱크윤활유침전탱크

low temperature welding       low tide low voltage battery system    

low water alarm       

lower bridge   lower calorific value   

lower deck     lower end buoy 

Lower Flammable Limit (LFL)

lower keel     lower mast     lower mode vibration   lower rigging  lower shroud   lower stay     

lower topgallant sail   lower topgallant yard  

lower topsail yard     lower tumbler  lower turn of bilge     lower 'tween decks   lower yard     

LPG carrier LPG tanker 엘(L)형여과기 L-type filter   엘(L)형여과기 L-type strainer lubricant       lubricating device      

lubricating oil cooler   lubricating oil dirty tank       lubricating oil drain tank       lubricating oil filter    lubricating oil gravity tank     lubricating oil pipe     lubricating oil priming pump    lubricating oil pump    lubricating oil purifier  lubricating oil reserve tank     lubricating oil residue tank     lubricating oil settling tank     

Page 140: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

윤활유슬러지탱크윤활유저장탱크윤활유여과기윤활유섬프탱크윤활유탱크윤활유이송펌프윤활펌프윤활고리

lubricator러프 luff러프태클러핑크레인 luffing crane러핑 실린더 luffing cylinder러핑대빗러그세일 lug러그고착소화물러거러그세일목재 lumber목재운반선목재건현목재적재항총액계약 lump-sum contract불규칙최대횡경사각마하수절삭성 machinability기계중단기간 machine down time

기계상태감시장치기계유 machine oil기계일정계획 machine scheduling plan기계공장 machine shop공작기계기계이용표 machine utilization table기관실배치도기관기본설계기관실위벽기관제어장소 machinery control position기관상세설계기관의장 machinery fitting기관의장설계기관의장품기관기능설계기관초기설계기계설치 machinery installation

machinery lay-up

기관생산설계기관구역 machinery space

기관실구멍

lubricating oil sludge tank      lubricating oil storage tank lubricating oil strainer  lubricating oil sump tank   lubricating oil tank     lubricating oil transfer pump   lubricating pump    lubricating ring     주유기luff tackle      

luffing davit    

lug connection 단 엘(L)형재 lug piece       luggage room  lugger lugsail 

lumber carrier lumber freeboard       lumber port    

lurch   Mach number  

machine health monitoring system

machine tool   

machinery arrangement (M/A)machinery basic design machinery casing      

machinery detail design 

machinery fitting design machinery fittings      machinery function design      machinery initial design 

기계장기휴지machinery product design      

A류 기관구역 machinery space of category Amachinery space opening       

Page 141: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

기관구역무인운전기관구역무인운전시험

machining allowance

마킨타이어식이중저육안시험화약고 magazine자기탐상검사탄산마그네슘단열재전자석기중기 magnet crane자기쏠림전자석식클러치 magnetic clutch자기나침반 magnetic compass자기컴퍼스자동조타장치자침로자기댐퍼자기장 magnetic field자석기름거르개자분탐상시험 자분탐상시험 magnetic particle test자기신호 magnetic signature자기변형률자기변동자석발전기자기탐사선자기센서자기변형식마그네트론처녀항해마이어선형우편선우편기우편실우편기선주공기압축기주공기이젝터주공기탱크주앵커주밸러스트탱크주베어링빌지주관주보일러주격벽주모선 main busbar주체인주순환펌프주복수펌프주복수기

main control console주갑판디젤주기관주요치수 main dimensions

machinery space unmanned operationmachinery space unmanned operation test      기계가공여유MacIntyre system double bottommacroscopic test       

magnaflux inspection   magnesium carbonate heat insulating material  

magnetic blow 

magnetic compass pilot magnetic course       magnetic damper       

magnetic oil strainer   Magnetic Particle Inspection (MPI)

magnetic strain magnetic variation      magneto   magnetometric sensing vessel  magnetometric sensor  magneto-striction type magnetron     maiden voyage Maier form     mail boat      mail flag       mail room      mail steamer   main air compressor   main air ejector main air reservoir      main anchor    main ballast tank       main bearing   main bilge pipe main boiler     main bulkhead 

main chain     main circulating pump  main condenser pump  main condenser 주제어반main deck     main diesel engine     

Page 142: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

주드레인관주조명장치주전원주기관 main engine

주기보조송풍기주기연료유가열기주기실주급수체크밸브주급수펌프주급전선주력함대정늑골재주가스터빈주대톱니바퀴주발전장소 main generating station주발전기 main generator

주발전기용디젤기관주권장치주선체주분사밸브주기관베드 main machinery seating주마스트주관

main plate주전원주추진기관 main propulsion machinery

주무선전신설비주감속장치주돛 main sail주축 main shaft주조정줄 main sheet 주조종줄 트래블러 main sheet traveler주전원 주시동밸브메인스테이주증기 main steam주증기관주증기터빈주조타장치주막음밸브주개폐기주배전반메인톱마스트주터빈주수직구역주대톱니바퀴메인슬 mainsail메인슬핼리어드정비용이성 maintainability

main drain pipe main electric lighting system   main electric power source    

main engine auxiliary blower   main engine fuel oil heater     main engine room      main feed check valve main feed water pump     main feeder    main fleet      main frame    main gas turbine       main gear wheel       

main generator diesel engine   main hoisting gear     main hull       main injection valve    

main mast     main pipe      주판main power supply     

main radiotelegraph installation main reduction gear    

main source of electric powermain starting valve     main stay      

main steam pipe       main steam turbine     main steering gear     main stop valve main switch    main switchboard      main top mast main turbine   main vertical zone     main wheel    

mainsail halyard 

Page 143: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

정비수리팀정비 및 보급 maintenance and supply정비용해치 maintenance hatch선급유지 maintenance of classmaintenance preventionmaintenance scheme근해구역주요개조 major conversion제조자도면 maker drawing제조자발행증명서보충급수 make-up feed보충급수관현장맞춤관 부급수밸브make-up water말라카맥스 Malaccamax고장 malfunction 가단성 malleability가단주철

맬릿 mallet

인력 man power

경영정보시스템물막이맨드렐조종신호등조종성조종 maneuvering조종용공기 maneuvering air조종용공기압축기조종용공기탱크조종장치 maneuvering arrangement조선상태 maneuvering condition 조종장치조종신호등 maneuvering light조종성능 maneuvering performance조종석조종성시험 maneuvering test조종밸브망간청동맨홀 manhole맨홀 덮개 manhole cover누적시수계획적하목록매니폴드 manifold매니폴드밸브마닐라로프머니퓰레이터울타리줄 manrope

maintenance and repair team

보전예방정비계획major coasting area    

maker's certificate    

make-up feed water pipe      make-up pipe  make-up valve 보충수

malleable cast iron     

목표관리 Management By Objectives (MBO)Management Information System (MIS)manager board mandrel 

maneuver light 

maneuverability 

maneuvering air compressor   maneuvering air reservoir      

maneuvering gear      

maneuvering platform  

maneuvering valve     manganese bronze     

man-hour cumulative manifest       

manifold valve Manila rope    manipulator    유(U)자관압력계 manometer     

Page 144: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

울타리줄수동경보장치수동제어수동크랭킹 manual cranking수동절단 manual cutting

수동식화재경보장치수동조작 manual intervention수동운전 manual operation수동시동 manual starting수동용접수동화재경보장치

manufacture drawing공장시험제작소요기간 manufacturing lead time마르코니형범장마르코니형캣마르코니형케치마르코니형슬룹마르코니형욜한계선목갑판끝판마진판 margin plate해난사고 marine accident선박용보일러선박용탄해상용디젤연료유 Marine Diesel Oil (MDO)선박기관사 marine engineer해양환경 marine environment해상탈출설비 marine evacuation system선박용풀해양생성물부착방지장치해양오염물질 marine pollutants해양오염 marine pollution항해용레이더인양선대해양관측부이선박오물처리장치해저지층탐사장치선박분뇨처리장치선박용터빈선원 mariner

미국해사청관해관청해난심판소해양환경보호위원회

manrope rove  manual alarm system manual control 

manual fire alarm system      

manual welding manually operated call 제작도면manufacturer's test   

Marconi rig    Marconi rigged cat     Marconi rigged ketch  Marconi rigged sloop   Marconi rigged yawl   margin line     margin plank   

marine boiler  marine coal    

marine glue    marine growth preventing equipment

marine radar   marine railway marine research buoy  marine sanitation device       marine seismic profiling system marine sewage treatment systemmarine turbine 

Maritime Adiministration (MARAD)Maritime Authority     Maritime Disaster Inquiry AgencyMaritime Environment Protection Committee (MEPC)

Page 145: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

해사이동통신식별번호해사이동통신위성 해사안전위원회해사안전정보 해사위성통신

MARK III마크라인밀도표함수법 Marker-Density Method말린스파이크맞당김식하역법쐐기블록마르텐사이트마팅게일 martingale마팅게일스테이도장보호테이프 masking tape질량 mass질량밀도마스트 mast마스트구멍테마스트덮개마스트색페인트전범장 mast head rig

마스트뿌리마스트구멍테마스트고리마스트하운드마스트밑방마스트등마스트구멍마스트경사마스트밑판마스트테이블마스트쐐기선장 master주나침반비상부서배치표마스터로그주 일정계획 master schedule주전파국주밸브주대톱니바퀴장등 masthead light마스트헤드라이저 masthead riser항해사재료사용구분 material class자재결함보고서 material deficiency report재료계수 material factor재료등급 material grade

Maritime Mobile Service Identification Number (MMSI)maritime mobile-satellite serviceMaritime Safety Committee (MSC)maritime safety informationmaritime satellite communication마크3형 멤브레인mark line      

marlinespike   married fall method    marrying wedge martensite     

martingale stay 

mass density   

mast (hole) collar    mast coat      mast color paint       

mast heel      

mast hole collar    mast hoop     mast hounds   mast housing   mast light      mast opening  mast rake      mast step      mast table     mast wedge    

master compass 

master list     master log     

master station master valve   master wheel  

mate   

Page 146: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

자재취급운반 material handling재료검사 material inspection매질경계면 material interface자재목록 material list

설치자재목록material preparation자재구매 material procurement

자재소요계획material specification

자재저장불출계획자재소요량정보 Material Take-Off (MTO)수학모형 mathematical model

결합 mating

메이팅장치결합면 mating surface매트릭스통로용매트MAU type blade section대형해머맥시급 maxi class최대전진항해속력최대후진속력 maximum astern speed

최대날개폭비최대폭최대연속정격출력최대적재용량 maximum load capacity최대허용질량 maximum permissible mass

도체최고허용온도최고기준주위온도최대단면적최대단면폭최대횡단면적계수최대단면계수최대속력최대두께 maximum thickness최대두께선정지시최대가로이동거리최대횡단면적시운전최대속력최고전압최대수선면최고사용압력메이데이 Mayday평균날개폭 mean blade width평균날개폭비

Material List of Fitting (MLF)자재준비Material Requirement Planning (MRP)자재시방서material stowage and issuing plan

mating device  

matrix matting runner 

MAU형 날개단면maul hammer  

maximum ahead service speed

maximum blade width ratio     maximum breadth      Maximum Continuous Rating (MCR)

maximum rated conductor temperaturemaximum reference ambient temperature       maximum section area maximum section beam  maximum section coefficientmaximum sectional area coefficientmaximum speed 

maximum thickness line maximum transfer in stopping  maximum transverse section   maximum trial speed   maximum voltage      maximum water plane   maximum working pressure    

mean blade width ratio 

Page 147: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

평균코드길이평균흘수 mean draft평균유효압력파중평균동력증가파중평균회전수증가파중평균저항증가파중평균추력증가파중평균토크증가평균유효지시압력평균선평균피치평균압력평균속력평균고장간격시간평균고장발생시간 mean time to failure평균수리시간 Mean Time To Repair (MTTR)평균수선면평균의평균흘수접근설비 means of access탈출설비 means of escape표주간거리 measured mile속력시험침로표주간속력시험재화용적용적화물무어손식측도법육류운반선기계효율 mechanical efficiency

열의일당량기계적위해요소 mechanical hazard도선사용기계식승강기 mechanical pilot hoist기계적성질 mechanical properties기계식통풍장치제작기준선의무실 medical treatment room메가와트데이절연저항시험 megger test융점 melting point용융속도막응력 membrane stress맴브레인 형 membrane type메르카토르항법개장순양함상선대상선 merchant ship상선대

mean chord length     

mean effective pressure mean increase in power in waves mean increase in rate of revolutions in waves mean increase in resistance in waves  mean increase in thrust in wavesmean increase in torque in wavesMean Indicating Pressure (MIP)mean line      mean pitch     mean pressure mean speed    Mean Time Between Failure (MTBF)

mean water plane      mean-of-means draft  

measured mile course  measured mile trial    measurement capacity  measurement cargo    measurement of Moorson's systemmeat carrier   

mechanical equivalence of heat 

mechanical ventilation systemmedian line    

Mega watt day 

melting rate    

Mercator sailing merchant cruiser       merchant fleet 

merchantile marine     

Page 148: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

상선법수은보일러수은트림조정장치수은터빈자오선 meridian자오선위도법요소분할 mesh그물망 mesh 요소분할경계 mesh boundary선원식당작동체인메타센터 metacenter메타센터곡선메타센터높이메타센터반지름메타센터안정성외장금속보수제 metal cement

미그용접금속피복 metal sheath

해양기상관측선기상레이더기상정보실 meteorological room기상업무 meteorological service메탄하이드레이트 methane hydrate

MF Radio installationMF/HF Radio installation미첼식추력 베어링마이크로제트마이크로 탱 micro tang마이크로미터

현미경시험현미경조직미진동계마이크로파중앙부선체중분위도항법중심선내저판중간마스트중앙부폭선체중앙단면적선체중앙 midship중앙기관중앙부늑골중앙부갑판실선체중앙부선체중앙횡단면도 midship section선체중앙횡단면적선체중앙횡단면계수

merchantile shipping act       mercury boiler mercury trim system   mercury turbine 

meridian altitude       

mess room     messenger chain       

metacentric diagram    metacentric height     metacentric radius     metacentric stability    metal braid armor     

Metal Inert Gas (MIG) Arc Welding

meteorological observatory ship meteorological radar   

MF 무선설비MF/HF 무선설비

Michell thrust bearing  micro jets       

micrometer     microscopic examination       microstructure microvibrograph microwave     middle body    middle latitude sailing  middle line strake      middle mast    midlength beam midlength section area  

midship engine midship frame  midship house  midship part   

midship section area   midship section coefficient     

Page 149: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

연강표주미국국방성표준규격압연번호압연흑피 mill scale밀링커터재료시험성적서 mill-sheet기뢰부설함 Mine Layer (ML)소해정기뢰탐색함 Minehunter, Coastal (MHC)무기물절연케이블광유광질면무기물투여기 mineralizer마이너 법칙 Miner's rule소해작업 mine-sweeping operation재작업최소화 minimize reworks 최소통과개구크기 minimum clear opening최소크리프율최소건현최소탐지거리최소요구질량 minimum required mass최저회전수시험최소조파저항 minimum wave resistance소조립 minor assembly마이너스랩마이너스나사거울등가스배기관마이터톱니바퀴혼합화물복합사이클혼합연소 mixed firing혼합연소보일러 mixed firing boiler혼합연소혼합특성 mixing behavior혼합실혼합탱크미즌마스트미즌톱마스트이동식해저자원시추선이동식작업대 mobile scaffold이동국실물모형 mock-up모드해석모드밀도 modal density모형시험모형선예인력모델링기준 modeling criteria

mild steel      milepost       Military Specifications and Standard (MIL Specification)mill number    

milling cutter  

mine sweeper  

mineral insulated cable mineral oil     mineral wool   

minimum creep rate    minimum freeboard     minimum range  

minimum revolution test 

minus lap      minus thread   mirror light    mist pipe      miter wheel    mixed cargo   mixed cycle    

mixed fuel burning     

mixing chamber mixing tank    mizen mast mizen topmast    Mobile Offshore Drilling Unit (MODU)

mobile station  

modal analysis 

model test     model towing force    

모형선-실선상관수정량 model-ship correlation allowance

Page 150: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

중형 조선소 moderate-size shipyard감속률감속재모듈방식건조 modular construction모듈형수학모형 modular model모듈탄성계수습증기내습성절연재료당밀운반선주형 mold몰드컷 mold cut몰드라인 mold line현도장몰드형상 mold shape형 molded (MLD.)형기선 molded baseline형나비 molded breadth형깊이형치수형배수량 molded displacement형흘수성형보온재주형공주조품 molding주형기계몰리에르선도용융금속용융지면적모멘트힘의모멘트관성모멘트

운동량의모멘트센티미터 트림 모멘트운동량모넬합금방사각제한장치감시장치 monitoring device감시장소단선수루

모형선-실선프로펠러회전수상관비

model-ship correlation factor for propeller rate of revolution   

모형선-실선추진효율상관비model-ship correlation factor for propulsive or quasi-propulsive efficiency     모형선-실선상관계수 model-ship correlation factor   

moderating ratio       moderator      

module modulus of elasticity   moist steam    moisture resistant insulating material   molasses tanker 

mold loft       

molded depth  molded dimension      

molded draft   molded heat insulating material molder 

molding machine       Mollier diagram molten metal   molten pool    moment of area     moment of force       moment of inertia      

단면2차모멘트 moment of inertia of section areamoment of momentum  moment to change one centimeter trim (MTC)momentum     Monel metal   monitor angle limit device      

monitoring station      monkey forecastle     

Page 151: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

몽키스패너몽키스패너단일체구조선문풀 moon pool계선 mooring계선장치 mooring arrangement계선부이계선장치계선파이프계선줄계선시운전계선윈치 mooring winch모스부호모스신호장부홈모르티스활차모자이크타일모자이크공사방충망문모스형 MOSS type모선 mother ship운동보상기motion of electrode운동응답 motion response 원동력전동기 motor전동송풍기전동발전기발동기정발동기붙이구명정전동기동력 motor power기범선 motor sailor내연기관선전동사이렌전동기기동장치내연기관선모터보트조기수 motorman마우싱송화구

이동식소화기이동식접근설비 movable means of access이동식램프 movable ramp움직날개움직깃머드박스 mud box머드혼합장치머드펌프머드탱크머드웰슬리브연결소음기다소자식음향측심기

monkey spanner       monkey wrench monolithic ship 

mooring buoy  mooring equipment     mooring pipe   mooring rope  mooring trial   

Morse code    Morse signal   mortis mortised block mosaic tile     mosaic work   mosquito net door     

motion compensator    운봉법motive power  

motor fan      motor generator motor launch   motor lifeboat  

motor ship     motor siren    motor starter  motor vessel   motorboat      

mousing mouth piece    movable fire extinguisher      

moving blade  moving vane   

mud mixing unit mud pump     mud tank      mud well       muff coupling  muffler multi-channel echo sounder    

Page 152: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

다원주 multi-circular cylinder다심케이블 multi-core cable다심튜브 multi-core tube복식디젤추진다중협동설계 multidisciplinary design복류식가열기다상물질 multi-phases다단원심송풍기다단원심펌프다중폐단면 multiple closed cell다기통다중디젤기관다단식증발기다단식냉각기다극점용접기다기배기복식용접기혼압증기터빈복식펀칭기계다점저항용접다축선다단원심송풍기다단원심펌프다단압축기다층안전유리다점최적설계다점선정형온도계다극스위치 multi-pole switch다항적하 multi-port loading

다목적화물선다중스팬 multi-span다중스프레더 multi-spreader다관식보일러다관식반응기 multi-tubular reactor복식날개디퓨저먼츠합금버섯꼴닻버섯꼴밸브버섯형통풍통비상배치표 muster list소집장소 muster station

multi-diesel propulsion 

multi-flow heater      

multiple centrifugal fan multiple centrifugal pump       

multiple cylinder       multiple diesel engine  multiple effect evaporator      multiple effect refrigerator     multiple electrode spot welding machinemultiple exhaust       multiple operator welding machinemultiple pressure steam turbinemultiple punching machine     multiple resistance welding     multiple screw ship    multiple-stage centrifugal fan  multiple-stage centrifugal pump     multiple-stage compressor     multiplex safety glass  multi-point design optimizationmulti-point selector type thermometer

Multi-purpose Cargo ship (MPC)

multi-tubular boiler      

multi-vane diffuser     Muntz metal   mushroom anchor      mushroom valve       mushroom ventilator   

Page 153: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

마일러알몸배수량 naked displacement알몸선체명판 name platenaming ceremony좁은수로

협대역직접인쇄전신장치주관청 national administration

미국항공우주 규격주관청 national authority자연순환 natural circulation자연대류 natural convection자연대류방열기자연곡재자연통풍

natural exhaust고유진동수고유주기 natural period자연방사능자연횡동요자연통풍 natural ventilation

자연통풍장치고유진동모드항해력항해천문학해도 nautical chart항해계기해리 nautical mile항해도서 nautical publication항해표항해연습선조선기사조선공학네이벌황동해군조함관해군공창해군기사미해군연구소

Navier-Stokes equations가항상태가항수역항행구역항해선교 navigation bridge항해선교갑판항해선교시야항해기기 navigation equipment항해등 navigation light항해등표시반 navigation light indicator조선장소 navigation position항해선교내다지항로표지

Mylar 

naked hull     

명명식narrow waters Narrow-Band Direct Printing telegraph(NBDP) National Aerospace Standard (NAS)

natural convector      natural crook timber   natural draft   자연배출natural frequency      

natural radioactivity    natural rolling  

natural ventilation system      natural vibration mode nautical almanac       nautical astronomy     

nautical instrument     

nautical table  nautical training ship   naval architect naval architecture      naval brass    naval constructor      naval dockyard naval engineer Naval Ship Warfare Center (NSWC)나비어-스톡스 방정식navigable condition     navigable waters       navigation area 

navigation bridge deck navigation bridge visibility

navigation wing navigational aids       

Page 154: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

항해설비 navigational equipment

협대역직접인쇄전신 항해경보 navigational warning항해당직 navigational watch미해군조함단 NAVSEA나브텍스수신장치해군항행위성시스템수치제어기계 NC machine수치제어마킹조금넥부시넥엘보네킹효과 necking effect바늘밸브음 부력탱크음 압력 negative pressure음 슬립음 복원력네스팅순적량순유효등가두께양망기순마력방잠망부설선유효흡입양정양망롤러순치수 net scantling순단면계수 net section modulus하역망순강재중량순두께 net thickness제공순두께 net thickness offered요구순두께 net thickness required순톤수신경회로망중립각중립축중립평형중성불꽃중립선중립면중립면중성화수중성자밀도중성자속밀도중성자원신선니켈강

NAVigational information TEleX (NAVTEX)

Navtex receiver Navy Navigation Satellite System (NNSS)

NC marking      neap tide      neck bush      necked elbow  

needle valve   negative buoyancy tank 

negative slip   negative stability       nesting net capacity    net effective equivalent thicknessnet hauler      net horsepower net layer       Net Positive Suction Head (NPSH)net roller      

net sling       net steel weight       

net tonnage    neural net      neutral angle   neutral axis    neutral equilibrium     neutral flame   neutral line    neutral plane   neutral surface neutralization number  

neutron density 

neutron flux density    neutron source      new ship       nickel steel    니켈-크롬강 nickel-chrome steel    

Page 155: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

니켈계 용접봉 Ni-electrodeNiFe-electrode 야간오차야간쌍안경야간근무 night shift야시경 night vision니플이음Nippon Kaiji Kyokai (NK)질소발생장치 nitrogen generator질소산화물 nitrogen oxide질소기화기 nitrogen vaporizer배선용 차단기 no fuse breaker절점변위 nodal displacement절점력 nodal force절점실내소음기준 Noise Criteria (NC)소음레벨 noise level소음평가지수 Noise Rating Number (NRN)소음저감량 Noise Reduction (NR)

무부하운전 no-load running무부하 시험 no-load test무부하전압호칭지름공칭총웨브두께공칭권양속력 nominal hoisting speed호칭마력 nominal horse power공칭면외하중 nominal lateral load공칭피치공칭압력공칭변형률 nominal strain공칭응력 nominal stress 공칭응력방법 nominal stress approach공칭치 nominal value공칭전압 nominal voltage공칭반류 nominal wake공칭반류비노모그램 nomogram비흡습성재료무브래킷식불연성재료 noncombustible material비복수기관비전도체 매트 nonconducting mat

nonconducting material불연속갑판 non-continuous deck불연속플랜지 non-continuous flange조립식라이너비도전금속부비파괴평가 nondestructive evaluation비파괴시험 nondestructive examination비파괴 기술 nondestructive technique

니켈-크롬-몰리브덴강 nickel-chrome-molybdenum steel

니켈-철계 용접봉night error     night glasses   

nipple joint     일본선급

nodal point     

no-load voltage nominal diameter       nominal gross web thickness

nominal pitch  nominal pressure       호칭치수 nominal size   

nominal wake fraction  

non-absorbent material non-bracket system    

non-condensing engine 

부도체

non-continuous liner   non-current carrying metallic part

Page 156: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

비파괴검사비분리식나사무차원의 non-dimensional 촉탁검사원비팽창기관비철금속내화도료부동혼합액비선형유한요소해석비선형파 nonlinear wave

non-magnetic material비자성강비금속수밀피복비금속물질 non-metallic material

고정원형창비여객선무동력선체크밸브비자기역전식디젤기관비회전 로프 non-rotating rope미끄럼방지 nonslip방폭 팬

non-sparking tool비정지캐비티법정외 예비품 non-statutory spare parts비수밀격벽 non-tight bulkhead

변동피치프로펠러비수밀 non-watertight (N.W.T.)

비수밀격벽비수밀문프랑스표준규격 Norm Francaise (NF)통상 밸러스트 normal ballast정상상태상용연속출력정상분포 normal distribution정상소요시간 normal duration통상운전상태 normal operating condition상용출력법선피치

통상전력공급 normal power supply

유효통달거리상용속력연강 normal strength steel수직응력 normal stress

NonDestructive Test (NDT)non-detachable screw cap     

non-exclusive surveyor non-expansive engine  nonferrous metal      nonflammable paint     nonfreezing mixture   nonlinear finite element analysis

비자성체non-magnetic steel     non-metallic impervious sheath 

non-opening side scuttle       non-passenger ship    non-powered vessel   non-return valve       non-reversible diesel engine   

non-sparking fan       방폭공구non-stationary cavities 

non-uniform pitch propeller    

non-watertight bulkhead       non-watertight door    

normal condition       Normal Continuous Rating (NCR)

normal output  

normal pitch   

normal range   normal speed  

Page 157: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

온도정격정상근로시간 normal working hours노멀라이징북극항로 Northern Sea Route (NSR)북쪽상방표시뿌리면운전부자유등노치 notch노치봉시험노치굽힘시험노치취성노치계수노치효과노치뿌리노치감도노치응력 notch stress노치인성 notch toughness지시판항행통보 notices to mariners

not-under command light무전압경보유해액체물질 noxious liquid substancenoxious substance노즐 nozzle노즐각노즐단면계수노즐날개노즐블록노즐상자노즐졸임유량노즐차단조절노즐효율노즐분사장치 nozzle injection system노즐손실노즐프로펠러 nozzle propeller노즐링 nozzle ring노즐타 nozzle rudder노즐목

노즐제어조속핵단면적핵분열핵력핵연료핵반응원자력선원자력잠수함원자력항공모함

normal temperature ration      

normalizing    

north-up       nose   코-꼬리코드선 nose-tail line  not under command light       

notch bar test notch bend test notch brittleness       

notch coefficient       

notch effect    notch root     notch sensitivity       

notice plate    

운전부자유등no-volt alarm   

유해물질nozzle angle   nozzle area coefficient nozzle blade   nozzle block   nozzle box     nozzle chocking flow   nozzle cutout governing nozzle efficiency       

nozzle loss     

nozzle throat   nozzle-control governing       nuclear cross section  nuclear fission       nuclear forcer  nuclear fuel    nuclear reaction nuclear ship    nuclear submarine      nuclear-powered aircraft carrier (CVN)

Page 158: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

핵형성너깃도장 횟수 number of coats반복횟수 number of cycles목표탐지횟수최대연속회전수회전수행정수수치계산 numerical calculation

Numerical Control (NC)수치현도법숫자기수치모사 numerical simulation수치파수조 numerical wave tank마름모꼴부표나이키스트주파수오컴노 oar노구명정객체지향모델링객체지향프로그래밍기법의무선선수사파 oblique sea

oblique section관측 observationobservation error검유탱크장애부표장애물등occasional inspection임시검사명멸등최소장비 가동율 occupancy requirement해류해양공학수조 Ocean Engineering Basin원양구역원양어업 ocean going fishing원양선원양항해 ocean sailing정점관측선

해양관측부이해양 조사선해양조사선옥탄가 octane number옥타브 octave옥타브밴드중심선에서 이격거리 off centerline편심표시미해군연구청

nucleation      nugget 

number of hits  number of maximum continuous revolutionsnumber of revolution   number of stroke      

수치제어 numerical mould method       numerical pennant      

nun buoy      Nyquist frequency      oakum 

oar lifeboat    object-oriented modeling       Object-Oriented Programming Style(OOPS)obliged vessel 

경사단면관측오차

observation tank       obstruction buoy       obstruction light 임시검사 Occasional Survey (OS)     occulting light  

ocean current  

ocean going area      

ocean going vessel     

ocean weather ship    oceanographic observation buoy oceanographic research shipoceanographic research vessel 

octave band    

off-center PPI Office of Naval Research (ONR)

Page 159: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

당직사관 officer on watch항해사선박번호공식등록표지 official registration markofficial sea trial공식시운전형상치수표 offset table잔류편차해상부두근해경비함외해경기 offshore race원호꼴단면기름흡착매트기름흡착재

기름윤활식선미관베어링선미관유밀장치유압브레이크연료저장고오일버너오일 코밍 oil coaming

석유회사국제해사평의회유분농도 oil content유분농도계기름검지기기름배출감시장치유처리제살포장치급유축오일펜스 oil fence

오일펜스확장장치주유연결구주유관기름여과기기름분리장치중력식기름탱크유면검지기유증기 탐지기 oil mist detector유성페인트오일팬

기름담금질 oil quenching기름기록부 oil record book기름회수기기름회수선 oil recovery ship기름회수장치 oil recovery system기름회수선유성잔류물 oil residue유밀장치 oil seal유수분리장치

officer  official number 

공식해상시운전official trial    

offset  offshore lading station Offshore Patrol Vessel (OPV)

ogival  oil absorption mat      oil absorption material oil bath type stern tube bearing oil bath type stern tube sealing deviceoil brake       oil bunker      oil burner      

Oil Companies' International Maritime Forum (OCIMF)

oil content meter      oil content sensor      Oil Discharge Monitoring Equipment (ODME)oil dispersant sprinkling device oil distribution shaft    

oil fence expanding device     oil filling connection   oil filling pipe  oil filter oil filtering equipment  oil head tank   oil level sensor 

oil paint        oil pan 

오피에이 90 Oil Pollution Act (OPA) '90   

oil recovery equipment 

oil recovery vessel    

oil separating system  

Page 160: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

유침전탱크 oil settling tank기름회수선 oil skimmer기름유출사고 oil spill기름저장부선기름여과기오일섬프오일스위치기름탱크비상차단밸브유조선유밀 oil tight (O.T.)기름받이 oil tray

기름형운전부자유등유수경계면검출기벌크겸유조선조기수유밀격벽유밀이음유밀피치유밀시험유밀공사유성오수탱크유성혼합물 oily mixture

폐유연소보조보일러유혼합수 oily water

유수분리탱크유수분리기 oily water separator

유수분리기서비스펌프유수흡입기유수흡입펌프오메가항법장치버스바

on-block outfittingon-board

선상통신장치선상정비 on-board maintenance

on-board outfitting선상공무지원 on-board services선내시험 on-board test선내시험절차서 on-board test procedure상부의장 on-ceiling outfitting갑판상거더one design class

편면용접 one side welding

on-floor outfitting

oil storage barge       oil strainer     oil sump       oil switch      oil tank emergency shut-off valveoil tanker      

oil type not-under-command lightoil water interface detector    oil-bulk carrier oiler   oil-tight bulkhead       oil-tight joint    oil-tight pitch   oil-tight test    oil-tight work   oily dirty water tank   

oily sludge burning auxiliary boiler

oily water separating tank     

oily water separator service pumpoily water suction device      oily water suction pump omega navigator       omnibus bar   블록의장선상on-board communication equipment

선내 의장

on-deck girder 동일설계급 1차원스펙트럼 one dimensional spectral

density

지상의장

Page 161: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

현장통신 on-scene communication직장내교육훈련 on-the-job training유니트의장 on-unit outfitting

준설토처리장치대기복수기벌림베벨무갑판선열린촉개회로전압개방사이클개방갑판 open deck개방단말링크 open end link 개방급수식조립늑판개방형계측장치격자모양 발판 open grating오픈호저평로강개방이음개항오픈레일 open rail개방정박지개방해역 open sea무개형컨테이너개방형베어링개방형연료밸브개방형추력베어링프로펠러단독효율작동지침 operating instruction작동유펌프작동유섬프탱크작동유보급탱크작동유탱크기관구역무인화설비작동수관작동설명서 operation manual작업공정도표 operation process chart수술실 operation room운항하중 operational load작동시주의사항 operational precaution운용자지침서 operator instruction book대향피스톤형광섬유케이블 optical fiber cable광레이저 optical laser옵티컬로그광센서 optical sensor옵티미스트 급 optimist class

ooze processing equipment     open air condenser    open bevel     open boat      open chock    open circuit voltage    open cycle     

open feed system      

open floor     

open gauging  

open hawser   open hearth steel      open joint      open port      

open roadstead 

open top container     open type bearing      open type fuel valve   open type thrust bearing       open water propeller efficiency 

operating oil pump     operating oil sump tank operating oil supply tank       operating oil tank      operating system for unattended machinery space operating water pipe   

opposed piston type    

optical log     

Page 162: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

최적화 optimizationoptimum design최적흘수형상 optimum water line shape

최적용접순서 optimum welding sequence

오렌지필형그래브버킷파반류차수지령타각스톡앵커

ordinary frame보통꼬임중실원형기둥일반보강재 ordinary stiffenerordinary temperature종선광석운반선광물원유산적화물겸용선 Ore-Bulk-Oil (OBO) ship미송

유기재감속원자로경제협력개발기구오리피스 orifice

주문자상표부착직교함수 orthogonal function직교이방성요소 orthotropic element 직교이방성판 orthotropic plate진동 날개 oscillating hydrofoil진동수주형 공기챔버 oscillating water column동요오실로스코프 oscilloscope오터보드오터트롤러오토사이클외업공장 out door shop

out haul외부하청 out sourcingoutboard선외기 outboard engine선체측면도바깥쪽회전선외축출거outdoor piping겉바닥아우터클램프외항바깥선각

최적 설계

orange peel type grab bucket  orbital wake   order   ordered rudder angle  

ordinary anchor 

일반늑골ordinary lay    ordinary pillar  

상온ordinate ore carrier     

Oregon pine   organic moderated reactor     Organization for Economic Cooperation and Development (OECD)

Original Equipment Manufacturer (OEM)

oscillation      

otter board    otter trawler   Otto cycle      

돛당김줄 선외측

outboard profile outboard rotation       outboard shaft out-docking    옥외배관outer bottom   outer clamp    outer harbor   outer hull      

Page 163: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

아우터지브외측판원형창바깥덮개선외축외측판의장작업계획 outfit planning의장 outfitting의장안벽의장안벽의장일정계획체계의장공장outfitting zone아웃홀공기출구각날개출구각출구속도출력 output출력밀도아웃리치 outreach아웃리거옥외조립장 outside assembly site외측맞댐덧판외측선실바깥지름파스선저복수기바깥지름 outside diameter외판외판바깥발판미해결사항 outstanding item가는항해

과전류방지장치과전류계전기 over current relay넘침 over flow초과속력한계과속력방지 over speed protection과속력방지장치 과전압계전기 over voltage relay종합특성전체치수종합효율

overall evaluation

총합열전달현상검사 overall inspection종합추진효율종합온도상승과평형선외로 overboard

선외불어내기밸브overboard discharge

선외배출관

outer jib       outer plating   outer plug     outer shaft     outer strake   

outfitting basin outfitting quay outfitting scheduling systemoutfitting shop 의장구획out-haul outlet air angle outlet blade angle      outlet velocity 

output density  

outrigger       

outside butt strap      outside cabin   outside calipers       outside condenser      

outside planking outside plating outside staging 

outward voyage over current protection device

over speed limit       

over speed protection device

overall characteristic   overall dimension      overall efficiency       종합평가overall heat transmission       

overall propulsive efficiencyoverall temperature rise over-balance   

overboard blow-off valve      선외배출overboard discharge pipe      

Page 164: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선외배출밸브선외부착품 overboard fitting과충전공진회피운전 overcritical running과팽창넘침제어장치 overflow control system넘침관넘침관장치수선위돌출부분해 overhaul개방검사

overhead cost천장크레인간접비 요소 overhead factors상부장애물 overhead obstruction천장주행 크레인 overhead traveling crane위보기용접 overhead welding과열겹침 overlap겹침 단부 연결 overlapped end connection과부하 overload과부하경보 overload alarm 과부하율과부하운전 overload operation과부하출력과부하방지장치 overload protection device과부하시험과부하정지 overload trip과적 overloading오버라이드과도작동 overshoot과대치수 oversize전복 overturnoverweight선주 owner

선주공급장비선주여분여유 owner's extra margin선주기선주검사원 owner's inspector선주매뉴얼 owner's manual

oxidation산화금속페인트산화염옥스터판산소아세틸렌용접산소아크절단산소농도계산소농도계산소가우징산소랜스산소플라즈마절단 oxygen plasma cuttingoxygen purity산소방출장치

overboard discharge valve     

overcharge     

over-expansion 

overflow pipe  overflow system       overhang       

overhaul inspection    간접비overhead crane 

overheat       

overload fraction 

overload output 

overload test   

override       

중량초과Owner Furnished Equipment (OFE)

owner's flag  

산화oxide paint     oxidizing flame oxter plate     oxyacetylene welding     oxy-arc cutting oxygen analyzer       oxygen content meter  oxygen gouging oxygen lance  

산소순도oxygen supply system 

Page 165: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

산수소용접산소프로판절단오존파괴물질 ozone depleting substance패키지보일러 packaged boiler패킹 packing패킹누르개패킹뽑개패킹피스패킹링패킹나사패킹경화살돋움패들 paddle외륜함외륜선외륜아이플레이트paint dipping도막결함 paint film defect페인트긁개페인트분무기페인트분무기페인트공팰릿 pallet팰릿 자재목록표 Pallet Material List (PML)팜 palm야자밧줄팜스테이냄비머리리벳

파나마운하신호등파나마운하톤수 Panama Canal Tonnage

파나마운하톤수증서파나마촉파나막스급 산적화물선 Panamax bulk carrier파나막스급 유조선 Panamax tanker패널 panel분전상자패널브레이커평블록라인 panel line패널진동패널공사팬팅 panting팬팅작용팬팅구조팬팅보팬팅늑골팬팅스트링거팬터그래프조리기구실 pantry낙하산붙이신호평행부

oxyhydrogen welding   oxypropane cutting     

packing gland  packing hook   packing piece  packing ring   packing screw packing stick   padding 

paddle box     paddle steamer paddle wheel   pad-eye       침적도장paint scraper   paint spray gun     paint sprayer  painter 

palm rope      palm stay      pan head rivet Panama canal signaling light   

Panama Canal Tonnage CertificatePanama chock 

panel board    panel breaker  

panel vibration panel work     

panting action  panting arrangement   panting beam  panting frame  panting stringer pantograph     

parachute signal       parallel body   

Page 166: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

평행류열교환기평행류열교환기축류터빈선체중앙평행부병렬운전 parallel operation 병렬처리 parallel processing평행자병렬운전 parallel running거등권항법병렬식병렬화 parallelization파라베인원형모재패리스법칙 Paris' law

파커라이징소조립 part assembly부분부하

part number

부분차양갑판선부분격벽부분캐비티부분이중저부분거더 partial girder부분만재흘수선 partial load line부분용입용접부분안전계수 partial safety factor부분안전계수법부분선루부분수밀격벽영상 입자 속도 계측단독해손칸막이벽

parts fabricationParts Per Billion (PPB)Parts Per Million (PPM)패스 pass패스순서터빈유로통로 passageway여객 passenger여객실여객선여객 도선 passenger ferry정기여객선여객공용구역 passenger public space여객선 passenger ship

여객선안전증서여객구역 passenger space

parallel flow heat exchanger   parallel flow regenerator       parallel flow turbine    parallel middle body   

parallel ruler   

parallel sailing parallel system 

paravane       parent form    parent metal   

parkerizing     

part load       부품번호partial awning deck vessel     partial bulkhead partial cavities partial double bottom  

partial penetration weldingpartial safety factor methodpartial superstructure  partial watertight bulkhead Particle Image Velocimeter (PIV)particular average      partition wall   부재가공십억분의 일백만분의 일pass sequence passage of turbine     

passenger accommodation      passenger boat 

passenger liner 

passenger ship safety certificate 

Page 167: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

화객선 passenger-cargo ship패치페이턴트로그순시선 patrol boat

목형 pattern원형목형공적재중량 payload피크 peak피크보드피크늑골피크부하피크펜던트피크 응력 peak stress피크탱크피크값 peak value진주채취선펄라이트페데스털 pedestal페데스털롤러피닝해머피닝눈구멍덤카드펜던트 pendant작업등진자식충격시험기침투탐상시험 Penetrant Test (PT)관통개구 penetration hole관통피스 penetration piece용입오동선 pentamaran퍼치 perch충격시험충격용접충격용접이상유체이상기체다공갑판 perforated deck다공판다공링성능보증 performance guarantee성능기준 performance standard

보호도장성능기준성능시험주기 period조우주기종동요주기횡동요주기

period of validity피리어드시스템periodic maintenance

patch  patent log      

pattern patterner       

peak board     peak frame    peak load      peak pendant  

peak tank      

pearl boat      pearlite 

pedestal roller peening hammer       peening peep hole      pelorus 

pendant light   pendulum impact testing machine

penetration     

percussion test percussion welding     percussive welding     perfect fluid   perfect gas    

perforated plate perforated ring 

Performance Standards for Protective Coatings (PSPC)performance test       

period of encounter    period of pitching      period of rolling       유효기간period system  정기적정비

A8600
JHKIM: 횡동요주기
Page 168: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

정기적시험 periodic testingperiodical survey

정기적무인화기관구역주변장치 peripheral devices주변속도펄라이트 perlite고정밸러스트 permanent ballast상설연료고 permanent bunker영구변형 permanent deformation상설경사사다리 permanent inclined ladder

상설접근설비영구변형상비품영구변형률 침수율투자율허용인도지연 permissible delay방사선노출허용용량허용길이허용한계값 permissible limit허용공차 permissible tolerance허용값 permissible value수선 perpendicular

personal allowance엘리베이터 personal lift개인감시장치 personal monitor인명안전 personnel safety투시도관련요소 pertinent factors꼬마콕꼬마밸브하사관Pferd Starke (PS)수소이온농도 pH페하미터페하미터

위상 phase

진상기위상각위상평균 phase averaging상변화 phase change위상제어 phase control상수변환기위상차위상지연위상응답함수검상기상순 phase sequence

정기적검사periodically unattended machinery space

peripheral velocity     

Permanent Means of Access (PMA)permanent set permanent stores      permanent strain permeability    permeability    

permissible exposer    permissible length      

생리여유

perspective drawing    

pet cock       pet valve      petty officer   마력단위 (PS)pH meter      pH testing apparatus   

phase advancer 

phase angle    

phase converter phase difference       phase lag      phase response operator       phase rotation indicator 

Page 169: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

검상기이상위상변화 Phase switch인청동광학마킹광전센서 photo sensor광효과 photo-effect광탄성현미경사진광전위 photo-potential피아노선 piano wire산세척 pickling산세척탱크픽업 센서 pick-up sensor부두 pier안벽계류 pier mooring압전선철안료붙임기둥파일캡파일드라이버파일가이드파일링선필러 pillar

필러/거더구조도원주부표도선사 pilot도선사선도선선교도선의자수로도도선기도선사승강기도선기도선사사다리표시등도선사실도선사대기실파일럿밸브도선료조립식받침목핀연결장치핀지그 설치 pin jig setting조이기 pinching핑거바늘구멍피니언 pinion피니언축도색잡음 pink noise함재정핀틀 pintle핀틀덮개 pintle cover

phase sequence indicator       phase shift     

phosphor bronze       photo marking 

photo-elasticity photo-micrography      

pickling tank   

piezo-electricity pig iron pigment pilaster pile cap pile driver     pile guide      piling barge    

pillar and girder construction profile   pillar buoy      

pilot boat      pilot bridge    pilot chair      pilot chart     pilot flag       pilot hoist      pilot jack      pilot ladder    pilot lamp      pilot room     pilot station    pilot valve     pilotage pin block       pin connection device  

pinger pinhole 

pinion shaft    

pinnace 

Page 170: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

관 pipe배관파이프밴드관굽히개파이프 밧줄걸이 pipe cleat관로파이프대빗관플랜지관걸이관집개파이프아이들러롤러파이프부설선파이프부설부선파이프정렬장치파이프통로배관부속파이프인발장치케이싱파이프압입장치파이프릴파이프 스케줄 pipe schedule관용나사깍개파이프공장파이프지지장치파이프텐셔너관용나사 pipe thread관용나사깍개 pipe threading machine관 통로 pipe trunk

관 터널 pipe tunnel

파이프렌치배관 piping

배관계장계통도배관계통도관장치도 piping plan

배관공사피스톤 piston피스톤면적 piston area피스톤간극 piston clearance피스톤냉각 piston cooling

피스톤냉각용청수냉각기피스톤냉각용청수펌프피스톤냉각유펌프피스톤냉각수펌프피스톤크라운피스톤행정체적피스톤헤드피스톤혼피스톤핀

pipe arrangement      pipe band      pipe bender    

pipe conduit   pipe davit      pipe flange     pipe hanger    pipe holder    pipe idler roller pipe layer      pipe laying barge      pipe line-up station    pipe passage   pipe piece     pipe pulling-out device pipe pushing-down device      pipe reel       

pipe screw cutting machine  pipe shop      pipe supporting gear   pipe tensioner 

pipe wrench   

Piping and Instrumentation Diagram (P & ID)piping diagram 

piping work    

piston cooling fresh water coolerpiston cooling fresh water pumppiston cooling oil pump piston cooling water pump     piston crown   piston displacement    piston head    piston horn    piston pin      

Page 171: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

피스톤펌프 piston pump피스톤링 piston ring피스톤링 홈 piston ring groove

피스톤링착탈공구피스톤로드피스톤용착피스톤스커트피스톤도 piston speed피스톤스프링피스톤밸브피치 pitch종동요 pitch 피치각피치코드비피치원피치게이지피치비피치형판피치계피토관곰보꼴점부식 pitting corrosion피벗 pivot선회축 pivot bearing피벗베어링피벗중심평면브래킷평면항법평테르밋평트롤리평면도 plan

plan approval평면운동장치주 좌표면 plane평면격벽 plane bulkhead회전면대칭면평면위치지시기평면스카프평면변형률 plane strain평면응력 plane stress면적계활주 planing평삭기계현연재플랑크톤네트계획정비제도평삭밀러플랜트 부선플라스마아크절단 plasma arc cutting플라스마 용접 plasma welding

piston ring tensioning tool     piston rod      piston seizing  piston skirt    

piston spring   piston valve    

pitch angle     pitch chord ratio       pitch circle    pitch gauge    pitch ratio     pitch template  pitchometer    Pitot tube  pitted surface appearance      

pivot bearing   pivot point     plain bracket   plain sailing    plain thermit   plain trolley    

도면승인 Planar Motion Mechanism (PMM)

plane of rotation       plane of symmetry     Plane Position Indicator(PPI) plane scarf     

planimeter     

planing machine plank sheer    plankton net   Planned Maintenance Scheme (PMS)planomiller     plant barge    

Page 172: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소성좌굴 plastic buckling소성변형소성류 이론 plastic flow theory소성관절 plastic hinge소성단면계수소성전단면적 plastic shear area유리섬유강화플라스틱선소성상태소성변형률 plastic strain소성역 plastic zone소성판 plate판굽힘롤러판상다이어프램 plate diaphragms판고정변 plate edge clamped판상늑판 plate floors판자유변 plate free edge판이음평판용골판펴기기계판선수재판펴기기계판펴기롤러플레이트형그래브버킷판형열재생기판상스트링거 plated stringer정반 platen플랫폼갑판디딤플랫폼 platform landing판재 plating도금판붙임유람선유람요트플리넘체임버 plenum chamber프림솔표지플로터플로팅장치프라우인 plow-in머리박기플러그 plug플러그구멍플러그 용접 plug welding연직추추선배관부착품 plumbing fixture중간축베어링플런저 plunger플런저펌프플러스나사항행구역제한합판공기제동기공기감쇠력계수

plastic deformation     

plastic section modulus 

plastic ship    plastic state    

plasticity       

plate bending roller    

plate joining plate keel      plate mangle   plate stem     plate straightener      plate straightening roller       plate type grab bucket plate type regenerator 

platform deck  

plating plating pleasure boat  pleasure yacht 

Plimsoll mark       plotter plotting device 

plowing 

plug hole      

plumb bob     plumb line     

plummer block 

plunger pump  plus thread    plying limit     plywood       pneumatic brake       pneumatic damping coefficient

Page 173: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

공기압 모터 pneumatic motor공기압설비공기압리베터공기압관 pneumatic tube

공기압관식화재경보장치공기압변환식 압력계포드추진기 pod propulsion system곶 point방위각 점 point출발점재휘점프아송비손누름점용접극지등급 polar class극도표 polar diagram

polar moment of inertia

극궤도위성업무polarity극성검지장치분극곡선 polarization curve편광극수변환 pole change봉 활대줄 pole lift경비정광택판

오염분류 pollution category

폴리에스터 polyester다상폴리트로픽효율폴리우레탄 polyurethane상자형부선 pontoon부교폰툰해치커버상자형뗏목폰툰형창구덮개선미루 poop선미루갑판선미루전단격벽포핏 poppet포핏압력포핏밸브

porosity포포이징좌현 port항구 port현문 port좌현큰닻배수구덮개좌현부표배수구덮개

pneumatic plant pneumatic riveter      

pneumatic tube fire alarm systempneumatic type pressure gauge 

point of departure      point of recalescence  Poisson's ratio poke welding  

극단면2차모멘트polar orbiting satellite service극성polarity indicator       

polarization    

police boat     polished plate  

polyphase      polytropic efficiency   

pontoon bridge pontoon hatch cover   pontoon raft   pontoon type hatch cover      

poop deck     poop front bulkhead    

poppet pressure poppet valve   기공porpoising     

port bower     port flap       port hand buoy port lid 

Page 174: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

원형창행선항양륙항피난항입항항적하항선적항항만규칙좌현 port side항구하역속력항만국 port state항만국통제 Port State Control (PSC)좌현 택 port tack조립식준설선휴대용가스탐지기휴대식소화기휴대식폼노즐이동식화로휴대등휴대등휴대식계기 portable instrument이동식사다리휴대용전등 portable lamp이동식접근설비 portable means of access이동식기둥이동식펌프휴대용무선장치 portable radio apparatus독립탱크 portable tank

portable type

휴대식자기나침반음료수펌프 portable water pump음료수탱크 portable water tank문형 크레인 portal crane원형창포틀랜드시멘트선위측정장치용접자세자리잡이위치최신화 position-updating양 압력 positive pressure정복원정곡선후열처리후열포스트파나막스급 Post-Panamax용접응력제거 post-weld stress relieving잠재적균열 potential crack퍼텐셜유동퍼텐셜함수잠재적위해요소 potential hazard

port light       port of destination     port of discharge      port of distress port of entry   port of loading port of registry port regulations 

port speed     

portable dredger       portable explosion meter       portable fire extinguisher      portable foam nozzle   portable forge  portable hand lamp portable hand light 

portable ladder 

portable pillar  portable pump 

휴대식portable type magnetic compass 

porthole Portland cement position measuring device      position of weld positioner      

positive righting lever curvePost Weld Heat Treatment (PWHT)post-heating   

potential flow  potential function       

Page 175: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

퍼텐셜반류potentiometer파운딩유동점화약카트리지 powder charge cartridge분말절단powder metallurgy지시동력 power동력작동계통 power actuating system동력계수출력곡선도동력배전반 power distribution panel출력추정역률동력실

동력부하계수전력관리시스템동력계통 power network동력출력부

power panel동력장치동력추정계수동력펌프출력영역방식정격출력 power rating출력비동력원자로출력행정동력인출장치 Power Take-Off (PTO)출력터빈동력장치 power unit출력추정입항허가서정밀선위측정장치정밀음향측심기정밀계측기기불갈퀴예연실계약전협의 pre-contract negotiation 예냉기지배적하중상태 predominant load case

pre-erectionpre-erection outfitting

선행제작부재 prefabricated section

선행제작유니트 prefabricated unit지상조립우선차단예열 preheating예열온도 preheating temperature조기점화 preignition초기설계 preliminary design

potential wake 전위차계pounding       pour point     

powder cutting 분말야금

power coefficient     power curve   

power estimation       power factor   power house   power loading coefficient       Power Management System (PMS)

power output section   동력반power plant    power prediction factor power pump   power range system   

power ratio    power reactor  power stroke  

power turbine  

powering       pratique precise ship position measuring deviceprecision echo sounder precision measuring equipmentprecker bar    pre-combustion chamber 

precooler      

선행탑재선행탑재의장

prefabrication  preference trip 

Page 176: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

preliminary planning예행시운전조기점화premature wear선행의장prerequisites

여객정원preservation design선행축심투시 pre-sighting탄성역변형프레스투토크방식압력각압력경계조건압력계수압력조합 pressure combination

균압형기름전동기압력보상기압력복식터빈압력용기압력조절기압력곡선압력저하압력여과기압력계압력수두내압선각압력지시제어기압력지시기 pressure indicator압력로그압력손실계수강제윤활기압력펌프압력비감압밸브압력조절기 pressure regulator압력도출장치압력도출밸브 pressure relief valve압력저항압력면압력스위치 pressure switch압력탱크 pressure tank

압력탱크급수방식압력단자압력시험가압테르밋용접압력발신기 pressure transmitter

압력식액면계압력진공차단밸브

초기계획preliminary trial premature ignition      조기 마모pre-outfitting    선행조건prescribed number of passenger방식설계pre-springing  press-to-talk system   pressure angle pressure boundary conditionpressure coefficient      

pressure compensated oil-filled motor pressure compensator  pressure compound turbine     pressure container     pressure controller     pressure curve pressure drop  pressure filter pressure gauge pressure head  pressure hull   pressure indicating controller

pressure log   pressure loss coefficient pressure lubricator     pressure pump pressure ratio  pressure reducing valve 

pressure relief arrangement

pressure resistance    pressure side  

pressure tank water service systempressure terminal      pressure test  pressure thermit welding       

pressure type level gauge      pressure vacuum valve 

Page 177: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

압력용기압력용적선도가압수 분무 소화장치균압형기름축전지

Pressure-Vacuum (PV) Valve

압력속도복식터빈압력용적선도가압연료유공급시스템가압방폭기기가압수형원자로가압기전류고정프로펠러날개 pre-swirl stator시운전관련회의 pre-trial conference우세풍

prevent reoccurrence프리벤터가이예방보전 preventive maintenance

예방정비절차primary barrier

primary member

primary stress componentprimary support member

원동기동서권시동준비 priming

시동펌프해양순환모델 Prince Ocean Model (POM)주축주좌표면주요치수

principal factors주요치수주응력중첩원리 principle of superposition인쇄회로기판

pressure vessel Pressure -Volume (PV) diagram    pressure water-spraying fire-extinguishing systempressure-compensated oil-filled battery압력·진공밸브pressure-velocity compounded turbinepressure-volume diagram      pressurized fuel oil supply systempressurized protected apparatus pressurized water reactor      pressurizer     

prevailing wind 재발방지preventer guy  

Preventive Maintenance Schedule (PMS)

1차방벽1차보일러급수펌프 primary boiler feed water

pump 1차냉각재 primary coolant 

1차배전 primary distribution    

1차되먹임 primary feedback      1차지지부재1단피니언 primary pinion 1차전원장치 primary source 1차응력성분1차지지부재1단큰기어 primary wheel 1차연소권 primary zone   

prime mover   prime vertical  

priming pump  

principal axis  principal co-ordinate   principal dimension     주요요소principal particulars    principal stress 

Printed Circuit Board (PCB)

Page 178: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

주형비척계수프리스매틱곡선도나포선 prize

확률밀도함수확률수준 probability level 초과확률 probability of exceedance

process analysisprocess chartprocess control공정흐름 process flowprocess planning처리기 processorprocurement informationprocurement lead timeproducibility석유제품운반선Product Liability (PL)혼류 생산방식 product mixing제품모델링석유제품운반선 product tanker

제품중심작업구분체계production control생산도면 production drawing생산기술 production engineering생산흐름분석 production flow analysis준설토량계생산소요일 Production Need Date (PND)생산중심설계 production oriented designproduction planning선표 production program생성규칙생성시스템production technologyproductive maintenance생산시간 productive time생산성관리단위 productivity control group생산성향상 productivity improvement생산성지표 productivity parameter측면도 profile형강재 profile선체종단면도 profile 형상계수

형강재절단 profile cutting

프로파일모니터프로그램제어공정관리기법프로그램가능 논리제어기전진블록용접법

prismatic coefficient    prismatic curve 

Probability Density Function (PDF)

공정분석공정도표공정관리공정계획구매정보조달기간생산용이성

product carrier 제조물책임product modeling       

Product Work Breakdown Structure (PWBS)생산관리

production meter       

생산계획production rule production system      생산기술생산보전

profile coefficient      

profile monitor program control Program Evaluation and Review Technique (PERT)Programmable Logic Controller (PLC)progressive block welding method

Page 179: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

점진적침수 progressive flooding점증속력시험연속점용접투영횡경사각투영면적 projected area투영면적비날개투영넓이투영도평면도구명줄발사기 발사체투영 projection돌기용접프로젝터나침반산책갑판프로메타센터즉발중성자보증하중검인내력내력시험프로펠러 propeller프로펠러애퍼처프로펠러뒷면프로펠러날개뿌리프로펠러날개단면프로펠러날개두께프로펠러날개끝프로펠러날개폭프로펠러날개프로펠러축캡프로펠러허브 propeller boss프로펠러형상붙이 캡프로펠러허브지름프로펠러허브비프로펠러축덮개프로펠러틈새프로펠러축덮개프로펠러지름프로펠러원판넓이프로펠러효율 propeller efficiency

프로펠러선후효율프로펠러선후효율프로펠러침식프로펠러기진진동수프로펠러선후시험

progressive speed trial progressive spot welding       projected angle of heel or roll 

projected area ratio    projected blade area   projected plan  projected planform     projectile for line-throwing appliances

projection weld projector compass     promenade deck       pro-metacenter 

prompt neutron 

proof load     proof mark     proof stress    proof test      

propeller aperture      propeller back propeller blade root    propeller blade section propeller blade thickness       propeller blade tip     propeller blade width  propeller blade propeller bonnet       

Propeller Boss Cap Fin propeller boss diameter propeller boss ratio    propeller cap  propeller clearance     propeller cone propeller diameter     propeller disc area     

propeller efficiency behind hull propeller efficiency behind ship propeller erosion       propeller exciting frequency    propeller experiment behind model

Page 180: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

프로펠러단독시험프로펠러앞면프로펠러식송풍기프로펠러충전재프로펠러압입력프로펠러후연프로펠러마력프로펠러허브프로펠러심도프로펠러기진력프로펠러 후류 propeller jet프로펠러법칙 propeller law프로펠러전연프로펠러너트단독프로펠러효율프로펠러피치 propeller pitch프로펠러피치비프로펠러평면프로펠러포스트프로펠러앞면프로펠러투영넓이프로펠러압입량프로펠러압입력프로펠러압입거리 propeller push up distance프로펠러압입력 propeller push up load프로펠러후류프로펠러기준선프로펠러발출장치프로펠러축 propeller shaft프로펠러축베어링프로펠러축보싱 propeller shaft bossing

프로펠러축발출장치프로펠러명음프로펠러회전수표시기 propeller speed indicator프로펠러뒷면프로펠러추력프로펠러팁클리어런스프로펠러후연프로펠러형식프로펠러주의등프로펠러워시백

프롭제트비례한도프러포셔너추진 propulsion

propeller experiment in open waterpropeller face  propeller fan   propeller filler propeller fitting force  propeller following edge       propeller horsepower  propeller hub  propeller immersion    propeller induced exciting force 

propeller leading edge propeller nut   propeller open water efficiency 

propeller pitch ratio    propeller plane propeller post  propeller pressure side propeller projected area propeller pull-up length propeller pull-up load  

propeller race  propeller reference line propeller removing device      

propeller shaft bearing 

propeller shaft withdrawal device

propeller singing       

propeller suction side  propeller thrust propeller tip clearance propeller trailing edge propeller types propeller warning signal light  propeller wash back   프로펠러-

선체소용돌이캐비테이션 propeller-hull vortex cavitation prop-jet       proportional limit       proportioner   

Page 181: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

추진보기추진계통제어콘술주기관 propulsion machinery

주기관제어장소추진 장치 propulsion system추진계수추진효율추진 성능 propulsive performance

보호틀붙이온도계선주책임상호보험조합 보호분무장치보호아연 protection zinc보호도장 protective coating보호덮개보호피복 protective covering

방식층방어갑판보호장치 protective device

protocol프로토콜프로톤자력계prototype원형시험 prototype test프로비전 기중기

식량창고냉각펌프식량창고임시증서가선급증서근접스위치 proximity switch의사 진폭 pseudo - amplitude가성캐비테이션선내방송장치 Public Address (PA) system공용실공용실 public space퍼프 puff퍼프포트 puff port막음용접 pug welding도르래맥동공동맥동용접동압과급방식맥동반복수펄스반복주파수동압과급방식미분탄미분쇄기

propulsion auxiliary machinery Propulsion Control Console (PCC)

propulsion machinery control room

propulsive coefficient  propulsive efficiency   

protecting case type thermometerProtection and Indemnity (P & I) Clubprotection spraying apparatus  

protective cover  

protective covering outer sheathprotective deck 

의정서protocol proton magnetometer   원형provision crane provision refrigerator cooling water pump      provision store provisional certificate  provisional classification certificate

pseudo-cavitation      

public room    

pulley  pulsating cavity pulsation welding       pulse operation Pulse Recurrence Rate(PRR) Pulse Repetition on Frequency(PRF) pulse turbo-charging system pulverized coal pulverizer      

Page 182: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

다공링펌프 pump펌프몸통펌프버킷펌프작동압력 pump cut-in pressure펌프준설선펌프레버펌프실 pump room펌프실출입구펌프타워 pump tower

주배수장치도주배수장치도펌프제트펀치 punch펀치테이블각인 punched mark

펀칭시어링기계펀칭기계펀칭틀펑커루버 punkah louver펑커루버환기장치자재주문서 Purchase Order (PO)자재주문요구서

purchased products자동차운반선자동차트럭운반선청정연료관청정연료유탱크청정윤활유관청정윤활유탱크

purifier청정기연료유가열기청정기온수탱크청정기윤활유가열기청정기작동수탱크청정기실기름청정기용청소대사무장건착망어선건착망어선 purse-seiner누름단추 push button밀대밀배푸싱니압입압력 push-up pressure퍼티펌프고온온도계 pyrometer카타르 플렉스 Q-flex카타르 맥스 Q-Max쿼드런트 quadrant쿼드런트대빗쿼드런트틸러

pulverizing ring 

pump barrel    pump bucket   

pump dredger  pump lever    

pump room entrance   

pumping and drainage plan     pumping plan   pump-jet       

punch table    

punching and shearing machine punching machine      punching template      

punkah louver system  

Purchase Order Request (POR)구매품Pure Car Carrier (PCC)Pure Car Truck Carrier (PCTC)purified fuel oil pipe   purified fuel oil tank   purified lubricating oil pipe     purified lubricating oil tank     청정기purifier fuel oil heater purifier hot water tank purifier lubricating oil heater   purifier operating water tank   purifier room purifier workbench     purser purse-seine netter     

push rod       pusher boat    pushing knee   

putty pump    

quadrant davit quadrant tiller  

Page 183: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스펙트럼허수부qualification test인정 품목표 qualified products list품질보증인증서품질관리분임조 quality circlequality control품질결함보고서 quality deficiency reportquality evaluation전파소실역quality standard검역 quarantine검역정박지검역선검역기검역등검역항검역선 quarantine vessel네바퀴도르래선미갑판사분판재측필러선미사파 quartering sea조타수

준추진계수준추진효율접안접촉구역 quay contact region안벽크레인퀜칭 quenching조질 quenching and tempering순간작동 클리트 quick acting cleats신속차단 밸브 quick closing valve순간이탈장치 quick-release arrangement유연성축격리병실 quite room

quotation래빗레이스나이프공전랙선반래킹 racking래킹력레이콘 racon레이더 radar레이더안테나장치주사안테나레이더비콘 radar beacon 레이더부이레이더용해도레이다단면적 Radar Cross Section (RCS)레이더일지레이더마스트레이더 반사기 radar reflector레이더트랜스폰더 radar transponder레이디얼형보트대빗

quadrature spectrum   4열리벳이음 quadruple riveting      자격시험

quality assurance certificate

품질관리품질평가

quality minima 품질기준quarantine anchorage   quarantine boat quarantine flag quarantine light quarantine port 

quardruple block       quarter deck   quarter grain   quarter pillar   

quartermaster  quasi-propulsive coefficient    quasi-propulsive efficiency     

quay crane     

quill shaft      

견적rabbet race knife      racing  rack   rack   

racking force  

radar antenna unit     radar antenna  

radar buoy     radar chart     

radar log    radar mast     

radial boat davit       

Page 184: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

회전대빗레이디얼드릴링머신레이디얼더미 radial dummy레이디얼더미링반지름방향평형반지름방향지느러미식패킹반지름류터빈레이디얼임펠러반지름방향유기속도반지름방향응력반지름방향속도복사열복사손실방열기무선방위신호소무선표식무선표식국라디오부이무선방향탐지기무선방향탐지기무선방위탐지국무선주파수 케이블 radio frequency cable

전자식별무선간섭무선설비 radio installation 무선구명설비무선일지전파항법통신사통신사무선통신담당자 radio personnel무선일지 radio records무선통신규칙 radio regulation무선중계부이

radio room무선전신기무선전신방사선동위원소방사선사진방사선검사방사선투과시험 Radiographic Test (RT)기상관측기구무선전신비상자동수신기무선전신조난주파수무선전화비상자동수신기무선전화조난주파수무선전화조난주파수청취수신기

radial davit    radial drilling machine  

radial dummy ring      radial equilibrium       

radial fin type packing 

radial flow turbine     radial impeller       radial induced velocity radial stress   radial velocity  radiant heat    radiation loss  radiator radio beacon and direction finding station    radio beacon signal    radio beacon station   radio buoy     radio compass Radio Direction Finder (RDF)  radio direction finding station

Radio Frequency IDentification (RFID)radio frequency interference   

radio life saving applianceradio log       radio navigation radio officer   radio operator 

radio relay buoy       무선실radio telegraph radio telegraphy       radioactive isotope     radiograph     radiographic inspection 

radiosonde balloon      radiotelegraph auto alarm      radiotelegraph distress frequencyradiotelephone auto alarm      radiotelephone distress frequencyradiotelephone distress frequency watch receiver     

Page 185: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

무선전화장치반지름 끝단 radius end행동반지름곡률반지름 radius of curvature관성반지름라도제트에어펌프레이돔뗏목 raft목재적재항레일중간문 rail gate불워크사다리철도연락선눈비클러터레인플로우법 rain flow method우량계레인아웃안팎붙임융기갑판저선미루갑판 raised quarter-deck

저선미루선레이크 rake레이크각경사선수램 ram램선수램벌브램 비율램형조타장치 ram type steering gear램제트램프 ramp램프게이트윈치램스보텀링임의접근기억장치랜덤진동레인지 range거리정도거리분해능거리오차측거기마스트등거리눈금유도표복원성범위조석차거리분해능거리범위거리범위스위치거리범위스위치랭킨사이클래스터주사방식쥐막이쥐막이구조수동드릴수동드릴래칫휠장치

radiotelephone equipment      

radius of action 

radius of gyration      Radojet air pump       radome 

raft port       

railing ladder  railway ferry   rain and snow clutter  

rain gauge     rainout raised and sunken system      raised deck    

raised quarter-deck vessel     

rake angle     raked stem    

ram bow       ram bulb       ram ratio      

ram-jet 

ramp gate winch       Ramsbottom ring       Random Access Memory(RAM)random vibration       

range accuracy range discrimination    range error    range finder   range light     range marker  range marks   range of stability       range of tide   range resolution range scale    range selection switch     range selector Rankine cycle  raster-scan system    rat guard      rat proof construction  ratchet brace  ratchet drill    ratchet gearing 

Page 186: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

래칫휠래칫렌치 ratchet wrench용착속도선회율 지시기 rate of turn indicator무게손실률rated current정격출력rated pressure정격값회두각지시기선박부원 rating정격 rating비율제어래틀린등나무방현재원자재 raw material레일리 수 Rayleigh numberRayleigh-Plesset equationreaching리치로드 reach-rod

반력영향계수 반동타반작용응력반동터빈원자로 reactor

원자로격납용기원자로장치원자로정지읽기전용기억장치계산출력점 readout point사용준비상태 ready for use condition실제기체 real gas실해역파 real sea waves참미끄럼비실시간처리실시간경사계측리머 reamer리머볼트리밍 reaming리밍머신재휘점복탄재수신기 receiver수신 receiving

수신공중선공용장치수신실린더

receiving inspection수신기receptacle수용시설 reception facility리세스 recess리세스격벽재충전식축전지 rechargeable battery재충전 recharging상반정리 reciprocal theorem

ratchet wheel       

rate of deposition      

rate of weight loss     정격전류rated output   정격압력rated value    rate-of-turn indicator  

ratio control   ratlines rattan fender   

레일리-플레셋 방정식순행 (측풍범주)

Reaction Influence Number (RIN)reaction rudder reaction stress reaction turbine 

reactor containment vessel     reactor installation     reactor shutdown      Read Only Memory(ROM)

real slip ratio  real-time processing   real-time slope measurement

reamer bolt    

reaming machine       recalescent point       recarburizer    

receiving antenna multi coupler   receiving cylinder      입고검사receiving set   리셉터클recess bulkhead 

Page 187: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

왕복동기관리클레이머 부선재입급재도장간격 re-coating interval공인기관의사결정을 위한 권고추천항로재가압체임버 recompression chamber설비기록부 records of equipment

회수유저장컨테이너회수유저장탱크회수유이송펌프회수하중 recovery load 직교좌표모드 rectangular mode각창정류확산전열식열교환기전열식열교환기붉은불꽃신호광명단 red lead광명단도료좌현등홍등적열취성적조 red tide적조 red water재입거 re-docking리듀서환원염감압밸브경감계수 reduction factor감속기 reduction gear

감속기윤활유감속기윤활유냉각기감속기윤활유중력탱크감속기윤활유펌프감속기윤활유침전탱크감속기윤활유저장탱크감속기윤활유섬프탱크단면수축감속비여분 redundancy레드우드점도계 Redwood viscosimeter암초 reef리프밴드리프크링글

reciprocating engine    reclaimer barge reclassification 

Recognized Organization (RO)recommendation for decision makingrecommendation route  

recovered oil storage container recovered oil storage tank     recovered oil transfer pump    

rectangular window    rectified diffusion      recuperative heat exchanger     recuperator    red flare       

red lead paint  red light      red light       red shortness 

reducer reducing flame reducing valve 

reduction gear lubricating oilreduction gear lubricating oil cooler    reduction gear lubricating oil gravity tank      reduction gear lubricating oil pumpreduction gear lubricating oil settling tank      reduction gear lubricating oil storage tank     reduction gear lubricating oil sump tank reduction of area      reduction ratio 

reef band      reef cringle    

Page 188: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

리프포인트리프태클패치냉동컨테이너 reefer container

냉동컨테이너감시장치냉동운반선 reefer vessel릴릴드리베팅재돌입제트기준주위조건기준좌표계

reference drawing날개단면기준선reference planereference point날개단면기준점참조선참조응력 reference stress상세요소분할 refined mesh미세화부선적국변경 reflagging반사플로터반사부표

반영식자기컴퍼스내화재냉매 refrigerant냉매관냉장 화물창냉장화물선 refrigerated cargo vessel냉장화물선식량냉장고식량냉장고냉동능력냉동실냉동용압축기냉동컨테이너 refrigerating container

냉동컨테이너선refrigerating oil냉동장치냉동톤냉동사이클냉동기냉장고 refrigerator냉동기브라인펌프냉장고로비연료교환쓰레기소각로 refuse furnace

재생식터보프롭기관재생사이클재생식열교환기열교환기선명록 register book

reef point      reef tackle patch       

reefer container monitoring system

reel    reeled riveting re-entrant jets reference ambient conditionreference coordinate system참고도면reference line  기준면기준점reference point reference ship 

refined zone   

reflection plotter       reflector buoy  reflector type magnetic compassrefractory material     

refrigerant pipe refrigerated cargo hold 

refrigerated carrier    refrigerated provision chamber refrigerated provision storerefrigerating capacity  refrigerating chamber  refrigerating compressor       

refrigerating container ship     냉동유refrigerating plant      refrigerating ton       refrigeration cycle     refrigeration machine   

refrigerator brine pump refrigerator lobby      refueling       

regenerated turbo prop engine regenerative cycle     regenerative heat exchanger     regenerator    

Page 189: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

등록폭등록깊이등록총톤수등록마력등록길이등록순톤수등록선등록총톤수 registered tonnage등록

회귀분석 regression analysis보통꼬임규칙파 regular wave조정봉조정기재열계수재열사이클재열로강화절연보강구조보강덧살보강링보강환보강환재초기화 과정 reinitialization procedure불합격재료상대방위상대변위 relative deflection상대건현relative humidity상대운동 relative motion상대운동표시상대운동레이더상대횡동요

상대회전효율상대속력상대변형률 relative strain 상대흘수상대풍향상대풍속완화계전기 relay간접조속기기존용접부절개 release existing seam weld해방장치신뢰성 reliability

신뢰성설계도출밸브 relief valve예비등릴리빙태클재액화장치냉각청수펌프재액화장치냉각해수펌프

registered breadth     registered depth       registered gross tonnage       registered horsepower registered length       registered net tonnage registered ship 

registration    

이탈리아선급 Registro Italiano Navale (RINA)

regular lay     

regulating rod  regulator       reheat factor   reheating cycle reheating furnace      reinforced insulation   reinforced structure    reinforcement  reinforcing ring reinforcing steel band  reinforcing steel hoop  

rejected material       relative bearing 

relative emergence     상대습도relative motion display relative motion radar   relative rolling relative rotative efficiency     relative speed  

relative submergence  relative wind direction    relative wind velocity  relaxation      

relay governor 

releasing device       

Reliability Based Design Optimization (RBDO)

relieving light  relieving tackle reliquefaction plant cooling fresh water pump  reliquefaction plant cooling sea water pump    

Page 190: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

렘잔류자기 remanenceremedial action잉여재관리 remnant control원격조종 remote control원격조종장치

원격조종장치작동시험remote indication원격조작밸브 remote operated valve원격조작 remote operating원격해제 remote release원격측심장치 remote sounding system원격조타장치 remote steering system

무인잠수정해체가능연결부 removable link붕괴열제거렌더링하중 rendering load신환허용기준

renewal of piping정기검사 renewal survey수리 repair결함수리 repair of defect수리선 repair ship보수용접 repair welding수리책임수리 독반복응력반복항복응력 repeated yield리피터 repeaterreplacement parts신선공기 replenishment air안식각 repose angle재처리요구구획지수 required subdivision index구조정 rescue boat구조용사다리구조선 rescue ship연구 반응로해양조사선 research ship예비연료유탱크

보조무선전신설비예비전원 reserve source예비강도 reserve strength예비두께 reserve thickness예비선원예비선원예비선원 reserved seafarers저장소복귀 reset잔존복원정 residual righting lever잔존강도 residual strength잔류응력잉여저항

resilient mounting탄성와셔 resilient washer

rem    

수정조치remote control device  remote control system operation test   원격지시

Remotely Operated Vehicle (ROV)

removal of decay heat 

renewal acceptance criteria배관신환

repairing chief repairing dock repeated stress 

대체부품reprocessing   

rescue ladder  

research reactor       

reserve oil tank      reserve radiotelegraph installation

reserved crew reserved mariner       

reservoir       

residual stress residuary resistance    탄성지지설치

Page 191: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수지 촉 설치 resin chock installation 수지라이너저항 resistance부가물저항저항증가율저항납땜측온저항온도계맞댐저항용접저항능력 resistance capacity 저항계수저항불꽃맞댐용접거칠기저항증가저항추정도표저항조정기저항시험저항용접저항횡동요분해능공진 resonance공명흡수공명통과확률공진하중 resonant loads

resource allocation응답 response

응답진폭함수반응표면법 response surface method휴식용플렛폼 resting platform복원처리 restoration treatment추진력 회복 restore propulsion복원력곡선 restoring curve복원력복원모멘트 restoring moment제한링구속도 restraint intensity제한형계측장치조종성능제한선등제한수역제한수로합력합성압력 resultant pressure파생전류잠금장치 retaining arrangement 회수역반사재 retro-reflective material리턴밴드추종장치투자회수율 Return On Invest (ROI)되돌림관복귀행정

resin liner     

resistance appendage  resistance augment fraction    resistance brazing      resistance bulb thermometer   

resistance butt welding 

resistance coefficient   resistance flash butt weldingresistance increase due to roughness    resistance prediction chart     resistance regulator    resistance test resistance welding     resisted rolling resolution discrimination 

resonance absorption   resonance escape probability   

자원분배Response Amplitude Operator (RAO)

restoring force 

restrained packing ring 

restricted gauging      restricted maneuver light       restricted water restricted waters       resultant force 

resulting current       

retrieval       

return band    return gear    

return pipe     return stroke  

Page 192: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

불꽃되돌림식보일러불꽃되돌림식보일러세관감시선잔향실잔향실잔향음장 reverberation sound field잔향시간역전 reverse

역전감속장치예비부력예비석탄고예비급수탱크예비급수부늑골역전력계전기 reverse power relay

역나선형조종시험역유동역극성예비선원리버서가역성자기역전기관역전클러치역전장치역전손잡이역전표시판역전레버역전시험후진터빈전도식채수기회전계수적산회전계회전계회전수텔레그래프회전방향지시기분당회전수회전자계레이놀즈수레이놀즈 스트레스 난류 모델가감저항기항정선 rhumb line리브안내목침수상태라이더부용골라이더판천막대들보천막줄천막대들보받침줄매기공삭구장치 rigging줄매기비품공장줄매기장치도

return-flame boiler     return-tube boiler      revenue cutter reverberation chamber reverberation room     

reverberation time     

reverse and reduction gear    reverse buoyancy      reverse coal bunker    reverse feed water tank       reverse feed   reverse frame  

reverse spiral maneuvering test reversed flow  reversed polarity       reversed seafarers     reverser       reversibility    reversible engine      reversing clutch reversing gear reversing hand wheel  reversing index reversing lever reversing test  reversing turbine       reversing water bottle revolution coefficient   revolution counter      revolution indicator    revolution telegraph    revolution telltale      Revolutions Per Minute(RPM) revolving field Reynolds number       Reynolds stress turbulence modelrheostat 

rib     ribband riddled condition       rider keelson  rider plate     ridge pole      ridge rope     ridge support  rigger  

rigging loft     rigging plan    

Page 193: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

줄당김나사줄매기비품공장오른편꼬임우회전프로펠러복원팔복원우력복원정 righting lever복원정곡선 righting lever curve복원모멘트강체운동 rigid body motion리지드연결장치고체식구명부기고체식구명동의 rigid type life jacket고체식구명뗏목 rigid type liferaft고체식구조정 rigid type rescue boat복합식구조정 rigid/inflated rescue boat강체연결 rigidly link림리머림드강링볼트환상격벽링윤활기링윤활베어링링윤활기선저구배라이저 riser라이저텐셔너수직소화주관밀물라이징우드위험성 risk위험성허용기준 risk acceptance criteria위험성평가 risk analysis위험성평가 risk assessment위험성기여수목 risk contribution tree위험성제어수단 risk control measure위험성제어방안 risk control option하천운항선하천포함리벳 rivet리벳재리벳머리리벳가열로리벳구멍리벳이음리벳제조기리벳끝리벳이음새리벳몸통리벳구조리벳집개리베팅기계리베팅 riveting리베팅해머리베팅기계정박지로밴드

rigging screw  rigging shop   right hand lay  right handed propeller righting arm   righting couple 

righting moment   

rigid connection device rigid type buoyant apparatus

rim    rimer  rimmed steel   ring bolt       ring bulkhead  ring lubricator ring oiled bearing      ring oiler      rise of floor   

riser tensioner rising fire main rising tide      rising wood    

river boat      river gunboat  

rivet bar       rivet head     rivet heater    rivet hole      rivet joint      rivet making machine      rivet point     rivet seam     rivet shank    rivet structure rivet tongs     riveter 

riveting hammer        riveting machine roadstead      roband 

Page 194: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

쇄암기가이드프레임쇄암용중추쇄암선 rock cutter쇄암 준설선 rock cutter dredger착암부선착암기리더암면 rock wool

암면보온재로커암 rocker arm

로커암윤활유펌프로켓 rocket풀크럼축로켓낙하산신호 rocket parachute signal로켓추진로켓신호풀크럼축로크웰 경도 Rockwell hardness 막대 rod봉요소 rod element압연 roll압연번호횡동요주기 roll period횡동요회전반지름 roll radius of gyration연속점용접롤 베인 roll vane단접압연봉강 rolled bar압연재 rolled product압연강압연면 rolled surface롤러 roller롤러베어링롤러체인롤러촉롤러클리어런스롤러페어리더롤러진수롤러길롤러붙이튜브확장기횡동요 rolling횡동요각 횡동요 촉 회전문 rolling door횡동요 히치 횡동요지시기 횡동요기록기 횡동요버팀 횡동요시험로팩스로로선롤온/롤오프방식

rock breaker guide frame      rock breaking weight   

rock drilling barge     rock drilling machine leader    

rock wool heat insulating material

rocker arm lubricating oil pump 

rocket fulcrum shaft   

rocket propulsion      rocket signal   rocking lever shaft     

roll number    

roll spot welding       

roll welding    

rolled steel    

roller bearing  roller chain    roller chock    roller clearance roller fair-leader       roller launching roller path     roller tube expander   

rolling angle   rolling chock   

rolling hitch    rolling indicator rolling recorder rolling stay    rolling test     Roll-on / Roll-off Passenger (Ro-Pax)roll-on/roll-off (RO/RO) ship   roll-on/roll-off (RO/RO) system 

Page 195: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

실상수난방기뿌리 root뒷면굽힘시험뿌리캐비테이션이뿌리원뿌리끝루트면 root face루트간격 root gap제곱평균실효값 Root Mean Square (RMS)root pass뿌리용입뿌리반지름이면용접루트밸브 root valve루츠송풍기

루츠압축기로프 rope로프벨트로프연결장치로프커터로프방현재로프가드줄매기로프해치줄사다리로프패킹로프스토퍼로로화물구역 ro-ro cargo space로로여객선 ro-ro passenger ship로즈박스로터미터회전식공기펌프벨트컨베이어회전식기관회전식펌프회전소기밸브회전테이블회전본회전식밸브로터리베인압축기 rotary vane compressor

회전베인형 조타기회전베인진공펌프 rotary vane vacuum pump

회전드럼열교환기회전식무선표지회전식경계신호등로테이터로터 rotor로터드럼로터축로터이동공구로터선로터축개략배치도

room constant  room heater   

root bend test  root cavitation root circle     root edge      

초층용접root penetration root radius     root running   

Roots blower   Roots displacement compressor  

rope belt       rope connection device rope cutter    rope fender    rope guard     rope handling  rope hatch     rope ladder    rope packing   rope stopper   

rose box       rotameter      rotary air pump rotary conveyor rotary engine  rotary pump   rotary scavenging valve rotary table    rotary template rotary valve   

rotary vane type steering gear

rotary-drum regenerator       rotating radio beacon  rotating type warning signal lightrotator 

rotor drum     rotor shaft     rotor shifter   rotor ship      rotor spindle   rough arrangement     

Page 196: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

거친바다거친면거칠기 roughness거칠기허용값거칠기계수거칠기저항초벌검사round bar원형격자원형선미라운드턴캠버원형거널원형거널항로routine inspection일상보전 routine maintenance와셔조정 rowing노젓는배노걸이로열백스테이로열리프트로열마스트로열스테이로열야드고무코팅 rubber coating고무호스 rubber hose고무라이닝축 rubber lining shaft슬래브용골러빙스트립러빙스트립쓰레기 배출구 rubbish shoot타 rudder타각조정타각 rudder angle타각지시기타면적타 암러더캐리어 rudder carrier타커플링타방향타력 rudder force타골재타 거전타두재타 힌지러더혼로킹핀틀타심재타 단독 실험 rudder open water test선회식추진장치 rudder peller propulsion응급타체인타핀틀타피트타판타주 rudder post쿼드런트

rough sea      rough surface  

roughness allowance   roughness coefficient   roughness resistance   rough-turn inspection  환봉round bar grating round stern    round turn     round up of beam      rounded gunnel rounded gunwale       route  일상점검rove   

rowing boat    rowlock royal backstay royal lift       royal mast     royal stay      royal yard     

rubbing keel   rubbing strake rubbing strip   

rudder adjustment      

rudder angle indicator  rudder area    rudder arm     

rudder coupling  rudder directions       

rudder frame   rudder gudgeon rudder head    rudder hinge   rudder horn    rudder locking pintle   rudder main piece      

rudder pendant chain   rudder pintle   rudder pit      rudder plate   

rudder quadrant 

Page 197: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

타두재타 스토퍼러더트렁크타형규칙기반시스템규칙 계산 rule calculation 선급규칙길이 rule length규칙 치수 rule scantling경험에 의한 상식 rules of thumb패스 run폭주런어바우트수직사다리발판 rung러너running항해용 뒷당김줄 running back stay움직도르래이동 좌표계 running coordinate 운항비헐거운맞춤움직맞춤운전표시기 running indicator항해등 running light항해등제어반해상수리동삭running stock소모품움직줄길들이기조정운전떨림 run-out재고소진기간 run-out time회전변류기파열판 rupture disk파단시험

녹 rust

녹부풀음녹연결방청유 rust-proof oil희생관 sacrifice pipe희생 양극 sacrificial anode새들블록안장판안전거리 safe distance

자기컴퍼스안전거리safe load안전항해 safe navigation 안전수위 safe water level안전케이지 safety cage안전캡안전칼라안전통신 safety communication안전차단 장치 safety cut-out device

rudder stock   rudder stopper rudder trunk   rudder types   rule based system     

run away      run-about      

runner 주행 (순풍범주)

running block  

running cost  running fit     running fix     

running light indicator  running repair  running rigging 운용재고running stores running wire   running-in trial 

run-rotary converter    

rupture test    

러시아 선급 Russian Maritime Register of Shipping (RS)

rust blister     

rust joint       

saddle block   saddle strap   

safe distance of magnetic compass안전하중

safety cap     safety collar   

Page 198: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

안전장치안전설비증서안전등가성 safety equivalence 안전평가 safety evaluation안전계수안전유리

safety goggles안전덮개 safety guard

안전절연변압기안전등안전링크항해안전 safety of navigation

안전무선전신증서안전봉안전스테이

safety stock안전장치 safety system안전밸브 safety valve

안전밸브올림기어안전밸브올림기어안전밸브봉쇄안전전압안전사용하중 Safety Working Load (SWL)새깅 sagging도장흘림 sagging and running돛 sail돛창고돛장치도범선항법 sailing항해상태 sailing condition항행지침 sailing directions출항허가범선 sailing ship

기범선범선 sailing vessel선원 sailor살로그염분 salinity

검염계 salinometer염분계통검염밸브연어송어공장선연어송어잡이모선살롱염장선해난구조 salvage샐비지펌프 salvage pump구난배수장치해난구조선 salvage ship

safety device  safety equipment certificate    

safety factor   safety glass    보호안경safety isolating transformer    safety lamp    safety link     

Safety Radiotelegraphy (SR) certificate    safety rod     safety stay     안전재고safety valve easing gear       safety valve lifting gear safety valve setting    safety voltage  

sail locker     sail plan       

sailing permit  

sailing ship with auxiliary engine  

sal log 

염분-온도-수심기록기 salinity temperature depth recorder

salinometer pot salinometer valve      salmon and trout factory ship  salmon and trout mother ship  saloon salting carrier  

salvage pump unit      

Page 199: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

통선등시료채취연기탐지장치 시료채취용배관표본채취위치 sampling point샘슨포스트모래밸러스트모래톱샌드빈샌드블라스트 sand blast모래반목모래상자모래운반선샌드콤팩션 부선모래분배장치샌드드레인선모래시계모래누름장치샌드호퍼샌드드레인선모래펌프준설선모래뿌림선모래면게이지샌드위치구조 sandwich structure위생수 sanitary위생배수구 sanitary discharge

위생청수탱크위생의장품위생파이프위생펌프위생해수탱크위생탱크위생배관공사백목질 sapwood새시 sash새시도어

위성통신장치위성비상조난위치발신기포화증기 saturated steam포화증기관

saturation temperature세이볼트퓨롤세이볼트유니버설발판 scaffold발판설치 scaffolding erection발판철거 scaffolding removal스케일 scale척도 scale척도효과눈금밝기조정눈금판축척비

sampan signaling light sample extraction smoke detection systemsampling line   

Samson post   sand ballast    sand bank      sand bin       

sand block     sand box       sand carrier    sand compaction barge  sand distributing device sand drain barge       sand glass     sand hold down device sand hopper   sand piling barge      sand pump dredger    sand spreader  sand top level gauge   

sanitary fresh water tank      sanitary outfit  sanitary pipe   sanitary pump  sanitary sea water tank sanitary tank   sanitary worker 

sash door      

위성통신 SATellite COMmunication (SATCOM)satellite communication system satellite EPIRB 

saturated steam pipe   포화온도saybolt furol(SSF) saybolt universal(SSU)

scale effect    scale illumination control       scale plate     scale ratio     

Page 200: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

녹털기봉녹털이망치관석생성률스캘럽치수 scantling치수기준 scantling criteria강도계산용흘수치수계수스카프이음 scarf스카프용접스카핑 scarfing스카핑브래킷 scarfing bracket스카프이음스카프커플링스카프절삭기소기통로소기통로소기 scavenging

소기실화재경보소기모음소기용송풍기 scavenging blow소기효율소기공소기펌프소기행정소기밸브스케줄 schedule

schedule impactscheduling일정계획및 관리 scheduling and control스키마 schema

배관계통도 schematic piping diagram

스쿠너 schooner스팬가이스쿠너범장 schooner rig과학적 관리법 scientific management섬광계수기스쿠프 scoop스코치보일러정찰함비상정지스크랩스크래치 scratch스크린 screen선등가리개칸막이격벽걸름효과스크루형압축기 screw compressor나사식컨베이어나사깍기기계나사조임식 체크밸브나사게이지 screw gauge나사식잭

scaling bar     scaling hammer scaling rate    scallop 

scantling draft       scantling number       

scarf weld     

scarp scarped coupling      scarping machine     scavenge air belt      scavenge air passage  

scavenging air box fire alarm     scavenging air receiver 

scavenging efficiency  scavenging port scavenging pump       scavenging stroke      scavenging valve       

공정영향일정계획

schooner guy  

scintillation counter    

Scotch boiler   scout  scram  scrap  

screen board   screen bulkhead        screening effect 

screw conveyor screw cutting machine Screw Down Non-Return (SDNR) valve

screw jack     

Page 201: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스크루플러그나선프로펠러 screw propeller나선추진기선스크루펌프 screw pump프로펠러축몽키스패너나사버팀나사식조타장치스터드볼트나사식닻줄멈추개몽키스패너나사식플랜지나사식유니언나가깍기기계스크라이브보드자국칼스크러버 scrubber

scrubber unit자급기잠수호흡기순주스컬식기세척대 scullery수면불어내기콕물때접시물때접시수면불어내기밸브갑판배수구 scupper현창sea area A1sea area A2sea area A3sea area A4해수흡입구 sea chest

해수흡입구청소밸브해수흡입격자해수흡입격자해면반사해수콕씨컬러급 sea color class해상상태해수연결입사파방향해수배출 sea discharge씨호퍼급 sea hopper class해수흡입 sea inlet친항성시마진해리해수압 sea pressure해난보고서파랑등급 sea scale파랑빈도분포 sea scatter diagram물튀김막항해속력해상상태

screw plug     

screw propeller ship     

screw shaft    screw spanner screw stay     screw steering gear    screw stud     screw type chain stopper      screw wrench  screwed flange screwed union screwing machine      scribe board   scribe knife    

가스세정기scuba  scudding       scull   

scum cock     scum dish      scum pan      scum valve    

scuttle 시-앵커 sea anchor     A1해역A2해역A3해역A4해역

sea chest cleaning valve       sea chest grating      sea chest grid sea clutter     sea cock       

sea condition   sea connection sea direction   

sea kindness   sea margin     sea mile       

sea protest    

sea screen     sea speed      sea state       

Page 202: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

해수흡입밸브해상시운전 sea trial해상시운전속력해수밸브해수여과기물소화장치해수압력탱크해수윤활식선미관베어링해수관해수압력탱크해수서비스펌프해수여과기해저자원탐사선해저광물채취선선원대양운항 seagoing항해상태 seagoing condition항해성능원양선내항성누설방지용접 seal weld물개잡이배밀봉 sealing밀봉용 공기 sealing air밀봉용 물이음매 seam심 seam심 용접선원운용술선원법 Seamen Act

해기면장이음매없는관 seamless pipe일체형 돛 seamless sail이음매없는관수상기모함수색및 구조 search & rescue탐조등 searchlight시효균열동기계절대시효처리거치대 seating자리파기 링감항성좌현큰닻

second independent means

second moment of inertiasecond source of energysecond systemsecondary

sea suction valve      

sea trial speed sea valve sea water filter sea water fire extinguishing system sea water hydrophore unit   sea water lubricated stern tube bearing sea water pipe sea water pressure tank       sea water service pump sea water strainer     seabed exploring ship  seabed mining ship     seafarers      

seagoing qualities     seagoing vessel       seakeeping     

sealer  

sealing water  

seam welding  seaman seamanship    

seamen's competency certificate

seamless tube  seaplane carrier 

season crack   seasonal winter zone   seasoning      

seating ring    seaworthiness  second bower  제2갑판 second deck   제2 독립수단 단면2차모멘트 second moment of area 관성2차모멘트

2차에너지원제2의 계통 2차측2차방벽 secondary barrier       2차전지 secondary battery      

Page 203: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

단면 section구전반단면계수 section modulus형강단면보기 section view

단면적계수단면적곡선조합보일러섹셔널헤더분호손잡이고박설비 securing arrangement고박장치 securing device고정판 securing plate침전물 sediment침전물받이침전물받이침전물받이오물인양용 대빗 sediment davit제거콘분리밸러스트탱크편석 segregation시징로프선택차단자연발화 self ignition자기발연신호자동조절식드래그헤드자정작용 self-cleaning자동폐쇄형 self-closing자동폐쇄밸브자기기전식 self-contained

자장식공기흡입구갑판승강형굴착선자기점화등자연발화온도 self-ignition temperature자력제어자기마모형도료자기마모형도료자흡식펌프 self-priming pump자항상태 self-propelled condition

그래브붙이자항운반선

2차전지 secondary cell 2차냉각공기 secondary cooling air  2차배전 secondary distribution  

2차기전력 secondary electro motive force (2nd EMF)

2차유동 secondary flow       2차손실 secondary loss 2차부재 secondary member     2단피니언 secondary pinion       2차전원 secondary source      

section board  

section steel   

sectional area coefficient      sectional area curve   sectional boiler sectional header       sector secure hand    

sediment box  sediment chamber      sediment collector     

Seger cone    Segregated Ballast Tank (SBT)

seizing rope   selective trip   

self-activating smoke signalself-adjustable type drag head 

self-closing valve      

self-contained air-breathing apparatusself-elevating drilling unit      self-igniting light      

self-operated control   Self-Polishing Copolymer (SPC)Self-Polishing Copolymer (SPC)

self-propelling grab hopper barge

Page 204: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

자항계수자항시험자기조절오뚝이형구명정자체하역설비 self-unloading cargo gear세마포르신호세미킬드강준선미기관선반자동용접반평형타중조립단계 블록 semi-block반상자형보반조립크랭크축반원차 semicircular deviation반밀폐사이클세미컨테이너선 semi-container ship소구기관세미멤브레인탱크 semi-membrane tank반문형기중기저온압력식 가스운반선세미 스패이드 타 semi-spade rudder반분리 유한요소법 semi-splitting FEM습식선대반잠수식시추선반잠수식플랫폼반 잠수선 semi-submersible ship세미탠덤방식 semi-tandem 세미윙블레이드송신장치센하우스슬립센스안테나감도현열감도 sensitivity감도조정감도시간조정박리유동분리기

sequence of welding

순차근사최적화순차제어순차동작 sequential operation

순차이차계획법sequential start

직렬흐름터빈직렬용접직권직류발전기세레이션서비스볼트항해상태

self-propulsion factor  self-propulsion test    self-regulation self-righting type life boat     

semaphore     semi killed steel       semi-after engined vessel      semi-automatic welding semi-balanced rudder  

semibox beam semi-built-up crankshaft       

semi-closed cycle      

semi-diesel engine     

semi-portal crane      semi-pressurized gas carrier

semi-submerged slipway       semi-submersible drilling rigsemi-submersible platform     

semi-wing blade       sending set    senhouse slip  sense antenna  sensibility      sensible heat   

sensitivity control      Sensitivity Time Control (STC)separated flow separator 용접순서sequential approximate optimizationsequential control      

sequential quadratic programming순차기동시리즈선 건조 series construction of shipseries flow turbine     series welding series wound dynamo  serration       service bolt    service condition       

Page 205: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

특기사항 service feature유효기간 service life서비스록업무구역 service spaces운항속력 service speed서비스탱크사용한계상태 serviceability limit state사용 servicing줄밀기망치서보날개 servo vane서보식제어서보기구서보모터날개날올림설정값정정시간침전탱크준비시간 set-up time오수 sewage오수집합탱크오수배출장치

sewage disposal오수펌프오수흡입장치오수탱크분뇨처리장치 sewage treatment plant육분의섀클 shackle섀클볼트차양갑판섀도핀불감구역축 shaft축계정렬축각축베어링선미관통함축브래킷 shaft bracket축브레이크축심투시축콘파트축커플링감축운전시험축계접지장치

shaft eccentricity축기진력축계접지장치샤프트가드 shaft guard샤프트행어축마력 Shaft HorsePower (SHP)축마력계축심깊이 shaft immersion축심깊이비축선축라이너축자유회전방지장치

service lock    

service tank   

serving mallet  

servo-actuated control servo-mechanism      servo-motor   set-back       setpoint setting time    settling tank   

sewage collecting tank sewage discharge apparatus    오수처리sewage pump  sewage suction apparatus      sewage tank       

sextant 

shackle bolt    shade deck    shadow pin    shadow section 

shaft alignment shaft angle     shaft bearing   shaft box      

shaft brake    shaft center sighting  shaft cone part shaft coupling  shaft cut-off test      shaft earthing device   축편심shaft force     shaft grounding device 

shaft hanger   

shaft horsepower meter 

shaft immersion ratio  shaft line      shaft liner     shaft locking device    

Page 206: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

축출력계축동력축경사축밀봉장치 shaft seal축슬리브축받이대축로축관축로축발출계획서 shaft withdrawal plan축계 shafting축계장치도축전달효율셰이크다운기진기천수 shallow water얕은수로천수효과 shallow water effect천수파 형상물 shape형강 shape형상함수 shape function유형단면셰이핑머신저온동결법전단 shear전단능력 shear capacity전단력 shear force전단력수정 shear force correction전단력곡선전단파괴전단지연전단탄성계수전단강도 shear strength전단응력전단진동전단기피복갑판피복선피복시브쉐더판 shedder plate현호 sheer선미현호선수현호현호선측면선도현측후판 sheer strake전단절단자국 sheering burrs조정줄 sheet예비앵커시트밴드판굽히개얇은층캐비테이션박판 sheet metalsheet metal forming박강판조정줄 고정구 sheet stopper

shaft output meter     shaft power    shaft rake      

shaft sleeve    shaft stool     shaft trunk     shaft tube      shaft tunnel    

shafting arrangement   shafting efficiency      shake-down    shaker 

shallow water channel 

shallow water wave 

shaped section shaping machine       sharp freezing 

shear force curve   shear fracture  shear lag      shear modulus 

shear stress   shear vibration shearing machine      sheathed deck sheathed vessel sheathing      sheave 

sheer aft       sheer forward  sheer line      sheer plan     

sheet anchor   sheet band     sheet bender   sheet cavitation 

판금성형sheet steel     

Page 207: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

시트트래블러갑판보받침대 shelf스툴정판 shelf plate외판 shell쉘엔튜브형열교환기현측문 shell door외각 shell envelop외판전개도 shell expansion plan외판부착물 shell fitting외판늑골 shell frame외판러그외판차랑갑판차랑갑판선보호된수역 sheltered water아연피복법막이판피복 아크용접피복아크용접봉피복아크용접피복가스 shielding gas회항 shift횡이음띄우기조선윈치해치빔이송펌프시프팅보드 shifting-board시프팅보드버팀기둥높이조절판 shim plate중성자제어봉자갈밸러스트선박해체업자선체중심선선구상선박건조계약 ship construction contract조타실제어콘솔 Ship Control Console (SCC)

ship conversion

선박지구국선박방식연결등함운용지침서선박검사증서선박검사선체운동 ship motion선번수리조선소 ship repair yard선박보고제도 ship reporting system선박안전법선박보안경보시스템잡용공기압축기잡용공기탱크선체횡단면

sheet traveler  

shell & tube heat exchanger

shell lug       shell plate    shelter deck   shelter decker 

sheradizing     shield plate    Shielded Metal Arc Welding (SMAW)shielded-arc electrode shielded-arc welding   

shift of butts   shifting and mooring winch     shifting beam  shifting pump  

shifting-board stanchion 

shim rod       shingle ballast ship breaker   ship center line ship chandler  

선박개조Ship Earth Station(SES) ship illumination lamp  Ship Information Book (SIB)ship inspection certificate      ship inspection 

ship number   

Ship Safety Law       Ship Security Alert System (SSAS)ship service air compressor    ship service air reservoir      ship shape     

Page 208: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

조선용강재 ship steel조선용강판선체강도선체구조선박 대 선박 ship to ship선박톤수ship type

선내소화장치선내소각 shipboard incineration

선박산업안전보건 프로그램선박기름오염비상계획선박적재부선 shipborne barge선내항해기구선박용 비자기적 수단조선소적하선주하송인해수침입 shipping of water선적지시서선박통행신호소일반용보기호종선저액체화학품산적운반선액화가스산적 운반선선구선등선용항해일지선박 인원배치 ship's manning선박직원전파식선박속력측정장치선체부착밸브 shipside valve조난선조선목공 shipwright조선목공장 shipwright shop조선소 shipyard모래톱완충기충격펄스감시 shock pulse monitoring충격파 shock wave무충격입사슈피스쓰레기구멍공장 shop공장부하정보 shop loading information숍프라이머 shop primer육상시험공장시운전지주 shore

ship steel plate ship strength   ship structure  

ship tonnage   선종shipboard fire-extinguishing system

Shipboard Occupational Health and Safety Program (SOHSP)Shipboard Oil Pollution Emergency Plan (SOPEP)

shipborne navigational aidsshipborne non-magnetic meansshipbuilder     shipment       shipowner      shipper 

Shipping Order(SO) shipping traffic control signal station   ship's auxiliary machinery    ship's bell    ship's bottom ships carrying liquefied chemicals in bulkships carrying liquefied gases in bulkship's fitting  ship's light   ship's logbook 

ship's personnel      ship's speed radio measuring equipment

shipwreck    

shoal  shock absorber 

shock-free entry       shoe piece     shoot  

shop test      shop trial    

Page 209: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

육상무선장치 shore based radio system육상연결구 shore connection선외급전상자육상시설 shore facility쇼어경도 Shore hardness선외급전 shore power receiving육상대선박 shore to ship 육상 기지국 shore-based facilities육상정비 shore-based maintenance쇼어링 shoring쇼트비드 short bead단성연료소진단락 short circuit단락전류단락보호장치 short circuit protectionshort circuit test단락스위치단기간항해 short duration voyage단늑판

단거리국제항해쇼트링크쇼트스테이단구간푸리에변환단거리항해 short voyage저수위단파정해양파

shot숏블라스팅 shot blasting숏피닝 shot peening어깨탱크수축여유수축균열수축박음 shrinkage fitting수축여유 shrinkage margin주물자주물자수축응력슈라우드 shroud슈라우드 사슬고정판 shroud chain plate슈라우드 밧줄선 shroud lines보호된날개슈라우드프로펠러정체장치누름쇠분권발전기분권조정기분권직류발전기정지 shutdown차단밸브셔틀탱커 shuttle tanker병실현측팔현측장갑

shore connection box  

short blast     short bunker   

short circuit current    

단락시험short circuiting switch 

short floor frame      short international voyage      short link      short stay      Short Time Fourier Transform (STFT)

short water    short-crested seas     체인 1연shoulder tank  shrinkage allowance    shrinkage crack 

shrinkage rule shrinkage scale shrinkage stress       

shrouded blade 

shrouded propeller     

shrouding device       shrouding ring shunt generator shunt regulator shunt wound dynamo 

shutoff valve   

sick bay       side arm       side armor     

Page 210: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

측판용골옆굽힘시험빌지블록선저선측 side bottom 현측연료고선측내장창구측면연재선저복수기측면도측면필릿용접선측늑골측거더 side girder현측개폐호퍼선측갑판실측내용골옆진수선측종늑골side opening현측차양측판재화문현측램프 side ramp현창 side scuttle현창안덮개현창바깥덮개선측외판 side shell외판베이스 side shell base선측외판문 side shell door선측외판선측지주선측내장사이드스토퍼선측스트링거사이드스러스터선측트랜스버스세류각선측빌지홈선측외륜선현등 sidelight현등격판사이드라인윈치표류옆진수폭관찰유리구멍 sight glass 눈구멍방위날개관찰용개구 sighting ports시그마용접신호 signal호종푸른불꽃신호신호서신호기신호등호출부호신호표시등붉은불꽃신호

side bar keel  side bend test  side block     

side bunker    side ceiling    side coaming   side condenser side elevation  side fillet welding      side frame     

side hopper barge     side house     side keelson   side launching  side longitudinal 현측개구side owning    side plate      side port       

side scuttle blind       side scuttle plug       

side shell plate side shore     side sparring   side stopper   side stringer   side thruster   side transverse side wash angle side water course  side wheel steamer    

sidelight screen       sideline winch sideslip sideway launching      siding  

sight hole      sight vane     

SIGMA welding 

signal bell     signal blue light signal code book       signal flag     signal lamp    signal letter    signal light indicator   signal red light 

Page 211: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

신호야드기적신호등탐조신호등유의파고유의파주기 침묵시간소음기실리콘제어정류기실크룸문턱오탁방지막 silt protector은납땜은납땜카플링 silver brazing coupling은납땜상사모형상사성상사성단순보이론 simple beam theory

단순가스터빈사이클단식여과기단식노즐분무기단식타단식여과기간이계산 simplified calculation간략화된 피로해석단순지지 simply supported심프슨공식

simulation시뮬레이션 기반 설계울림단동기관단동펌프단묘박독방싱글베벨홈단식도르래단저 single bottom

단저구조단저거더 single bottom girder

단선접지식단일제어장치 single control device단기통기관편면개선 single groove편면홈용접단일적하상태 single loading pattern

단식용접기단상단판타일점계류 Single Point Mooring (SPM)

signal yard     signaling light for air horn     signaling searchlight   significant wave height significant wave period  silence periods silencer Silicon Controlled Rectifier (SCR)silk room      sill     

silver alloy brazing     

silver soldering similar model  similarity       similitude      

simple gas-turbine cycle       simplex filter  simplex nozzle atomizer simplex rudder simplex strainer 

simplified fatigue analysis

Simpson's rule 모사 Simulation Based Design (SBD)singing single acting engine    single acting pump     single anchor mooring  single berth cabin      single bevel groove    single block    

single bottom construction     

1단침대 single bunk    single conductor earthed system

single cylinder engine  

single groove welding  1단난간 single handrail 

single operator welding machinesingle phase   single plate rudder     

Page 212: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

일점계류부이단극스위치단공미끄럼밸브단기통펌프

단일횡동요진폭 single roll amplitude single screw ship

단면전단단측파대통신방식 Single Side Band (SSB)한쪽흡입임펠러단일저장에너지 단일스팬일반보강재단단

single strake 단일중첩 single summation단연크랭크축단선식배선방식

싱크 sink싱커사이렌시로코존방식시스터훅자매선현장용접 site welding치수효과필릿크기스케그 skeg스케그타 skeg rudder골조도알몸배수량조립늑판얇은스패너스켈프스케치판스큐 skew스큐각스큐베벨기어스큐범위스큐비스큐백 skew-back

스큐유기축방향변위스키드보스키드갑판

skid plate스키프 skiff스키밍 skimming외판 skin

Single Point Mooring (SPM) buoysingle pole switch      single ported slide valve       single pump    

1단감속장치 single reduction gear   1열리벳이음 single riveted joint     1열리베팅 single riveting 

1축선1축선 single screw vessel    

single shear    

single sided impeller   single source of stored energysingle span ordinary stiffenersingle stage    

1조의 강판single throw crankshaft single wire system     편면제이(J)형홈 single-J groove 편면유(U)형홈 single-U groove       편면브이(V)형홈 single-V groove       

sinker  siren   sirrocozone system    sister hook    sister ship     

size effect       size of fillet weld      

skeleton diagram       skeleton displacement    skeleton floor  skeleton spanner       skelp  sketch plate    

skew angle    skew bevel gear       skew extent   skew ratio     

skew-induced axial displacementskid beam      skid deck      활판

Page 213: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

표면마찰 skin friction표면마찰저항마찰유효마력표면마찰저항띔용접스킵잭어선소형선선장스커트 skirt스커트판 skirt plate걸레받이상공파천창 skylight천창개폐장치천창개폐장치슬래브 slab코르크판슬래브용골분탄슬랙적하 slack load게조슬래그 slag슬래그망치슬래그혼입슬래그울슬래밍슬래핑종국대형해머마루판받침슬리브 sleeve슬리브이음 sleeve joint

슬리브식신축관이음슬리브밸브세장비선회식크레인선회식파일드라이버불갈퀴봉슬라이드블록슬라이더 slider이동캠축식이동실린더왕복동기관미닫이문미끄럼틀슬라이딩 다중격자기법미닫이수밀문 sliding watertight door진수미끄럼대저농축연료보트걸이훅슬링걸이장치슬립 slip슬립각역류슬립볼트슬립율슬립훅

skin friction resistance skin horse power      skin resistance skip welding   skipjack pole and line  skipper 

skirting board  sky wave      

skylight operating gear skylight quadrant       

slab cork      slab keel       slack coal      

slack water    

slag hammer   slag inclusion  slag wool      slamming       slapping slave station   sledge hammer sleeper 

sleeve type expansion pipe joint  sleeve valve   slenderness ratio       slewing crane  slewing type pile driver slice bar       slide block     

sliding cam shaft type sliding cylinder double acting engine   sliding door    sliding frame   sliding multiblock technique

sliding way    slight enriched fuel    sling hook     sling wire handling device      

slip angle      slip back       slip bolt slip factor     slip hook       

Page 214: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

슬립비슬립링프로펠러후류미끄럼방지발판삽입경납땜플랜지삽입용접플랜지슬라이드블록 slipper선대 slipway선대진수슬루프 sloop슬루푸범장 sloop rig슬롭탱크기울기 slope슬로프얼라인먼트슬로프보링경사판 sloping plate적하램프 sloping ramp슬로싱 sloshing슬로싱모드효과 sloshing mode effect슬롯 slot작은 구멍 slot hole슬롯용접홈파인거더홈파인웨브슬로팅기계장주기표류운동 slow drift motion감속 slowdown슬러지 sludge슬러지관슬러지펌프슬러지탱크 sludge tank슬러깅미닫이밸브소병기고 small arms locker좌현큰닻나사버팀소형관식 보일러최소수선면적쌍동선흠집 smear스미스수정스미스효과연기실연색도연기댐퍼 smoke damper연기탐지장치 smoke detection system연기탐지기방연헬멧매연지시기 smoke indicator

연관식화재경보장치연막연관 smoke tube연관식보일러흡연실매끈한면평수구역 smooth water area평수구역 항해

slip ratio       slip ring       slip stream     slip-free surfaces underfootslip-on brazing flange  slip-on welding flange 

slipway launching      

slop tank      

slope alignment slope boring   

slot welding    slotted girder  slotted web    slotting machine 

sludge pipe    sludge pump   

slugging sluice valve    

small bower    small stay      small tube type boiler  Small Water plane Area Twin Hull (SWATH)

Smith correction       Smith effect    smoke box     smoke chart   

smoke detector smoke helmet  

smoke pipe fire alarm system  smoke screen  

smoke tube boiler      smoking room  smooth surface 

smooth water area navigation

Page 215: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소화증기관S-N curve 둥근머리리벳자동걸쇠 snap shackle개폐식도르래누설밸브스닙 snip스닙끝스나이프급 snipe class

미국조선학회대한조선학회소켓 socket박스스패너소다콕

sodium vapor light소프트패킹소프트패치심층혼합처리선연납소프트 토 soft toe연수연질목재소프트웨어공학진흙함률계오수관

solar battery태양열 이득 solar heat gain땜납땜질 soldering납땜인두압력단자전자밸브 solenoid valve솔피스 solepieceSol-Gel Method고체밸러스트일체주물일체크랭크인발관실체늑판단재늑골고체연료무공기분사일체형부품의 돌출부 solid part protrusion중실기둥단판늑골일체프로펠러중실축

반도체식압력계반도체식온도계중실원형기둥경화제이송펌프

smothering steam pipe 에스-엔 선도snap head rivet 

snatch block   sniffing valve  

snip end       

Society of Naval Architects & Marine Engineers (SNAME)Society of Naval Architects of Korea (SNAK)

socket spanner soda cock      나트륨등soft packing    soft patch      soft seabed solidifying barge   soft solder     

soft water     soft wood      software engineering   soil concentration meter       soil pipe       태양전지solder  

soldering iron  solderless terminal     

졸-겔법solid ballast    solid casting   solid crank     solid drawn tube       solid floor     solid frame    solid fuel      solid injection  

solid pillar     solid plate frame       solid propeller solid shaft     solid state type pressure gauge solid state type thermometer   solid tubular pillar     solidifying material transfer pump

Page 216: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

솔리디티고립파용해도음향탐지기 sonar음탐장비실 sonar equipment room초음파발광수트 soot수트블로어 soot blower소르바이트 sorbite에스오에스흡음차음 sound insulation

방음구조방음문음향인텐시티소음계음향파워레벨음력식전화기음압레벨방음문방음재

음향수신장치 sound reception system

음향신호 sound signal음향신호장치 sound signal appliances

음향차폐지수음향전달손실 sound transmission loss측심 sounding측심판측심도표측심연축심기측심관측심봉측심자측심표소스 source소스분포법 source distribution method스페이스 히터 space heater스페이서 spacer간격 spacing스페이드타 spade rudder스팬 span스팬가이스팬포인트스팽커 spanker스패너멈추개원주부표선창내장재스파바니시예비앵커예비소화제 spare charge

solidity solitary wave  solubility       

sono-luminescence     

SOS    sound absorption    

sound insulation construction   sound insulation door  sound intensity sound level meter      sound power level     sound powered telephone      sound pressure level   sound proof door      sound proof material   

Sound Transmission Class (STC)

sounding board sounding diagram      sounding lead  sounding machine      sounding pipe  sounding rod   sounding scale sounding table 

span guy       span point     

spanner guard spar buoy      spar ceiling    spar varnish   spare anchor   

Page 217: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

예비석탄고예비품예비실불꽃막이스파크분배기스파크간격스파크점화기점화플러그선창내장재공간정확도 spatial accuracyspatial analysis공간 푸리에 변환 spatial Fourier transform튕김 spatter튕김손실전성관특별해역특수분류구역 special category space

특수유연와이어로프특수용도선특수강정기검사연료소비율비중

specific heat

정압비열정적비열절대습도비출력비속력비체적비중시방서 specification안경형 보스스펙터클 플랜지 spectacle flange안경형선미골재안경형축브래킷스펙터클맹플랜지 spectacle-blank flange스펙트럼해석 spectral analysis스펙트럴 방법 spectral method스펙트럼 spectrum스펙트럼레벨속력 speed

속력 및 거리측정장치 속력계수속력표주속력오차수정기속력오차조속기 speed governor속장비선속계선속저하전진속력 speed of advance

spare coal bunker      spare parts    spare room    spark arrester spark distributor       spark gap      spark igniter   spark plug     sparring 

공간해석spatter loss    speaking tube  special area    

special flexible wire rope      special purpose ship    special steel   special survey Specific Fuel Consumption (SFC)specific gravity 비열specific heat at constant pressurespecific heat at constant volumespecific humidity       specific power specific speed specific volume specific weight 

spectacle bossing      

spectacle stern frame  spectacle type shaft bracket   

spectrum level 

speed and distance measuring devicespeed coefficient       speed cone    speed error corrector  speed error    

speed length ratio   speed log      speed loss     

Page 218: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

프로펠러전진속력대지속력감속속력텔레그래프속력시험속력시운전속력계아연구형탱크 spherical tank범킨슈피겔철스피것 spigot스피것이음누설손실누설멈추개스필탱크가감밸브부유유수인입장치스핀들 spindle스핀들축스핀들토크스피니커 spinnaker 스피니커 봉 spinnaker pole스파이럴베벨기어나선형컬럼 spiral column나선형덕트 spiral duct나선형조종시험스파이럴프로펠러와선형스프링수준기내부요판물튀김막이스플라이스스플라인 spline스플라인축방풍격벽분할난방분할핀스플릿프라이머리형감속장치스플릿세컨더리형감속장치양력감소장치바퀴살스펀지꼴내다지 sponson내다지보내다지갑판자연연소자연발화스풀피스 spool piece점가열

spot inspection점용접분무도장 spray coating

speed of advance of a propellerspeed over the ground speed reduction speed telegraph speed test     speed trial     speedometer    spelter 

spider  Spiegeleisen   

spigot joint    spill loss       spill strip      spill tank      spill valve     spilled oil collecting device    

spindle axis    spindle torque 

spiral bevel gear       

spiral maneuvering test spiral propeller spiral spring   spirit level     spirketting     splash proof   splice  

spline shaft    splinter bulkhead       split heating   split pin split primary type reduction gearsplit secondary type reduction gearspoiler spoke  spongy surface appearance     

sponson beam  sponson deck  spontaneous combustion spontaneous ignition   

spot heating   현장검사spot welding   

Page 219: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

분무노즐물보라막이살수펌프물보라저항사수식 spray type물보라막이띠동체기준면간거리 spread활주대가로지주버팀재 spreader버팀재 칩컵 spreader chip cup버팀재 관통 막대 spreader through bar스프링완충기스프링라인스프링안전밸브스프링강대사리스프링와셔스프링잉살수전살수장치체인홈바퀴스퍼드 spud스퍼드캐리지스퍼드갠트리스퍼드승강장치스퍼드홀더스퍼드키퍼스퍼드웰스퍼드윈치스퍼드와이어로프꼬임올패킹평톱니바퀴평톱니큰바퀴물막이판자직각자 squaresquare bar각강격자평행부각형홈부망어선가로돛배가로돛분할스테이션각형선미각나사직각도 squareness밀어굽히개바구니형

세인트로렌스시웨이신호등복원성 stability안정성 stability

조종성미분계수복원력곡선도북쪽상방표시북쪽상방표시

spray nozzle   spray proof    spray pump    spray resistance       

spray-strip     

spread shore   

spring buffer   spring line     spring safety valve     spring steel    spring tide     spring washer  springing       sprinkler head sprinkler system       sprocket wheel spud carriage  spud gantry    spud hoisting equipment spud holder    spud keeper   spud well      spud winch    spud wire rope spun yarn packing      spur gear      spur wheel     spurn water    

4각봉square bar grating     square body square groove square netter  square rigged vessel   square sail     square station  square stern   square thread  

squeezer       squirrel cage type     St. Lawrence sea way signal light산부난의 단면2차모멘트 St.Venant's moment of inertia

stability and control derivatives stability curve stabilized display       stabilized PPI  

Page 220: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

감요장치안정평형단 stage발디딤판 stage

도시단효율단효율단내부효율발판판자단압력단온도지그재그단속필릿용접지그재그리베팅엇갈림관배치지그재그용접 staggered welding

staging정체점정체압력스테인레스강 Stainless Steel (STS)계단실 staircasestairway이해당사자 stakeholder실속스톨링하중 stalling load형단조지지대 stanchion스탠드파이프스탠드파이프스탠드롤러스탠드식자기나침반표준점검항목표 standard check list표준나침반표준상태표준설계 standard design표준편차표준화재시험

선박소방설비기준선박구명설비기준선박방화구조기준선박설비기준표준담수표준호깅상태표준자기나침반 standard magnetic compass스탠드파이프기준압력계표준저선미루갑판 standard quarter deck

표준새깅상태표준해수표준단면형재

stabilizer       stable equilibrium      

stage diagram efficiency       stage efficiency stage internal efficiency stage plank    stage pressure stage temperature      staggered intermittent fillet weldstaggered riveting      staggered tube layout  

작업대stagnation point stagnation pressure    

계단stall   

stamp forging  

stand column   stand pipe     stand roller    stand type magnetic compass  

standard compass      standard condition      

standard deviation      standard fire test      standard for ship fire-fighting appliancesstandard for ship life-saving appliancesStandard for Ship's Construction for Fire Protectionstandard for ship's facilitiesstandard fresh water   standard hogging condition     

standard pillar standard pressure gauge       

standard sagging condition     standard salt water    standard section       

Page 221: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

표준현호표준선표준시방서 standard specificationstandard timestandard tolerance표준전압 standard voltage

표준전압방식표준파와이어게이지규격 Standard Wire Gauge (SWG)표준화 standardization표준시운전표준검정기예비발전기예비기예비전원대기장치 stand-by unit고정줄지지용 줄장치 standing rigging고정줄정상파고정줄꺽쇠성형결선우현 starboard우현큰닻우현부표우현 starboard side우현 택 starboard tack기동기시동공기 starting air시동용공기압축기시동공기분배관 starting air distributor시동용공기관시동공기압력 starting air pressure시동공기탱크시동공기밸브용접 착수완료탭 starting and runoff tabs시동장치 starting arrangement시동캠 starting cam기동전류 starting current 시동장치시동조작 starting operation시동서보모터시동장치시동시험시동용 변압기 starting transformer시동밸브상태점정적 static정전기 static electricity정적연료소비량정하중정압 static pressure정적복원력 static stability정적탱크압력 static tank pressure정적시험정지추력계수

standard sheer standard ship  

표준시표준공차standard voltage system       standard wave 

standardization trial    standardizing box      stand-by generator    stand-by machine     stand-by power 

standing line   

standing rigging standing wave standing wire  staple  star connection 

starboard bower anchor starboard hand buoy   

starter 

starting air compressor 

starting air pipe 

starting air reservoir   starting air valve       

starting gear   

starting servo-motor   starting system starting test    

starting valve  state point      

static fuel consumption static load     

static test      static thrust coefficient 

Page 222: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

정압과급방식정적평형정적복원력무선국 station스테이션 station비상배치표 station bill정상파정치용접기통계해석 statistical analysis

통계적에너지해석법통계적품질관리통계적파랑빈도분포 statistical wave scatter고정자 stator고정자날개고정자날개고정자권선법정갑판선법정건현법정예비품 statutory spare parts스테이볼트스테이세일지주관스테디 steady정상캐비티스테디정상유동스탠드파이프정상상태 steady state최소크리프율정상영역정상선회안정선정상풍정상영역정상선회지름 steady-turning diameter스텔스기술 stealth technology증기 steam증기축적기증기분사추기통기기정증기보일러증기열량계증기실증기모임통증기소비량증기실린더증기돔증기드럼증기기관증기발생장치 steam generating system증기발생기증기글랜드증기해머

static turbo-charging pressure systemstatical balancing       statical stability 

stationary wave stationary welding machine     

Statistical Energy Analysis(SEA) statistical quality control

stator blade    stator vane    stator winding  statutory deck line     statutory freeboard     

stay bolt       stay sail       stay tube      

steady cavities steady course       steady flow    steady pipe    

steady state creep rate steady state zone  steady turning steady vessel  steady wind    steady zone    

steam accumulator     steam blast    steam bleeding steam blow    steam boat     steam boiler   steam calorimeter      steam chest    steam collector steam consumption     steam cylinder steam dome    steam drum    steam engine  

steam generator       steam gland    steam hammer 

Page 223: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

증기난방기증기가열코일증기가열관기적증기정증기미터증기관증기압력 steam pressure증기압력계증기방열기증기리시버증기왕복동기관 steam reciprocating engine수증기분리기드럼기선증기사이렌증기소화장치증기실증기여과기증기표증기트랩증기터빈 steam turbine증기터빈선기적증기윈치증기양묘기증기요트증기세척 steaming증기압상승시험강 steel강재적치장강제브래킷steel casting강제 심 steel core강재절단 steel cutting강갑판 steel deck강제갑판실강제창구덮개강제호저강괴강재주문 steel ordering강관

고압배관용탄소강관저온배관용강관강판강선강재적치장 steel stockyard고정식작업대 steel tower scaffold강관강선 steel wire강선외장강재적치장최속강하법 steepest descent method조타성능조종식덕트프로펠러조타성능 steerage

steam heater   steam heating coil     steam heating pipe     steam horn    steam launch   steam meter   steam pipe     

steam pressure gauge  steam radiator steam receiver 

steam separator drum      steam ship     steam siren    steam smothering system      steam space   steam strainer steam table    steam trap     

steam turbine ship     steam whistle  steam winch   steam windlass steam yacht    

steaming test  

steel bay   steel bracket   주강

steel deck house       steel hatch cover      steel hawser   steel ingot     

steel pipe      Steel Pipes For High Pressure Service (STS)Steel Pipes for Low Temperature Service (SPLT)steel plate     steel ship      

steel tube      

steel wire armor      steel yard      

steerability     steerable ducted propeller     

Page 224: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

보통여객 steerage passenger보통여객실최저타효속력조타 steering조타장치조타장치조타체인조타나침반조타기관조타기 steering gear조타기경보조타기실 steering gear compartment조타기실 steering gear room조타시험조타레버 steering lever조타목표등키잡이노조타명령조타발판조타쿼드런트조타봉조타실수직타조타발판조타장치 steering system조타텔레그래프steering test조타틸러조타륜조타줄선수재 stem선수보호쇠선수재이음쇠스텝각스텝가이드후진용접법감속기어 step-down gear강압변압기스티븐슨밸브장치유단격벽유단드럼증속기 step-up gear

증속기윤활유펌프승압변압기살균소독기 sterilizer선미 stern중형닻선미관통함선미벌브선미관베어링부시스턴슈트선미구조 stern construction

선미구조도선미단벌브선미재 stern frame선미게이트 stern gate

steerage passenger room      steerage way  

steering apparatus     steering arrangement   steering chain  steering compass      steering engine 

steering gear alarm    

steering gear test      

steering light  steering oar    steering order steering pedestal       steering quadrant      steering rod   steering room  steering rudder steering stand  

steering telegraph      조타시험steering tiller  steering wheel steering wire  

stem band     stem shoe     step angle     step guide     step-back welding     

step-down transformer Stephenson's valve gear      stepped bulkhead      stepped drum  

step-up gear lubricating oil pumpstep-up transformer    

stern anchor   stern box      stern bulb      stern bush      stern chute    

stern construction profile      stern end bulb 

Page 225: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선미관글랜드 stern gland선미등스턴라인 stern line스턴라인윈치선미보호쇠선미램프 stern ramp선미케이블바퀴선미스러스터 stern thruster선미관 stern tube선미관베어링 stern tube bearing선미관베어링케이스선미관베어링부시선미관부시선미관구획실 stern tube compartment선미관냉각용청수탱크선미관글랜드 stern tube gland선미관글랜드패킹 stern tube gland packing선미관글랜드선미관윤활유냉각기선미관윤활유중력탱크선미관윤활유펌프선미관윤활유섬프탱크선미관너트선미관수밀장치선미관수밀장치선미관시트선미관축선미점성경계층선미복도선미파선미외륜선타주주방원보강판 stiffened plate보강재 stiffener보강구조 배치 stiffening arrangement강성 stiffness강성행렬 stiffness matrix무풍공기저항정수 still water

정수중굽힘모멘트정수중하중 still water load정수중전단력 still water shear force 스팅어 stinger스팅어히치보강봉

stock allowance스톡앵커스톡리스 앵커 stockless anchorstocktaking화부실불때기장치

stern light     

stern line winch stern molding  

stern sheave   

stern tube bearing case stern tube bearing shell stern tube bush     

stern tube cooling water tank

stern tube gland    stern tube lubricating oil cooler stern tube lubricating oil gravity tank     stern tube lubricating oil pump stern tube lubricating oil sump tankstern tube nut stern tube sealing device      stern tube sealing      stern tube seat stern tube shaft stern viscous boundary layerstern walk     stern wave     stern wheel steamer   sternpost      steward 

still air resistance      

Still Water Bending Moment (SWBM)

stinger hitch   stirrup 가공여유stock anchor   

재고조사stokehold      stoker 

Page 226: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스토크스파불때는시보기돌운반선석취관스툴 stool스툴저부 stool bottom스툴정판 stool top plate멈추개 stop정지콕스톱홀 stop hole정지밸브물막음멈추개정지거리정지시간 stopping time축전지절단부재보관 storage of cut parts적하장소저장탱크저장품실 store room저장에너지 stored energy선용품 stores풍우밀 커버 storm cover스톰레일 storm rail스톰레일브래킷스톰세일스톰밸브적하 stowage재화용적재화계수적하율화물적재도적하검사밀항자 stowaway일직선정렬직형직선형선정극성직선선수일축형 straight through

직류연소실직재바로잡기직선안정성변형률 strain변형에너지여과기변형경화스트레인게이지변형률속도 strain rate여과기 strainer여과판 strainer plate스트레이크 strake

부현측후판스트랜드 strand

stranding

Stokes' wave stoking indicator       stone carrier   stone catcher  

stop cock      

stop valve     stop water     stopper stopping distance      

storage battery 

storage space  storage tank   

storm rail bracket      storm sail      storm valve    

stowage capacity       stowage factor stowage factor stowage plan   stowage survey 

straight alignment      straight compound     straight lined vessel   straight polarity straight stem   

straight through combustion chamber   straight timber straightening   straight-line stability   

strain energy  strain gauge   strain hardening strain meter   

strake below sheer strake     

좌초

Page 227: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스트랩연결짚매트종통재 streak줄꼴캐비테이션중형닻흐름속핵유선 streamline중묘줄 streamline유선흐름유선타유선형퍼텐셜반류강도 strength강도기준 strength criteria강력갑판강도흘수강도건현보강 strengthening보강링응력 stress응력진폭 stress amplitude

stress analysis응력조합 stress combination응력집중 stress concentration

응력집중계수응력부식 stress corrosion 응력부식균열 stress corrosion crack진동응력응력피로응력확대계수 stress intensity factor응력범위 stress range 응력비 stress ratio응력재분배 stress redistribution 응력감소 stress reduction응력완화 stress relaxation

응력제거열처리응력제거구급용 들것 stretcher조정나사타격판 striking plate스티링비드스트링거 stringer스트링거비드스트링거판선행도장 stripe coat잔유관스트리핑펌프 stripping pump행정 stroke행정체적행정안지름비뒷댐특설보

strapped joint  straw mattress 

streak cavitation       stream anchor stream nuclei  

streamline flow streamline rudder      

streamline shape       

streamline wake      

strength deck  strength draft  strength freeboard     

strengthening ring      

응력해석Stress Concentration Factor (SCF)

stress due to vibration stress fatigue  

stress relief heat treatment    stress relieving 응력-변형률선도 stress-strain diagram  

stretching screw       

string bead    

stringer bead  stringer plate  

stripping pipe 

stroke volume  stroke-bore ratio      strong back    strong beam   

Page 228: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

양고리줄스토롤수 Strouhal number구조격벽 structural bulkhead구조적용량 structural capacity구조상세 structural detail구조열화 structural deterioration구조잉여성 structural redundancy구조시험 structural test

상부구조structure borne noise정렬중첩격자 structured chimera grid여과기스트럿 strut스트럿베어링스트럿설치각스트럿단면뒤틀림각스트럿사이각스터드 stud스터드볼트스터드링크체인스터드용접 stud welding스터드용접기 stud welding machine스터드리스체인스터핑박스 stuffing box패킹누르개중조립분기회로subcontracting costsubcontracting management구획 subdivision격벽배치 subdivision arrangement구획갑판 subdivision deck구획지수 subdivision index구획길이 subdivision length구획만재흘수선구획요건 subdivision requirement구획요건 subdivision rule동결 온도잠수함 submarine잠수함모선잠수함구난함수중신호잠수함모함 submarine tender (AS)서브머지드아크용접선저복수기수중준설펌프서브머지드아크용접잠수선 submerged ship캐비테이션제어잠수준설선착저형굴착선

잠수조사선수중운동체 submersibles기준미달선 substandard vessel과도 부식 substantial corrosion

substation

strop   

structure above upper deck    고체전달소음strum box      

strut bearing   strut-arm angle strut-arm section angle strut-vee angle 

stud bolt   stud link chain 

studless link chain     

stuffing box gland      sub-assembly  sub-circuit     외주비용외주관리

subdivision load line   

sub-freezing air temperature

submarine depot ship  submarine rescue ship (ASR)submarine signal       

submerged arc welding (SAW) submerged condenser  submerged dredge pump       submerged melt welding       

submergence control   submersible dredger   submersible drilling unit submersible research vehicle   

변전소

Page 229: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수면아래파형successive ship흡입 suction

흡배기밸브랩핑공구석취관펌프준설선흡입여과기 suction filter흡입가스기관흡입가스발생기

suction head흡입래더흡입관흡입펌프흡입측흡입행정흡입밸브흡입웰 suction well수에즈운하 Suez Canal수에즈운하타수에즈운하탐조등수에즈운하신호등수에즈운하톤수 Suez Canal tonnage

수에즈운하톤수증서스웨즈막스급 탱커 Suezmax tanker황밴드황 배출 통제지역황산화물 Sulfur Oxides (SOx)황프린트하기건현표시하기만재흘수선하기탱크하기목재만재흘수선하계구역섬프탱크 sump tank일광갑판햇빛막이천막저선수루갑판저선수루선저선수루저선미루선 sunken poop vessel저선미루암초저선루선행탑재블록 super block완전캐비테이션 super cavitation완전캐비테이션흐름완전캐비테이션프로펠러초대형드레드노트급함과열기화물감독

자재대체 substitution of the materialssubsurface wave       후속선suction and exhaust valve lapping tool suction cleanout suction dredger 

suction gas engine     suction gas producer   흡입수두suction ladder  suction pipe    suction pump   suction side   suction stroke  suction valve   

Suez Canal rudder     Suez Canal SearchLight (SCSL) Suez Canal signaling light     

Suez Canal tonnage certificate 

sulfur band    Sulfur Emission Control Areas (SECA)

sulfur print    summer freeboard mark Summer Load Water Line (SLWL)summer tank   summer timber load line       summer zone  

sun deck       sun screen     sunken forecastle deck sunken forecastle vessel       sunken forecastle      

sunken poop   sunken rock   sunken superstructure  

super cavitation flow   super cavitation propeller super dread naught      super heater    supercargo     

Page 230: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

과급기관 supercharged engine과급기과급 supercharging과급송풍기과급펌프초전도 전자추진초다듬질과열증기중첩법 superimposition method감독 superintendent선주감독기사과포화증기초음파탐상기초음속 난류모델 supersonic turbulent flow

초음파식유량계초음파액면계선루 superstructure선루갑판초대형유조선 supertanker완전공기공급흐름완전공기공급감독자훈련 supervisory training

예비비상조명장치 보충급수 supplementary feed

부급수밸브추가절연공급관보급함급기통풍기보급선 supply vessel지주용 캡 support cap보조선 support ship지지용 블록 supporting block수면불어내기콕수면불어내기밸브수상선표면복수기표면균열 surface crack표면결함표면효과 surface effect표면효과 선 Surface Effect Ship (SES)표면기진력표면마찰표면계표면연마기표면열전달표면점화표면검사표면모니터수면관통형 터널 프로펠러

supercharger   

supercharging blower  supercharging pump    super-conducting electric propulsionsuper-finishing  superheated steam     

superintendent engineer supersaturated steam   supersonic flaw detector   

supersonic type flow meter    supersonic type level gauge    

superstructure deck    

super-ventilated flow    super-ventilation 

supplementary emergency lighting

supplementary feed valve      supplementary insulation       supply pipe    supply ship    supply ventilating fan  

surface blow off cock   surface blow off valve  surface boat   surface condenser     

surface defect 

surface force  surface friction surface gauge  surface grinder surface heat transmission      surface ignition surface inspection      surface monitor surface piercing propeller in tunnel

Page 231: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

정반전처리 및 도장면적비표면거칠기표면보간법 surface spline정반표면장력표면온도계전처리등급 surface treatment grade함대공유도탄함대함유도탄전후동요 surge서지선서지탱크선의주위요소 surrounding mesh검사 survey

제조중검사탐사계검사보고서측량선검사원 surveyor생존정 survival craft

생존정용레이더트랜스폰더구명복 survival suit

현수식파일타워suspended solid서스펜션암서스펜션로드서스펜션와이어벌집정반스웨지격벽 swage bulkhead베이어닛꼭지제수격벽 swash bulkhead제수격벽 swash plate좌우동요 sway가로진동받이 sway brace관 방진기 sway brace스웨트파이프너울 swell스웰컴펜세이터파랑계너울등급팽윤 swelling 감도시간조정스윙앵커스윙블록선회붐하역법선회붐시스템스윙체크밸브 swing check valve준설폭설정장치스윙윈치스윙와이어로프

surface plate   surface preparation and paintingsurface ratio   surface roughness      

surface table   surface tension surface thermometer   

Surface-to-Air Missile (SAM)Surface-to-Surface Missile (SSM)

surge line      surge tank     surgeon 

survey during construction     survey meter  survey report  surveying ship 

survival craft radar transponder 

suspended pile driving tower   부유물질suspension arm   suspension rod suspension wire swage block   

swan base     

sweat pipe     

swell compensator     swell meter    swell scale     

swept gain control     swing anchor  swing block    swing boom method    swing boom system    

swing range indicator  swing winch   swing wire rope       

Page 232: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선회붐하역법수반각 swirl error와류분무기선회날개스위치함전환콕표시모드스위치스위치장치배전반 switchboard스위블 swivel스위블도르래스위블훅스위블이음 swivel joint대칭식날개배열싱크로 synchro동기발전기동기검정기동기동기동기발전기동기전동기동기속력협동상승효과 synergy effect합성섬유 synthetic fiber시스템분석시스템설계제어편차시스템 식별법작동유 system oil시스템 기반 설계 system oriented design보조제어판테이블식자기나침반표정건현 tabular freeboard회전계택 tack택크링글택구멍가용접태킹태클선회지름선회시운전선미난간 taffrail꼬리도르래테일로드프로펠러축 tail shaft누기밸브쌍방향통신확성장치 talk back system수지검수원하역사무소탠덤아티큘레이티드형감속장치탠덤건조법탠덤컴파운드터빈탠덤진수

swinging method       

swirl type atomizer    swirl vane     switch box     switch cock    switch for mode of presentation switch gear    

swivel block   swivel hook    

symmetrical blading    

synchro generator      synchro scope  synchronism   synchronization synchronous generator synchronous motor     synchronous speed     

system analysis system design system deviation       system identification method

tab     table type magnetic compass   

tachometer     

tack cringle    tack hole      tack welding   tacking tackle  tactical diameter       tactical trial    

tail block      tail rod 

tail valve      

tallow  tally man      tally office     tandem articulated type reduction gear tandem building system tandem compound turbine      tandem launching       

Page 233: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

탠덤프로펠러회전방향유기속도접선응력탱크 tank탱크세정시설 tank cleaning facility탱크클리닝가열기탱크청소구탱크세정용개구 tank cleaning opening탱크클리닝펌프탱크청소장치수조시험탱크가열코일탱크가열관탱크 과압 tank overpressure이중저측면브래킷 tank side bracket내저판 tank top탱크정판탱커탱크세정 tank washing탱크내적재탱커 tanker

탱커구조협의회탭볼트줄자 tape measure테이퍼 taper테이퍼볼트테이퍼게이지테이퍼핀경사비 taper ratio테이퍼날개테이퍼드럼테이퍼라이너경사날개 tapered wing테이퍼링브래킷 tapering bracket태핏로드태핑기타르 tar타르시멘트표적물 target목표탐지회수표적선표적강도 Target Strength (TS)목표내구연한 target useful life타폴린타르로프토트와이어장치테일러도표 Taylor chart

선수벌브테일러횡단면적계수테일러의지름계수

tandem propeller       tangential induced velocity     tangential stress       

tank cleaning heater   tank cleaning hole 

tank cleaning pump    tank cleaning system   tank experiment 

tank heating coil       

tank heating pipe      

tank top plate  tank vessel    

tankage 

Tanker Structure Cooperative Forum (TSCF)tap bolt 

taper bolt      taper gauge    taper pin       

tapered blade  tapered drum  tapered liner  

tappet rod     tapping machine 

tar cement     

target data rate target ship     

tarpaulin       tarred rope    taut wire measuring gear      

Taylor sectional area coefficient for bulbous bow      Taylor's advance coefficient  

Page 234: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

테일러의동력계수체비셰프공식티 크립퍼 tea clipper인열시험 tear test티 tee

해양무선중계부이텔레그래프 telegraph텔레그래프로거텔레모터신축마스트신축관텔레비젼 감시장치 television surveillance 표시계 telltale매달린나침반집합경보및 신호표시장치 telltale system가열굽힘시험템퍼색온도감지쵸크 temperature chalk온도등급온도조절기온도수정편차온도경보기온도감시장치 temperature monitor온도상승 temperature rise

온도상승계수온도상승비온도엔트로피선도템퍼링 tempering

templatetemplate for bending

임시변경증임시사다리고정장치임시항행검사증

temporary repair

임시비상전원인성보급선 tender중두선장부 tenon인장하중 tensile load인장강도인장응력인장 tension인장부재인장시험자동계선윈치

tentative rule좀조개단자 terminal

Taylor's power coefficient    Tchebycheff's rule    

telecommunication relay buoy  

telegraph logger       telemotor      telescopic mast telescopic pipe 

telltale compass 

temper bend test       temper color   

temperature class      temperature controller temperature correction temperature deviation alarm    

temperature rise coefficient    temperature rise ratio  temperature-entropy diagram   

형판곡작업용 형판temporary alteration certificatetemporary ladder suspension equipment temporary navigation certificate임시수리temporary source of emergency power tenacity 

tender vessel  

tensile strength tensile stress  

tension member tension test    tension winch  잠정규칙teredo 

Page 235: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

단자반단자함단말 termination

지상파무선항해시스템tertiary stress시험콕 test cock내염시험 test for flame retardance테스트 해머 test hammer시험수두 test head검사구멍 test hole시험하중 test load시험기 test machine시험용배전반 test panel시험편 test piece시험압력 test pressuretest specimen세오돌라이트 theodolite이론적목두께 theoretical throattheory spray ratio열용량 thermal capacity열전도율 thermal conductivity열사이클링 thermal cycling온도성층파괴 thermal de-stratification열탐지기 thermal detector열효율 thermal efficiency열팽창 thermal expansionthermal insulation

방열구조방열문 thermal insulation door열중성자 thermal neutron열매체유 thermal oil

열매체유순환펌프열매체유배기가스이코노마이저열매체유가열기열매체유설비 thermal oil installation열매체유관 thermal oil pipe열출력보온구 thermal protective aids온도비 thermal ratio열중성자로 thermal reactor배기받이 thermal receiver열차폐 thermal shield열충격 thermal shock열해석 thermal simulation열성층 thermal stratification열응력 thermal stress테르밋 thermit테르밋용접 thermit welding온도감지페인트 thermo paint열전대 thermocouple열전대온도계열역학 thermodynamics

열역학적효율

terminal block  terminal box   

terrestrial radio navigation system

3차응력

시험편

이론도포율

방열thermal insulation construction

thermal oil circulating pump    thermal oil exhaust gas economizer    thermal oil heater      

thermal power 

thermocouple thermometer     

thermodynamics efficiency     

Page 236: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

열가공제어강열연화성플라스틱절연케이블열경화수지 thermosetting온도자동조절장치 thermostat온도감지팽창밸브난방용공기가열기 thermo-tank후판 thick plate

자발적추가두께두께게이지 thickness gauge두께비 thickness ratio

thickness-chord ratio심블 thimble박판 thin plate얇은 날개 thin wing희석제 thinner

노받이핀토마수나사산 thread나사게이지나사밀러나사깍기기계

목두께목두께조리개조속조리개밸브조리개열량계관통보관통볼트 through bolts관통브래킷두께방향특성 through thickness property일정시간내의 처리작업량 through-put추력 thrust추력베어링추력블록 thrust block추력블록리세스 thrust block recess추력블록받침대추력상실추력계수추력감소계수

Thermo-Mechanical Controlled Process (TMCP) steelthermoplastic insulated cable

thermostatic expansion valve

thickness for voluntary addition

두께-코드비

제3갑판 third deck     thole-pin       Thoma number 

thread gauge   thread miller   threading machine      

3층갑판선 three deck vessel      3겹도르래 three fold block 3도형선 three islander  3상 three phase    

3단공기압축기 three stage air compressor     

3가닥로프 three stranded rope    3방향콕 three way cock 3방향유니언 three way union       3방향밸브 three way valve       3선식배전 three wire system     3층판리베팅 three-ply riveting      

throat depth   throat thickness throttle governing      throttle valve  throttling calorimeter   through beam  

through bracket 

thrust bearing  

thrust block seat       thrust breakdown      thrust coefficient       

thrust deduction coefficient    

Page 237: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

추력감소율추력마력추력지수추력부하계수추력계추진출력추력 패드 thrust pad추진동력 thrust power스러스트리세스 thrust recess추진기시트 thrust seat추력받이칼라추력슈 thrust shoe스러스터 thruster항정선 thumb line나비나사노좌석사이러트론사이리스터조류조석차이 tidal range조석 tide조류표시부표조류신호소조류신호조석표타이볼트 tie bolt띠판타이로드 tie rod빔층 tier of beam밀착용접 tight weld틸러 tiller경사계 tilt sensor목재 timber목재운반선갑판적목재화물팀버헤드목재만재흘수선하기목재만재흘수선시보종정기용선 time charter시간정수시간제어기불때는시보장치불때는시보기타임래그최단접근시간시각대타이밍 기어 timing gear점화시기조정밸브주석함량계양철가위이산화타이타늄 피막날개끝캐비테이션

thrust deduction fraction       Thrust HorsePower (THP)  thrust index    thrust loading coefficient       thrust meter   thrust output   

thrust shaft collar  

thumb screw   thwart thyratron       thyrister       tidal current   

tide indicating buoy    tide signal station      tide signal     tide table      타이엘(L)형강 tie angle 

tie plate       

timber carrier  timber deck cargo     timber head    timber load line timber summer load water linetime bell       

time constant  time controller time firing device      time firing indicator    time lag Time to Closest Point of Approach(TCPA) time zone      

timing valve    tin content meter      tinman's shears       TiO2 Coatingtip cavitation   

Page 238: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

날개끝누출손실날개끝틈새날개끝노출날개끝누출날개끝속력끝단 실속 tip stall날개끝보텍스 tip vortex날개끝보텍스캐비테이션선미침하 tipping티핑모멘트토빈청동토 toe

중립타각스테이웨브의 토 toe of stay webs토피스토글 toggle토글볼트 toggle bolt

토글스위치공차 tolerance허용한도 tolerance limits허용요건 tolerance requirement스카프용접혀붙이 와셔 tongued washer톤수 tonnage적량톤수증서측도갑판톤세적량측도법톤수표지적량측도감톤구멍센티미터당배수톤수

tool board공구상자공구지기공구공장공구강공구치형 tooth profile톱 top상부 브레이스 top bracing상사점톱헤비두표정판톱팀버하향식방법톱갤런트리프트톱갤런트마스트톱갤런트세일톱갤런트스테이세일톱마스트 topmast톱마스트백스테이

tip clearance leakage loss      tip clearance   tip emergence tip leakage     tip speed      

tip vortex cavitation   

tipping moment Tobin bronze  

toe angle of an offset rudder  

toe piece      

toggle switch  

tongue weld    

tonnage capacity       tonnage certificate     tonnage deck  tonnage dues  tonnage law    tonnage mark  tonnage measurement  tonnage opening       Tons Per Centimeter immersion(TPC) 공구대tool box       tool keeper    tool shop      tool steel      tools   

Top Dead Center (TDC)top heavy      top mark top plating     top timber     top-down approach    topgallant lift  topgallant mast topgallant sail  topgallant staysail      

topmast backstay      

Page 239: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

톱마스트밴드톱마스트스테이세일topology토핑브래킷토핑리프트토핑유닛토핑윈치

보충용공기압축기톱세일 topsail톱세일리프트톱세일스쿠너상부현측탱크 topside tank토치 torch토치헤드토치점화기토치램프토치튜브어뢰정방뢰망붐토크 torque토크상실토크계수토크지수토크계토크렌치토레모리노스국제협약

비틀림 torsion비틀림우력비틀림 함수 torsion function비틀림진동기록계비틀림계비틀림강성비틀림시험기비틀림 좌굴 torsional buckling비틀림우력비틀림위험회전속력비틀림변형비틀림유연성비틀림 모멘트 torsional moment비틀림진동 torsional vibration비틀림진동시험파비틀림모멘트전레이크전속도 total flow velocity총기체함유량전수두 total head

전열전달계수total inspection전손

topmast band  topmast staysail 위상topping bracket topping lift     topping unit    topping winch  topping-up air compressor     

topsail lift      topsail schooner       

torch head     torch igniter   torch lamp     torch tube     torpedo boat   torpedo net boom      

torque breakdown      torque coefficient      torque index   torque meter   torque wrench Torremolinos International Convention for the Safety of Fishing Vessels(1977)

1977 어선의 안전에 관한 국제협약, 1993 토레몰리노스 의정서

Torremolinos Protocol of 1993 relating to the International Convention for the Safety of Fishing Vessel 1977;

torsion couple  

torsion graph  torsion meter  torsion rigidity torsion tester  

torsional couple torsional critical speed torsional deflection     torsional flexibility     

torsional vibration test torsional wave moment total axial displacement 

total gas content       

total heat transfer coefficient  전수검사total loss      

Page 240: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전압력전사적설비관리전사적품질관리전레이크전저항전폐형구명정 totally enclosed lifeboat

특수형하역등보수도장 touch up인성 toughness토라인예인점예인저항예인줄예인조타목표등타위크레인예항장치예인줄받이아치예인줄받이보예인비트예인훅예선등 towing light예인밧줄 towing line예인줄묶음관 towing pendant예인패넌트 towing pennant예항력예인로프예인수조예인윈치예항식로그

toxic symptomtoxicity송수신변환기트레이서항적 track항적도항적제어장치 track control systems추적무역풍드래그암뒷날

트레일링 흡입 호퍼 준설선트레일링형드래그헤드후류보텍스캐비테이션열차도선연습선연습전대훈련함 Training Tender (ATX)타원컴퍼스부정기선송수신기신호변환기 transducer선회가로이동거리 transfer전달함수제어권의 이전 transfer of control

total pressure  Total Productive Maintenance (TPM)Total Quality Control (TQC)total rake      total resistance 

totally enclosed portable type cargo light      

tow line tow point      tow rope resistance    tow rope       tow steering light      tower crane    towing apparatus       towing arch    towing beam   towing bitt     towing hook   

towing power  towing rope    towing tank    towing winch   towing-log     중독증상독성TR switch     tracer  

track chart     

tracking trade wind     trailing arm    trailing edge   trailing suction hopper dredgertrailing type drag head  trailing vortex cavitation       train ferry     training ship   training squadron      

trammels       tramper transceiver     

transfer function       

Page 241: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이송펌프공장간의 작업자이동변압기순간캐비티과도편차과도전자탐사법과도상태트랜싯천이 영역 transition area천이점천이온도천이 구역 transition zone천이유동임시비상전원전달율 transmissibility (TR)

전달효율전동장치화염전파전동축신축이음쇠송신기송신 transmitting발신식컴퍼스방위발신기붙이자기컴퍼스자기선수방위전송장치트랜섬 transom선미보트랜섬늑판 transom floor순양함형선미투명도판방탄유리 transparent armor glass트랜스폰더횡격벽가로이송컨베이어횡늑골횡늑골식구조횡부재횡메타센터제일수횡단면트랜스버스링 transverse ring횡복원력횡강도횡늑골식구조트랜스버스웨브트랩 trap그네 trapeze사다리꼴공식잡힌기체

transfer pump  transfer workers between shopstransformer    transient cavities       transient deviation     Transient Electro Magnetic (TEM) methodtransient state transit 

transition point transition temperature  

transitional flow transitional source of emergency electric power

transmission efficiency 

transmission gear      transmission of flame  transmission shaft loose joint  transmitter     

transmitting compass   transmitting magnetic compass Transmitting Magnetic Heading Device (TMHD)

transom beam  

transom stern  transparency disc      

transponder    transverse bulkhead    transverse conveyor   transverse frame       transverse framing system     transverse member     transverse metacenter  transverse number     transverse plane       

transverse stability     transverse strength    transverse system transverse web 

trapezoidal rule trapped gas    

Page 242: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이동크레인주행식작업대이동탑가로이송 traverse feed연침로항법트래버스표트롤망오토보드트롤어망끌줄트롤윈치저인망어선디딤판 tread전처리공장 treatment shop

나무못trend analysistrend line도려내기시험코어링트레슬 trestle트레슬트리시운전 trial시행착오법 trial and error method시운전상태trial conference시험조작시운전속력 trial speed트라이애틱스테이유기주석계 tributyl-tin (TBT) Based트라이싱로프트릭밸브삼색등트리거 trigger트리거구멍트림 trim트림힐지시기선수트림선수트림선수트림선미트림조절탭 trim tab트림웨이트삼동선 trimaran삼동선형 trimaran type hull form트리밍해치트리밍모멘트트리밍표트리밍탱크

자유외기회로차단기트립장치

trip line트립시험트립와이어

traveling crane traveling stage traveling tower 

traverse sailing traverse table  trawl otter board       trawl warp     trawl winch    trawler 

3겹도르래 treble block    3열리벳이음 treble riveting  

tree nail       추세분석추세선trepanning test trepanning     

trestle tree    

trial condition  시운전회의trial maneuvering      

triatic stay     

tricing wire    trick valve     tri-colored light 

trigger fit      

trim and heel indicator trim by bow   trim by head   trim by stem trim by stern  

trim weight    

trimming hatch trimming moment       trimming table trimming tank  trip free air circuit breaker    trip gear       개폐줄 trip test trip wire       

3추진기선 triple screw vessel     3실린더펌프 triplex pump   

Page 243: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

삼중안전유리세다리마스트트리핑브래킷트로코이드파트롤리 trolley병력수송선열대성폭풍우 tropical cyclones열대건현열대담수만재흘수선열대만재흘수선열대폭풍우열대고장발견방법 trouble shooting

조타줄홈트로프진방위 true bearing진방위수신장치참운동표시트루모션레이더참풍향참풍속트렁크 trunk공기배출구트렁크갑판트렁크창구트렁크피스톤기관트렁크통풍통트렁크선트렁크웨이트러니언트러스 truss트라이돛관 tube관배치관그을음불어내기관청소솔관청소기관뽑아내기공구관확장기관용패킹삽입공구관용패킹제거공구관용패킹조임공구관판관플러그관때려빼기공구지주관연관보일러파이프발판수관식보일러예인선텀블홈

triplex safety glass    

tripod mast    tripping bracket trochoidal wave 

troopship      

tropical freeboard      tropical fresh water load line  tropical load line       tropical storm  tropical zone   

trough for steering chain       trough 

true bearing unit       true motion display    true motion radar      true wind direction     true wind velocity      

trunk air outlet trunk deck     trunk hatchway trunk piston engine    trunk ventilator trunk vessel   trunk way      trunnion 

trysail 

tube arrangement      tube blower    tube brush     tube cleaner   tube drawing tool      tube expander tube packing inserting tool     tube packing take-out tool     tube packing tightening tool    tube plate      tube plug      tube push-out tool     tube stay      tubular boiler  tubular scaffolding     tubulous boiler tug boat       tumble home   

Page 244: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

텀블러스참치어선다랑어주낙어선다랑어주낙어선 tuna long liner다랑어잡이모선티그 용접텅스텐강

tuning동조조정튜닝휠터널 tunnel터널탈출구터널갑판터널리세스천장터널리세스중간축베어링중간축터널웰터빈 turbine터빈케이싱터빈케이싱터빈바퀴터빈효율터빈펌프터빈로터터빈선터빈선터빈날개바퀴터빈송풍기터빈발전 전기추진선터빈발전기복수기순환펌프터빈발전기복수기복수펌프터빈발전기복수기순환펌프터빈발전기복수기복수펌프터보제트과급기 turbocharger

과급기세척수탱크과급기차단시험과급기윤활유냉각기과급기윤활유중력탱크과급기윤활유펌프과급기윤활유저장탱크과급기윤활유섬프탱크

tumbler switch tuna clipper    tuna long line fishing boat     

tuna mothership Tungsten Inert Gas (TIG) arc weldingtungsten steel  조율(튜닝)tuning control  tuning wheel   

tunnel escape  tunnel flat      tunnel recess top      tunnel recess  tunnel shaft bearing    tunnel shaft    tunnel well     

turbine casing  turbine cylinder turbine disc    turbine efficiency      turbine pump   turbine rotor   turbine ship   turbine steamer turbine wheel  turbo blower   turbo electric motor ship       turbo generator condenser circulating pump    turbo generator condenser condensate pump   turbo generator turbine condenser circulating pump    turbo generator turbine condenser condensate pumpturbo jet       

turbocharger cleaning water tank       turbocharger cut off test       turbocharger lubricating oil coolerturbocharger lubricating oil gravity tank turbocharger lubricating oil pumpturbocharger lubricating oil storage tank       turbocharger lubricating oil sump tank  

Page 245: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

터보압축기터빈발전 전기추진선터보송풍기터빈발전기난류모델 turbulence model난류촉진장치난류경계층난류난류운동에너지 turbulent kinetic energy난류운동

turbulent velocity난류후류유동 turbulent wake flow조임나사 turn buckle만곡부 turn of the bilgeturn on side반전 turn over턴버클선회 turning선회원회전기관회전력터닝기어선수돌림 모멘트 turning moment선회반지름회두선회시운전회전륜turnkey base턴테이블포탑 turret터릿갑판터릿선반터릿노즐터릿선거북등갑판중간갑판 'tween deck갑판간탄고갑판간화물창갑판간내장판갑판간늑골갑판간사다리

쌍캠축형쌍동선 twin hull ship

쌍롤러형쌍타twin screw ship쌍추진기선돛실비틀린날개비틀림모멘트비틀림시험쌍묘박

turbo-compressor      turbo-electric drive    turbo-fan      turbo-generator 

turbulence stimulator   turbulent boundary layer       turbulent flow  

turbulent motion       난류속도

반전turnbuckle    

turning circle  turning engine turning force   turning gear   

turning radius  turning round  turning test    turning wheel  턴키방식turntable       

turret deck    turret lathe    turret nozzle   turret vessel   turtle back deck       

'tween deck bulker   'tween deck cargo space     'tween deck ceiling   'tween deck frame    'tween deck ladder   

20피트컨테이너 등가적재량 Twenty-feet Equivalent Unit (TEU)twin cam shaft type    

2심전선 twin core cable 

2열종격벽 twin longitudinal bulkhead      twin roller type twin rudder    

2축선twin screw vessel     twine  twisted blade  twisting moment       twisting test   two anchor mooring    

Page 246: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

경합시험 two boat test쌍두리트롤선two cycle engine쌍실린더펌프

two point approximation

two stage pumptwo stage turbo-charger

쌍크랭크축two wire systemtwo-phase flow쌍방향콕

쌍방무선전화장치two-way VHF radiotelephone형식 type 형식승인 type approval형식승인시험 Type Approval Test (TAT)선종태풍기준상세도 typical detailU-bolt얼리지 ullage얼리지홀 ullage hole얼리지 플러그 ullage plug유면측정공 ullage port얼리지표 ullage table

최종종강도최종강도 ultimate strength최종인장강도 ultimate tensile strength

ultra high frequency (UHF)

극대형원유운반선초음파탐상기초음파누수탐상시험 ultrasonic leak test초음파탐상기초음파탐상시험 Ultrasonic Test (UT)초음파두께측정자외선 ultraviolet (UV)자외선측정기 ultraviolet dosimeter자외선살균기 ultraviolet sterilizer생명줄 umbilical cable원질부 unaffected zone

기관구역무인화선무인화기관구역 unattended machinery space

unbalance불평형하중 unbalanced load불평형타비감쇠동요

two boat trawler       2중급전 two circuit feeding     2행정기관

two cylinder pump     2차원유동 two dimensional flow    

2차원스펙트럼밀도 two dimensional spectral density

2중태클 two fold purchase      2점근사화2단공기압축기 two stage air

compressor      2단펌프2단과급기2행정기관 two stroke cycle engine   

two throw crankshaft  2선식2층류유동

two-way cock two-way radiotelephone apparatus쌍방향 VHF무선전화

type of ship   typhoon 

유(U)볼트

ultimate longitudinal strength

극초단파Ultra Large Crude oil Carrier (ULCC)ultrasonic flaw detector    

ultrasonic reflectoscope 

ultrasonic thickness gauging

Unattended Machinery Automatic (UMA) ship

불평형unbalanced rudder     undamped oscillation   

Page 247: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

비감쇠진동비감쇠파under construction갑판하부구역 under deck area갑판하보강재 under deck stiffener갑판하부구조 under deck structure갑판하톤수 under deck tonnage부족팽창 under expansion상갑판하톤수

저전압방지비드밑균열 underbead crack언더컷 undercut수중카메라잠수함수중절단수면하부속품

underwater inspection

수중진수대해중투시선수중투시실수중투광기수중방사소음수중착암기수중스테레오카메라수중통화기수중텔레비전수중용접항행중해상보험업자부등변형강 unequal angle부정형유니플로소기기관유니플로소기정류복수기균일분포하중 uniform distributed loads

무정전전원장치유니언 union유니언연결유니언멜트식용접유니언너트맞당김식하역법

unit assembly붙박이욕실 unit bath유닛캐빈 unit cabin유닛쿨러 unit cooler개별급수식 unit feed system유닛의장 unit outfitting유닛롤러 unit roller유닛스위치 unit switch

undamped vibration    undamped wave 건조중

under upper deck tonnage     Under Voltage Protection (UVP)저전압해방 Under Voltage Release (UVR)

underwater camera     underwater craft       underwater cutting     underwater fittings     수중검사underwater launching way      underwater observation boat   underwater observation space  underwater projector   Underwater Radiated Noise (URN)underwater rock drilling machineunderwater stereo camera      underwater telephone  underwater television  underwater welding    underway      underwriter    

unfairness      uniflow engine uniflow scavenging      uniflux condenser      

Uninterruptible Power Supply (UPS)

union joint     union melt welding     union nut      union purchase method 소조립

Page 248: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

미국연안경비대유니버설촉 universal chock유니버설이음유니버설페어리드유니버설이음만능공작기계몽키스패너만능재료시험기양토부선양하 unloading무인항공기무인조종 unmanned control개구가 없는 격벽 un-pierced bulkhead무저항횡동요비내항성비피복갑판 unsheathed deck불안정평형 unstable equilibrium비정상성 unsteadiness비정상 unsteady비정상캐비티비정상유동 unsteady flow비정상열유동 unsteady heat flow

비정렬 셀 중심방법비정규격자 unstructured grid

unsymmetrical비대칭침수 unsymmetrical flooding

비대칭파랑유기하중상행행정상승관헤더상층선루 upper bridge상부선교갑판 upper bridge deck관리상한선 upper control limit상갑판 upper deck삼각주상단부표 upper end buoy상한주파수 upper frequency타두재 upper stock상부판 upper strake상부텀블러외판만곡부상단상층갑판간공간최상전통갑판직립직립선수업셋용접업세팅머신전복모멘트

upside down연도 uptake배기통풍기upward trend풍상향 upwindurinal유용성검사 usability test

United States Coast Guard (USCG)

universal coupling      universal fairlead       universal joint  universal machine      universal screw wrench universal testing machine      unloader barge 

Unmanned Aerial Vehicle (UAV)

un-resisted rolling      unseaworthiness       

unsteady cavities       

unstructured cell-centered method

비대칭unsymmetrical wave -induced loadsup stroke      upcast header  

upper tumbler  upper turn of bilge     upper 'tween decks   uppermost continuous deck     upright position upright stem   upset welding  upsetting machine      upsetting moment      반전uptake ventilator 상승추세

소변기

Page 249: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

U-Tube

진공증진기진공누설시험 지그 vacuum box진공차단기진공청소기 vacuum cleaner진공복수기 vacuum condenservacuum distillation진공계진공펌프진공시험 vacuum test진공트랩진공관진공밸브밸브상자밸브상자밸브체스트 valve chest

밸브조정구멍소기밸브선도밸브디스크밸브장치밸브가드밸브핸들스패너밸브레버밸브양정밸브목록표 valve list

밸브조작스탠드밸브루프밸브판밸브원격제어 Valve Remote Control (VRC)

밸브원격제어장치밸브원격비상차단장치밸브자리깎기밸브로드 valve rod밸브로드가이드밸브소기밸브자리밸브조정밸브스핀들밸브스프링밸브고착상단밸브소기베인 vane베인프로펠러임펠러베인붙이디퓨저복원력멸실점증기 vapor증기캐비테이션수베이퍼로크증기포켓증기압력

유(U)자관유(U)자관압력계 U-tube pressure gauge vacuum augmentor     

vacuum breaker 

감압증류vacuum gauge  vacuum pump  

vacuum trap   vacuum tube   vacuum valve  valve box      valve casing   

valve controlled port scavengingvalve diagram  valve disc      valve gear     valve guard    valve handle spanner   valve lever    valve lift       

valve local control stand       valve loop     valve plate     

valve remote control system   valve remote emergency shut-off device       valve reseater 

valve rod guide valve scavenging       valve seat     valve setting   valve spindle   valve spring   valve sticking  valve-in-head scavenging      

vane propeller vane wheel    vaned diffuser vanishing point of stability     

vapor cavitation number vapor lock     vapor pocket   vapor pressure 

Page 250: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

증발 vaporization증발기 vaporizer증발 vaporizingvaporizing chamber증발식연소실증기성캐비테이션 vaporous cavitation

가변분사시기조정변동하중 variable load불균일피치프로펠러가변거리눈금가변거리눈금가변속력 variable speed가변속력조속기 variable speed governor가변행정펌프추치제어가변전압용접기바니시 varnish변 단면 varying cross section변동피치프로펠러

V-belt drive벡터평균속도 vector mean velocity함재초계정 vedette boat채소창고차량운반선속도 velocity속도계수 velocity coefficient속도선도유속수두 velocity head속도퍼텐셜 velocity potential속도변환 velocity shift반데글로브 Vendee Globe제조자도면 vendor drawing제조회사보증 vendor guarantee제조업체소요기간 vendor lead time제조자매뉴얼 vendor manual베니어 veneer베니어판베니션도어통기 vent통기구멍벤트관벤트라이저 vent riser공기공급식흐름공기공급식프로펠러통풍플랩통풍 ventilation통풍콕통풍덕트통풍 플랩 ventilation flap공기공급초생공기공급지수통풍관배치도통풍트렁크통풍통 ventilator버니어 vernier버니어캘리퍼 vernier caliper

증발실 vaporizing combustion chamber

Variable Injection Timing (VIT)

variable pitch propeller variable range marker  variable range scale   

variable stroke pump   variable value control  variable voltage welding machine

varying pitch propeller 브이(V)벨트구동vegetable chamber     vehicle-carrying ship   

velocity diagram       

veneer board  venetian door  

vent hole   vent pipe      

ventilated flow ventilated propeller    ventilating flap 

ventilation cock ventilation duct 

ventilation inception    ventilation index       ventilation plan ventilation trunk       

Page 251: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수직줄 vertical수직축 vertical axis연직축프로펠러직립형보일러

수직연결 vertical coupling수직하향용접 vertical down-hand welding직립형기관버티칼킬수직사다리수직이착륙기연직변위각수직면운동시험연직주형계수수직스카프연결

vertical section수직전단력 vertical shear force직립선수수직방요재 vertical stiffener수직판 vertical strake상하진동수직파랑굽힘모멘트수직파랑전단력 vertical wave shear force연직웨브직립식용접

초단파초대형산적화물선초대형원유운반선초대형부유식해양구조물초대형광석운반선선박 vessel용기 vessel선박통항관제 흘수제한선박

VHF radio installation

진동대진동 vibration흡진기진동해석 Vibration Analysis진동특성 vibration characteristics소진기진동제어 vibration control진동감쇠장치진동피더접수진동방진고무 vibration isolating rubber진동레벨

vertical axis propeller  vertical boiler  

수직중심 Vertical Center of Gravity (VCG)

vertical engine vertical keel   vertical ladder Vertical or Short Take-Off/Landing (VSTOL)vertical path angle     Vertical Planar Motion Mechanism (VPMM) testvertical prismatic coefficient   vertical scarf  수직단면vertical stem   

vertical vibration       vertical wave bending moment 

vertical web   vertical welding 

브이에이치에프 (VHF)비상위치지시용무선표지장치

very high frequency emergency position-indicating radio beacon(VHF EPIRB) Very High Frequency(VHF) Very Large Bulk Carrier (VLBC)Very Large Crude Oil Carrier (VLCC)Very Large Floating Structure (VLFS)Very Large Ore Carrier (VLOC)

Vessel Traffic Service (VTS)vessel with freeboard  브이에이치에프 (VHF)

무선설비vibrating table 

vibration absorber      

vibration compensator  

vibration damper       vibration feeder vibration in water      

vibration level 

Page 252: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소진기진동기 vibrator진동해머진동계바이스 vice 비커경도 Vickers hardness식량수송선전망창 view portViking ship비닐타일겉보기화물밀도 virtual cargo density겉보기질량

겉보기관성모멘트Virtual Reality (VR)가상일 virtual work점탄성viscometer점도계점도 viscosity점도조절기점도지수점성감쇠력 viscous damping force점성유동 viscous flow

점성압력저항점성저항바이스 vise

visibility발연기적가시경보 visible alarm명호광 visible arc빛도달거리 visible distance육안 visual시각경보 visual alarm영상지시장치 Visual Display Unit (VDU)육안 검사 visual inspection시각신호 visual signal전성관보이드 구역 void space보이스슈나이더프로펠러 Voith-Schneider Propeller

기화성부식억제제휘발성물질 volatile matter

휘발성유기화합물휘발성용매제 volatile solvent휘발도 volatility전압강하 voltage drop전압변동률전압조정기체적포착법 volume capturing method부피손실 volume loss체적탄성계수 volume modulus배수용적 volume of displacement체적효율 volumetric efficiency

체적팽창계수 

vibration reducer       

vibratory hammer      vibrometer     

victualler       

바이킹선 vinyl tile       

virtual mass    virtual moment of inertia       가상현실viscoelasticity  점도계viscosimeter   

viscosity controller     viscosity index 

viscous pressure resistance    viscous resistance     

가시도visible air whistle  

voice tube (pipe)  

Volatile Corrosion Inhibitor (VCI)

Volatile Organic Compounds (VOC)

voltage regulation      voltage regulator       

volumetric expansion coefficient

Page 253: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용적식유량계 volumetric flow meter와류실 volute chamber볼류트펌프 volute pump벌류트스프링 volute spring보텍스 vortex보텍스캐비테이션 vortex cavitation보텍스모델링 vortex modeling보텍스박리 vortex shedding 항해용선 voyage charter항해자료기록장치 항해종합관리시스템항해계획 voyage plan

V-shaped sectionV-type engine벌컨장치 vulcan gear가황고무 vulcanized rubber차량갑판 wagon deck중앙부상갑판 waist deck작업대기시간 waiting time반류 wake프로펠라측덕트 wake equalizing duct반류비 wake factor반류계측 wake field measurement반류비 wake fraction워키토키 Walkie-Talkie보행면 walking level 건조중통로벽걸이크레인 wall crane측벽효과 wall effect 벽붙이 등 wall lamp벽붙이 등 wall light벽면핵 wall nuclear벽걸이레이디얼드릴기계연직현측 wall sided벽붙이통풍통 wall ventilator널뜀용접법 wandering sequence워드레오나르드방식 Ward-Leonard system옷장 wardrobewarehouse가온 증기관 warming steam pipe예열 warming up경고 warning경계등 warning light경고신호등 warning signal light뒤틀림 warp비틀린날개 warped blade당김줄드럼 warping drum당김줄감개 warping end당김줄윈치 warping winch배를 끄는 밧줄 warps군함 warship날개날올림 wash backwash basin물막이판 wash board제수격벽 wash bulkhead겉바르기시멘트 wash cement제수격벽 wash plate

Voyage Data Recorder (VDR) Voyage Management System (VMS)

브이(V)형 단면브이(V)형 기관

walkway during construction

wall radial drilling machine

창고

세면기

Page 254: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

방수구 wash port날개날내림 wash-down와셔 washer날개날올림 wash-up허용쇠모한도 wastage allowancewaste heat폐열보일러폐열회수시스템폐유 waste oil폐유소각장치폐유펌프 waste oil pump폐유탱크

폐유처리장치폐유처리선폐증기관당직 watch시보종물밸러스트 water ballast물밸러스트 water ballast물밸러스트관물밸러스트관장치물밸러스트탱크 Water Ballast Tank (WBT)청수부선 water barge급수선물결막이 water breaker

water closetwater content수냉배수로물실린더주수관물여과기물분무방사기 water fog applicator수면계유리수면계water hammering수두수마력침수경보장치 water ingress alarm물흡입관물재킷물분사 water jet물분사추진선 water jet craft물분사 이젝터물분사장치물분사추진 water jet propulsion

누수감지장치 수선 water line수선길이수선부페인트물윤활식선미관베어링수량계물모니터수선면 water plane

폐열waste heat boiler      waste heat recovery system   

waste oil incinerator   

waste oil tank waste oil treating device       waste oil treating ship waste steam pipe      

watch bell     

water ballast pipe      water ballast piping system    

water boat     

화장실수분함량water cooling  water course   water cylinder water filling pipe       water filter    

water gauge glass     water gauge   수격water head     water horsepower    

water intake pipe      water jacket   

water jet ejector water jet equipment     

Water Leakage detection system

water line length water line paint water lubricated stern tube bearingwater meter   water monitor  

Page 255: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수선면적수선면계수수선면관성계수

water pollution수압물저항기수냉벽물봉쇄급수관급수관장치연수장치물분무펌프물여과기청소선수관식보일러수관벽현측물고랑

water-air coupling방수 waterproof수밀전기등 waterproof electric torch수밀형식통수시험수밀 watertight수밀격벽갑판수밀전선관통쇠붙이수밀구획수밀갑판 watertight deck수밀문수밀마루수밀늑판수밀이음수밀미닫이문수밀시험수밀트랜섬늑판 watertight transom floor수밀공사적산전력계 Watt-Hour Meter전력계파 wave소파기 wave absorber파동 흡수 장치 wave absorber파진폭쇄파 wave breaking

쇄파저항파속력파랑계수 wave coefficient파정 wave crest파정선파랑감쇠력 wave drift damping파랑표류력 wave drift force파랑기진력파진동수파전면

water plane area water plane coefficient  water plane inertia coefficients  수질오염water pressure water rheostats water screen   water seal     water service pipe     water service system  water softener  water spray pump      water strainer  water surface cleaning ship    water tube boiler      water wall     water way     해수-공기 연성waterproof type water-supply test      

watertight bulkhead    watertight cable gland for deck watertight compartment 

watertight door watertight flat  watertight floor watertight joint watertight sluice door  watertight test 

watertight work 

wattmeter      

wave amplitude 

wave breaking resistance      wave celerity  

wave crest line 

wave exciting force    wave frequency wave front     

Page 256: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

도파관파고 wave height파저파랑 유기 하중 wave induced load파간섭 wave interaction파장파랑하중 wave load조파기 wave maker조파저항파수파형 wave pattern파형저항파주기파랑관통형 쌍동선파랑압력 wave pressure파형풍랑등급파전단력파경사파수스펙트럼파속력파기울기진파장치파면파랑비틀림모멘트 wave torsional moment파저 wave trough파반류웨이브렛변환 wavelet transform밀납본위크링크 weak link쇠모마모 wear down마모량계측기 wear down gauge내마모성 강 wear resistant steel마스크 착용 wear respirator풍하측회두 wearing천후조정물막이판자노천갑판weather effectweather forecast선수끌림 weather helm노천사다리바람막이막비막이지붕풍상측하강 weather side down바람맞이쪽노출강력갑판 weather strength deck풍우밀정적방향안정성풍화작용풍우밀 weathertight풍우밀문

wave guide    

wave hollow   

wave length    

wave making resistance wave number  

wave pattern resistance wave period   Wave Piercing Catamaran (WPC)

wave profile   wave scale     wave shearing force   wave slope    wave spectrum wave speed    wave steepness ratio  wave subduer  wave surface  

wave wake     

wax pattern    

wear and tear  

weather adjustment    weather board weather deck  일기영향일기예보weather ladder weather screen      weather shed  

weather side   

weather tight  weathercock stability   weathering     

weathertight door      

Page 257: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

강제풍우밀창구덮개위빙웨브 web특설보특설늑골웨브 보강재 web stiffener쐐기중량곡선중량밀도중량추정무게변화툴 weight gain무게손실적재중량가중평균법 weighted average method

weighted index numberweighted mean웨어식펌프용접부 weld용접비드weld condition용접부부식 weld decay용접결함 weld defect용접상세 weld detail용접끝단부 weld end용접결함 weld flaw용접간극 weld gap용접게이지weld geometry용접헤드용접길이용접선용착금속용접선 weld seam용접치수용착금속끝단 weld toe용접부 weld zone용접성welded construction용접이음용접공 welder용접사기량시험용접 welding용접아크전압 welding arc voltage용접전선용접전류용접변형 Welding Distortion용접불꽃용제 welding flux용접열용접유기균열 Welding Induced Crack용접지그용접전선용접기 welding machine용접재료 welding material용접금속학 welding metallurgy맞대기용접플랜지

weathertight steel hatch cover weaving 

web beam      web fame      

wedge weight curve   weight density       weight estimation      

weight loss    weight on board       

가중지수가중평균Weir's pump  

weld bead     용접조건

weld gauge    용접형상weld head     weld length    weld line       weld metal     

weld size      

weldability     용접구조welded joint    

welder's qualification test 

welding cable  welding current 

welding flame  

welding heat   

welding jig     welding leads  

welding neck flange    

Page 258: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용접공welding pass sequence용접자세 welding position용접압력용접시공법 welding procedure

용접법승인시험용접시공절차서용접시공시험용접법용접덧붙임용접잔류응력 welding residual stress

welding rod

용접봉자동피복기용접순서용접공장

welding shrinkage용접전원용접장치용접응력용접기호용접대 welding tablewelding throat용접시간용접불구멍용접토치용접변압기용접유니언용접물용접식돌기물 weldolet웰 well저장소 well웰갑판 well deck상륙정탑재갑판 well deck웰갑판선웰갑판선 well decker시유장치습식공기펌프

습연실식보일러습연실액체컴퍼스계류 독습식 낙하시험 wet drop test

Wet Film Thickness (WFT)습식보존법wet provision습증기침수표면적경배선포경선포경포포경모선탐경선포경윈치포경선

welding operator       용접순서welding pressure       

Welding Procedure Qualification Test (WPQT)Welding Procedure Specification (WPS)welding procedure test welding process welding reinforcement  

용접봉welding rod extrusion press    welding sequence      welding shop   용접수축welding source welding station welding stress welding symbols       

용접각목welding time   welding tip     welding torch  welding transformer    welding union  weldment      

well deck vessel       

well test unit  wet air pump  wet combustion chamber boiler wet combustion chamber       wet compass   wet dock      

습도막wet process    냉장부식wet steam     wetted surface area    whale back vessel     whale catcher boat     whale gun     whale mother ship     whale scouting vessel  whale winch   whaler 

Page 259: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

부두 wharf부두크레인부두사다리부두사용료부두관리인날개바퀴단조타실 wheelhouse조타실정부 wheelhouse top위프 whip휘핑 whipping휘둘림 whirling휘둘림진동 whirling vibration기적 whistle

기적제어장치백색다이아몬드형백연페인트백등화이트메탈백색잡음백색아연페인트위트워스나사홀타인형그래브버킷광역통신망광폭날개광폭라이너특설창내빔특설기둥체인홈바퀴윈치 winch윈치대윈치갑판윈치드럼 winch drum윈치조종수윈치플랫폼바람막이풍동표면류바람막이풍향 wind direction

풍향영향계수표면류풍력풍속변화도 wind gradient바람유기조류바람저항 wind resistance

공기저항계수바람받이바람막이막바람받이풍향삼각형 wind triangle풍동 wind tunnel풍동시험풍향날개 wind vane풍속

wharf crane    wharf ladder   wharfage       wharfinger     wheel stage    

whistle and siren control systemwhite diamond shape   white lead paint white light     white metal    white noise    white zinc paint Whitworth screw thread whole-tine type grab bucket   Wide Area Network(WAN) wide blade     wide liner      widely spaced hold beam      widely spaced pillar    wildcat 

winch bed     winch deck    

winch man     winch platform wind breaker   wind channel   wind current   wind deflector 

wind direction effect coefficient wind drift      wind force     

wind induced current   

wind resistance coefficient     wind scooper  wind screen    wind shoe      

wind tunnel test        

wind velocity  

Page 260: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

풍랑 wind wave풍압면적 windage조풍손실풍랑나선계단권선양묘기풍차작용윈도 window윈도와이퍼범포환기통현측격벽측로수면효과익선 Wing In Ground (WIG) Ship

표면효과익선날개용골 wing keel날개펌프날개 돛 wing sail현측나선프로펠러날개 단면 wing section현측축측부흡수관 wing suction현측탱크날개 끝단 wing tip윙렛 winglet동기건현동기만재흘수선동기북대서양건현동기북대서양만재흘수선동기목재만재흘수선방한장치 winterizing와이어브러시와이어클립신선와이어 송급 모터 wire feed motor와이어게이지가는눈철망와이어가이철망문와이어니퍼와이어릴와이어로프 wire rope와이어로프홈 wire rope grooving와이어로프니퍼와이어하역고리와이어소켓 wire socket무선제어무선방위측정기무선장치무선국통신사무전실무선국무선전신기

windage loss   wind-generated wave  winding stairs  winding windlass       windmilling     

window wiper  windsail wing bulkhead wing furnace   

Wing In Surface Effect (WISE) Ship

wing pump     

wing screw propeller   

wing shaft     

wing tank      

winter freeboard       winter load line Winter North Atlantic freeboard Winter North Atlantic load line winter timber load line 

wire brush     wire clip       wire drawing   

wire gauge     wire gauze     wire guy       wire net door     wire nipper    wire reel       

wire rope nipper       wire sling      

wireless control wireless direction finder       wireless installation    wireless office wireless operator      wireless room  wireless station wireless telegraph     

Page 261: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

무선전화무전당직원배선기구배선도탈급목재저장소

wood deck목공선반나무못목침나무피복목재저장소목제갑판실목갑판목제방파벽목재받침 wooden dunnage목제방현재목제페룰목제가구목제기둥목재플러그 wooden plug목제칸막이목나사목선목선조선소목재받침 wooden support목공사목공장가공경화work loadwork managementwork measurementwork orderwork package일비단계별공사요령서작업대working conditions작동실린더제작도헐거운맞춤working lamp사용압력 working pressure작업공간 Working Space작용응력 working stress작용응력설계 방법작업행정작업대공원공작실 workshop공장용구공작실냉방장치

세계보건기구

wireless telephone     wireless watcher       wiring accessories     wiring diagram withdrawal of classification    wood bay      목갑판wood lathe     wood nail      wood pad      wood sheathing wood yard     wooden deck house    wooden deck   wooden dodger 

wooden fender wooden ferrule wooden furniture       wooden pillar  

wooden screen wooden screw wooden ship   wooden shipyard       

woodwork      woodworker's shop   work hardening 작업부하작업관리작업측정작업지시작업단위work ratio     Work Sequence Diagram (WSD)workbench     작업여건working cylinder       working drawing       working fit     작업등

working stress design method working stroke working table  workman       

workshop appliance    workshop unit cooler   World Health Organization (WHO)

Page 262: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

세계무선항행경보구역웜기어웜축웜휠워싱턴펌프권선형회전자측판페어리더난파선 wreck장애부표조난선등불부표렌치리스트핀오작동경보추종착오경보연철

X-form vibration

X-Ray radiographyX-ray room요트야드 yard선번꼰실 yarn꼰실 시험기선수동요각선수균형 yaw balance요힐요미터선수동요 모멘트 yaw momentyawing욜 yawl욜범장 yawl rig

검역기황색등항복점항복강도항복면 yield surface항복 평가 yielding check요크 yoke영률와이형여과기Z plate

무결점 zero defect지그재그조임지그재그 단속용접지그재그형 이음 zigzag joint지그재그조종시험지그재그리베팅지그재그조정아연 zinc방식아연 zinc anode

world-wide NAVigational warning service AREA (NAVAREA)worm gear     worm shaft    worm wheel   Worthington pump      wound rotor   wrapper plate  wrapping chock 

wreck buoy    wreck light buoy       wrench wrist pin       wrong operation alarm wrong way alarm      wrought iron   엑스(X)형 진동

엑스(X)선장치 X-ray inspection apparatus     엑스(X)선 투과시험엑스(X)선실yacht  

yard number   

yarn tester     yaw angle      

yaw heel       yaw meter     

선수동요

와이(Y)결선 Y-connection   yellow flag     yellow light    yield point     yield strength  

Young's modulus      Y-type strainer 

Z 판 제트(Z)형강 Z-bar  

zigzag fastening      zigzag intermittent weld 

zigzag maneuvering test zigzag riveting zigzagging     

Page 263: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용융아연조아연 인산염피막 처리 zinc phosphating아연판보호아연 zinc protector구역별공정단계별 구역 zone by area by stagezone outfitting구획의장방식구획도장방식구획중심작업 zone-oriented work

zinc bath       

zinc plate      

구획의장 Zone OutFitting Method (ZOFM)Zone Painting Method (ZPTM)

Page 264: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 265: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 266: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 267: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 268: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 269: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 270: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 271: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 272: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 273: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 274: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 275: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 276: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 277: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 278: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 279: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 280: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 281: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 282: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 283: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 284: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 285: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 286: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 287: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

3D numerical wave tank90' bend elbow ductA class divisionA-60 class bulkhead 맞바람받이선미방향으로위임폐기옆방향아벨식밀폐시험숙련선원abnormal operation 비정상운전abnormal value 비정상값aboard 선내에above (ABV) 상방above base (A/B) 기준선상방above baseline (A/B) 기선에서 이격거리above-water projected area 수상부투영면적abrasion material 마멸시험abrasive 절대압력절대횡동요절대온도절대속도절대영도

흡수단면적흡수식냉동기

abutting plate 인접판acceleration 가속도가속영역가속도계acceptable quality level 합격품질수준acceptance criteria 허용기준인수자안벽시운전acceptance requirement 허용요건Acceptance Sea Trial (AST) 인수자해상시운전Acceptance Trial (AT) 인수자시운전access door 출입문access hatch cover 출입창구덮개access hatchway 접근창구통로구멍access ladder 출입사다리access manhole 출입 맨홀access trunk 출입 트렁크접근성부속품accident 사고accident category 사고범주accident scenario 사고시나리오accidental loads 사고하중accommodation 거주설비

거주구갑판현측사다리거주구배치도

3차원수치파동수조90도곡면 엘보덕트A급 구획A-60 급 격벽

aback  abaft   abandonment   abeam Abel's close test     able seaman   

연마제abrasion test    연마제absolute pressure      absolute rolling absolute temperature   absolute velocity       absolute zero  absorption cross-section      absorption refrigerating machine 

acceleration zone      accelerometer  

Acceptance Harbor Trial (AHT)

access hole    

accessibility    accessory      

accommodation barge   거주용부선accommodation deck   accommodation ladder  accommodation plan    

Page 288: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

거주구축기시험탑재중량누적곡선

accumulator 축전지accumulator 축열기accumulator 축압기accumulator lamp 축전등아세틸렌가스발생기아세틸렌용접산세척탱크산세척취성acid pickling

산성법내산페인트산성강

acoustic emission 음향방출음향방출시험음향속도목표포착acrylic resin paint 아크릴수지페인트능동제어능동타주공정작업작업기간단축actual cargo mass 실제화물질량

실질작업투입시수실적선투입시수

actual thickness 실제두께actual throat thickness 실제목두께동작신호actuation system 구동시스템actuation test 작동시험 애덤슨링adapter 어댑터added mass 부가질량부가질량계수부가수질량added moment of inertia 부가관성모멘트부가중량법addendum 어덴덤어덴덤 원additional notation 추가부기부호additional workadditiveadhesion test 부착력시험단열압축단열효율단열팽창adjustable pin jig 조정가능 핀지그adjustable pipe 조정용관조정식축베어링자동반목adjustable speed governor 가변속력조속기

accommodation space  accumulation test      accumulative erection weight curve

acetylene gas generator acetylene welding      acid bath       acid brittleness 

산세척acid process   

acid resisting paint     acid steel      

Acoustic Emission Test (AET)acoustic velocity       acquisition     

active control  active rudder  activities on critical pathactivity duration reduction

Actual Hours of Work Performed (AHWP)actual man-hours used on previous ship

actuating signal 

Adamson's ring       

added mass coefficient added mass of water   

added weight method  

addendum circle       

추가공사첨가제adiabatic compression  adiabatic efficiency     adiabatic expansion    

adjustable shaft bearing    adjustable side block   

Page 289: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

조절식추력베어링조절토피스조절식드래그헤드adjusting bolt 조정볼트조절장치조절장치adjusting piece 조정피스조정나사adjusting shim 조정Administration 주관청애드미럴티계수애드미럴티포금진입공기소음기advance 선회전진거리advance angle 전진각전진계수전진비advance speed 전진속력 전진시기조종주시동밸브

손도끼AEGIS 이지스체계aerial 안테나장치항공프로펠러aero elastic analysis 공탄성해석항공터빈풍향풍속계aerofoil 에어로포일aerofoil section 에어로포일형 단면

항공학

항공프로펠러afloat 해상에서afloat 부유하는 afloat conditionAframax tanker 아프라막스급 탱커고정식크레인

선미부aft end (A.E.) 선미끝선미기관aft peak 선미피크선미피크탱크aft perpendicular (A.P.) 선미수선후부스퍼드선체후반부선미흘수after peak 선미피크선미격벽선미피크탱크

adjustable thrust block adjustable toe piece    adjustable type drag head   

adjusting device adjusting gear  

adjusting screw  조정-심adjustment     

admiralty coefficient   admiralty gun-metal    admission air silencer  

advance coefficient     advance ratio  

advance timing advanced starting valve adz    

aerial propeller 

aero turbine    aero vane       

aeronautics    

aero-propeller 

부양상태A-frame derrick       A-frame        에이(A)프레임aft body       

aft engine      

aft peak tank   

aft spud       after body      after draft     

after peak bulkhead     after peak tank 

Page 290: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

애프터스프링후연후부복수기지연발생후부선창최후단베어링선미포핏선미현호뒷톱마스트aftward 선미쪽으로맞바람age of vessel 선령 ageing effect 경년효과계량기골재호퍼총괄생산계획시효시효경화 agitation 좌초ahead 전진전진캠전진더미전진배기캠전진점화캠전진분사캠

전진조종밸브전진단전진터빈항로표지공기축압기공기최종냉각기채광통풍공간공기관겸용측심관

air blast 공기블라스트공기분사분무기통기송풍기압축공기병공기제동기공기거품방파제공기케이싱air cavity 공기공동공기실환기지수풍동air charging test 공기충진시험Air Circuit Breaker (ACB) 기중차단기에어콕air compressor 공기압축기공기조화기air conditioning 공기조화공기조화장치공기로공기저장용기air content 공기함유량

after perpendicular      선미수선after spring    after-burning  after-condenser after-generation after-hold      aftermost bearing      after-poppet   after-sheer    after-topmast  

against wind   

aggregate batcher      aggregate hopper      aggregate production planningaging  aging hardening 교반aground 

ahead cam     ahead dummy  ahead exhaust cam     ahead igniter cam      ahead injection cam    ahead maneuvering valve       ahead stage    ahead turbine  aids to navigation      air accumulator air after cooler air and light space     air and sounding pipe  

air blast atomizer      air blow       air blower     air bottle      air brake       air bubble breakwater  air casing      

air chamber    air change rate air channel     

air cock    

air conditioner       

air conditioning system air conduit     air container   

Page 291: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

공기함유율 air cooler 공기냉각기

공기냉각기세척수탱크air cooling 공냉공냉식공기통로

공기부양선공기실린더통풍댐퍼탈습기통풍로공기이젝터

air escape 공기빼기공기빼기관공기뽑기공기여과기

air flow test 통기시험에어갭공기망치

Air Handling Unit (AHU) 공기조화장치공냉경화강공기창공기가열기

air hole (A/H) 공기구멍기적공기불요추진장치

air injection 공기분사공기분사압력공기분사식air inlet 공기입구공기입구소음기공기흡입밸브공기중간냉각기공기재킷공기로커공기조절창

공기구동식전등공기출구각공기통로

air pipe 공기관공기관 폐쇄장치공기마개air pocket 공기포켓공기예열기공기압력계

air content ratio       

air cooler cleaning water tank 

air cooling system     air course      

Air Cushion Vehicle(ACV) air cylinder    air damper     air dryer       air duct air ejector     

air escape pipe 

air extractor   

air filter       

air gap 

air hammer    

air hardening steel     

air hatch       air heater      

air horn Air Independent Propulsion (AIP) system

air injection pressure  air injection type       

air inlet silencer       air inlet valve  air inter cooler air jacket      air lock air louver      air operating electric light      air outlet angle air passage    

air pipe head  air plug 

air preheater   air pressure gauge     

Page 292: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

air pump 공기펌프공기펌프레버air purge 공기배출정화

기포식액면계공기담금질공기율공기조절구공기탱크공기저항공기분리기공기소음기공기시동캠공기시동밸브

air suction 공기흡입공기흡입관공기흡입구공기탱크air test (A/T) 기밀시험공기온도계통풍로공기밸브air vent head 공기관 폐쇄장치공기관공기세척기air whistle 기적

공기전달소음공냉익렬

air-cooled cylinder 공냉실린더공냉식기관항공모함air-fuel ratio 공기연료비율airless injection 무공기분사무공기분사기관항공장애표시등airtight 기밀기밀격벽기밀문기밀시험공대함 유도탄AirWay Bill (AWB) 항공화물수취증경보 및 감시장치alarm bell 경보벨경보신호경보장치알코올기관alcohol paint 알코올페인트알코올온도계alert 경고 에일리어징alignment 정렬alignment of structure 구조정렬알칼리도alkyd resin paint 알키드수지페인트all position welding 전자세용접all round light 전주등

air pump lever 

air purge type level gauge     air quenching  air rate air register    air reservoir   air resistance  air separator   air silencer    air starting cam air starting valve       

air suction pipe air suction port air tank 

air thermometer air trunk       air valve       

air vent pipe   air washer    

air-acetylene welding   공기-아세틸렌용접airborne noise air-cooled cascade blade       

air-cooled engine      aircraft carrier 

airless injection engine airplane warning light  

airtight bulkhead       airtight door  airtight test    Air-to-Surface Missile (ASM)alarm and monitoring system

alarm signal    alarm system  alcohol engine 

alcohol thermometer   

aliasing 

alkalinity       

Page 293: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

all told 총재화중량톤수전용착금속시험편통로악어가위절단기동소변태

allowable angle 허용각도allowable errorallowable hold loading 허용적재하중allowable limit 허용한계

인체진동허용한계진동허용한계

allowable loadallowable local loading 허용국부하중허용화물질량 allowable normal stress 허용수직응력허용압력allowable shear stress 허용전단응력허용응력allowable value 허용치allowable water velocityallowance 허용차allowance list 누락자재 목록alloy 합금합금철Alloy Steel Pipes (SPA) 배관용 합금강관합금강합금원소접안alongside repairalongside ship 접안alteration 개조alteration surveyalternate loading 격창적하alternate subcontractorAlternating Current (AC) 교류전류alternating current motor 교류전동기

교류동력계통alternating flashing light 교색섬광등

교색다섬광등교색다명멸등

alternating light 교색등교색명멸등alternating stress 교번응력 대안제시alternative power supply 대체동력원 대체동력원alternator 교류발전기aluminizing 알루미늄도금aluminum 알루미늄aluminum alloy 알루미늄합금aluminum anode 방식알루미늄

all weld metal test specimen   alley way      alligator shear allotropic transformation       

허용오차allowable limits of vibration to human body    allowable limits of vibration     허용하중allowable mass of cargo 

allowable pressure     

allowable stress 

허용유속

alloy iron      

alloy steel     alloying element       alongside pier   안벽수리

개조검사외주업체 변경

alternating current power network

alternating group flashing lightalternating group occulting light

alternating occulting lightalternative method proposal alternative source of power

Page 294: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

알루미늄청동aluminum spray coating 일루미늄스프레이코팅표준주위조건ambient temperature 주위온도ambient test 주위환경시험amendment plan 개정도

미국선급미국표준협회미국석유협회미국재료시험협회

미국냉동공조학회

미국기계학회미국수조회의미국용접학회

America's Cup Yacht 아메리카 컵 경기 요트amidships 선체중앙부ammeter 전류계

암모니아흡수식냉동기암모니아압축식냉각기

ammonia condenser 암모니아콘덴서ammonia purifier 암모니아청정기

암모니아냉매압축기무정형탄소수륙양용 장갑차수륙양용정상륙지휘함증폭기

amplitude 진폭Amplitude Modulation (AM) 진폭변조analysis pitch 해석피치analysis process 해석과정anchor 닻anchor 앵커anchor arm 앵커암anchor ball 정박표시구anchor bed 앵커받침anchor bill 앵커빌anchor board 앵커받침anchor bolt 앵커볼트

aluminum bronze   

ambient reference condition

American Bureau of Shipping (ABS)American National Standards Institute (ANSI)American Petroleum Institute (API)American Society for Testing Materials (ASTM)American Society of Heating, Refrigeration and Air Conditioning Engineers (ASHRAE)American Society of Mechanical Engineers (ASME)American Towing Tank Conference (ATTC)  American Welding Society (AWS)

ammonia absorption refrigerating machine      ammonia compression refrigerating machine

ammonia refrigerating compressoramorphous carbon      Amphibious Assault Vehicle (AAV)amphibious boat Amphibious Command Ship (LCC)amplifier       

Page 295: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

anchor buoy 앵커부이

anchor cable 앵커체인anchor capstan 앵커캡스턴anchor chain 앵커체인anchor chain cable 앵커체인anchor chock 앵커촉anchor crane 앵커크레인anchor crown 앵커크라운anchor davit 앵커대빗anchor drop-and-snub test 투묘시험anchor dues 정박료anchor fluke 앵커플루크anchor gear 양묘기anchor handling boat 양묘선anchor handling winch 앵커핸들링윈치anchor head 앵커헤드anchor light 정박등anchor lining 앵커라이닝anchor palm 앵커팜anchor pattern 앵커패턴anchor piece 고착쇠붙이anchor pocket 앵커포켓anchor point 고정지점anchor recess 앵커리세스anchor ring 앵커 링anchor rope 앵커로프anchor shackle 앵커섀클anchor shaft 앵커샤프트anchor shank 앵커섕크anchor stock 앵커스톡anchor stopper 앵커스토퍼anchor swivel 앵커스위블anchor telegraph 앵커텔레그래프anchor throat 앵커 목anchor tumbler 앵커텀블러anchor winch 앵커윈치anchor windlass 양묘기묘박지정박료anchoring 묘박anchoring equipment 묘박설비anchoring gear 양묘기anchoring test 투양묘시험anechoic chamber 무향실anechoic room 무향실풍속계anemoscope 풍향계아네로이드기압계angle 형강angle bar 형강angle gauge 각도계angle obliquity 압력각

anchorage anchorage 

anemometer 

aneroid barometer  

Page 296: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전진각angle of attack 받음각angle of attack in roll 투영횡경사각angle of diverging wave 발산파각angle of drift 표류각angle of encounter 만남각angle of entrance 물가름각angle of heel or list 횡경사각angle of incidence 입사각angle of repose 안식각angle of roll 횡동요각angle of run 물모음각표류각angle of spray 분무각도angle of trim 종경사각angle of wave direction 파도진행각angle of zero lift 무양력각angle valve 앵글밸브옹스트롬angular acceleration 각가속도angular advance 전진각angular momentum 운동량의 모멘트angular motion 각운동angular velocity 각속도aniline point 아닐린 점annealing 어닐링annealing furnace 어닐링 로Annual Survey (AS) 연차검사annulus combustion chamber 환상연소실annunciator 표시계anode 양극anode current 양극방식법answering flag 회답기answering pennant 회답기antechamber 예연실antenna 안테나antenna scanner 주사안테나antenna unit 안테나장치anthracite (coal) 무연탄anti-clutter 클러터방지anti-collision light 충돌예방등레이더충돌예방장치anti-collision system 충돌예방장치anticorrosive coating 방식코팅anticorrosive composition 방식제anticorrosive paint 방식도료anticorrosive tape 방식테이프anticorrosive treatment 방식처리anti-exposure suit 노출보호복anti-fouling 방오anti-fouling coating 방오코팅anti-fouling composition 방오제anti-fouling paintantifreeze solution 부동액antifriction composition 마찰감소제antifriction grease 마찰감소그리스antifriction metal 마찰감소금속

angle of advance  

angle of sideslip  

angstrom 

양극전류anodic protection       

anti-collision radar system

방오도료

Page 297: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

anti-motion device 감요장치anti-priming pipe 프라이밍방지관anti-rolling bar 횡동요방지봉anti-rolling tank 횡동요감쇠탱크anti-skid barantisubmarine submarine 대잠잠수함대잠수함전antisubmarine warfare ship 대잠함정anti-sweat insulation 결로방지anti-torpedo armament 대어뢰장갑판anti-torpedo boat gun 대어뢰정포anvil 모루aperiodic 비주기적인apparent pitch 겉보기피치apparent rolling 겉보기횡동요apparent slip 겉보기 미끄럼apparent slip ratio 겉보기 미끄럼비

겉보기 화물비중apparent wave height 겉보기파고apparent wave length 겉보기파장apparent wave period 겉보기파도주기apparent weight 겉보기무게appeal on disagreement 불복신청appendage 선체부가물선체부가물척도영향비applicable rule 적용규칙applicable standard 적용표준apprentice 실습생approach run 접근항주approach speed 접근속력approval approved drawing 승인도면approved maker 승인된 제조자approved plan 승인도면approved type 승인형식approved working pressure 승인사용압력approximate calculation 근사 계산apron 에이프런arbitrationarbitration tribunal 중재재판소arc 아크arc brazing 아크경납땜arc cutting 아크절단아크끝아크등arc length 아크길이arc resistant material 내아크성재료arc stabilizer 아크안정제arc strike 아크스트라이크arc time 순수용접시간arc voltage 아크전압

배관용 아크용접 탄소강관arc welding 아크용접arch 아치선미재arch framing 아치식늑골구조arch principle 아치식배구조

미끌림방지봉AntiSubmarine Warfare (ASW)

apparent specific gravity of cargo

appendage scale effect factor

승인

중재

arc end (of electrode)   arc lamp   

Arc Welded Carbon Steel Pipe (SPW)

Page 298: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

arch vessel 아치형선박archives 문서보관소area coefficient 면적계수area curve 면적곡선area of wetted surface 침수표면적area ratio 면적비argon arc welding 아르곤아크용접armature 전기자armature coil 전기자코일armature core 전기자철심armature winding 전기자권선armor 장갑armor backing 장갑뒷판armor bolt 장갑볼트armor closing plate 장갑끝판armor shelf 장갑받침armored cable 장갑피복케이블armored hose 장갑호스armored plate 방탄판armored wire 장갑피복전선arrangement plan 배치도arrival 입항arsenic bronze 비소청동articles for ship 선용품

관절기둥형계류articulated crane 다관절형크레인artificial antenna 모조공중선artificial coal 연탄artificial draft 인공통풍artificial intelligence 인공지능artificial seasoning 인공시효처리artificial ventilation 인공통풍

합리적 실행가능한 낮은 수준asbestos 석면asbestos board 석면판asbestos cloth 석면포

석면보온재asbestos lagging 석면마대asbestos packed cock 석면패킹콕석면패킹asbestos plate 석면판asbestos ring 석면링asbestos sheet 석면판asbestos tape 석면테이프as-built drawing 완성도면as-built gross thickness 건조총두께as-built thickness 건조두께ash free fuel 무회연료ash-shoot 소각재 배출구aspect ratio 종횡비as-rolled steel 압연강assembly 대조립assembly jig plan 조립용 지그플랜assembly line 조립라인assembly stage

articulated column type mooring

As Low As Reasonably Practicable (ALARP)

asbestos heat insulating material

asbestos packing  

조립공정

Page 299: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

assembly station 소집장소assistant cylinder 보조실린더assistant oiler 조기원associated work processes 관련작업공정astern 후진astern cam 후진캠astern dummy 후진더미astern exhaust cam 후진배기캠astern guardian valve 후진중간밸브astern igniter cam 후진점화캠astern maneuvering valve 후진조종밸브astern nozzle 후진노즐astern output 후진출력astern power 후진출력astern stage 후진단astern test 후진시험astern turbine 후진터빈asymmetric spin 비대칭스핀athwartship 옆방향atmospheric condenser 대기압복수기atmospheric discharge pipe 대기방출관atmospheric drain tank 대기압드레인탱크atmospheric escape pipe 대기방출관atmospheric exhaust 대기배출atmospheric line 대기선atmospheric pollution 대기오염atmospheric pressure 대기압atomic hydrogen welding 원자수소용접atomic mass unit 원자질량단위atomic propulsion 원자력추진atomization 분무화atomizer 분무기atrium 중앙홀attach 부착attached cavity 부착캐비티attached plating 부착판attachment 부착품attachment angle 부착 형강attachment plug 부착 플러그attained subdivision index 도달구획지수attemperator 과열조절기attention attracting light 주의환기신호등attenuation 감쇠attraction 인력audible 가청식audible alarm 가청경보auto alarm receiver 자동경보수신기auto filter 자동여과기자동부하경감장치auto-converter 자동변환기automated ship 자동화선automatic arc welding 자동아크용접automatic boiler control 자동보일러 제어automatic changeover 자동전환자동전환장비 자동체크밸브자동폐쇄장치

Auto Unloading System (AUS)

automatic changeover deviceautomatic check valve  automatic closing appliances

Page 300: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

자동연소제어automatic control 자동제어

자동화기기 작동시험자동급수조절기자동화재경보장치

automatic follow-up system 자동추종장치automatic gas cutting 자동가스절단

자동식별장치 automatic mooring winch 자동계선윈치

자동항해 및 침로유지장치automatic non-return valve 자동체크밸브

자동충돌예방장치비상신호자동키장치

automatic resetting 자동복귀automatic scavenging valve 자동소기밸브

자동복원팽창식구명뗏목센서위치자동추종장치

automatic shut down 자동정지 automatic sprinkler system 자동살수소화장치automatic starting system 자동시동장치automatic steering 자동조타automatic stopping device 자동정지장치

자동온도기록계automatic tension system 자동장력조절장치automatic tracking aids 자동추적장치

자동전압 조정기automatic welding 자동용접automobile ferry 자동차도선

자주식무인잠수정autopilot 자동조타장치auto-plotter 자동작도기auto-starter 자동시동기autotransformer 단권변압기auxiliary air compressor 보조공기압축기auxiliary air ejector 보조공기이젝터auxiliary air reservoir 보조공기탱크auxiliary ballast tank 보조밸러스트탱크auxiliary boiler 보조보일러auxiliary circulating pump 보조순환펌프auxiliary condensate pump 보조복수펌프auxiliary condenser 보조복수기

보조제어콘솔

Automatic Combustion Control (ACC)

automatic control device operation testautomatic feed water regulatorautomatic fire alarm system

Automatic Identification System (AIS)

Automatic Navigation and Track-keeping System (ANTS)Automatic Radar Plotting Aids(ARPA)automatic radiotelegraph alarm signal keying device    

automatic self-righting inflatable liferaftautomatic sensor positioning equipment 

automatic temperature recorder

Automatic Voltage Regulator (AVR)

Autonomous Underwater Vehicle (AUV)

Auxiliary Control Console (ACC)

Page 301: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

auxiliary cruiser 개장순양함auxiliary diesel engine 보조디젤기관auxiliary drain pump 보조드레인펌프auxiliary engine 보조기관auxiliary exhaust 보기배기보기배기계통auxiliary feed check valve 보조급수체크밸브auxiliary feed line 보조급수관계통auxiliary feed water pump 보조급수펌프auxiliary generator 보조발전기

보조발전기용디젤기관보조발전기연료유탱크

auxiliary gunboat 개장포함auxiliary light 보조등auxiliary machinery 보기

보기용디젤기관보기실보기용증기터빈보조타보조증기관보조조타장치보조스톱밸브보조배전반보조선유효에너지유효열량해손정산인

average error

평균운임요율해손

aviation briefing room 항공브리핑실awning 천막천막붐awning deck 차양갑판awning rafter 천막대들보awning ridge 천막대들보awning spar 천막횡재awning stanchion 천막기둥awning stretcher 천막살axial blower 축류송풍기axial clearance 축방향틈axial compressor 축류압축기axial damper 축방향댐퍼axial flow 축류 axial flow pump 축류펌프axial flow turbine 축류터빈axial induced velocity 축방향유기속도axial load 축하중axial stress 축응력axial velocity 축류속도axial vibration damper 종진동댐퍼axis of oscillation 동요기준축

auxiliary exhaust arrangement

auxiliary generator diesel engine auxiliary generator engine fuel oil tank

auxiliary machinery diesel engineauxiliary machinery room      auxiliary machinery steam turbineauxiliary rudder auxiliary steam pipe   auxiliary steering gear auxiliary stop valve    auxiliary switchboard   auxiliary vessel available energy       available heat  average adjuster        평균오차Average Freight Rate Assessment (AFRA)average 

awning boom   

Page 302: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

axis of weld 용접기준축axisymmetric body 축대칭물체axle 차축axle load 축하중 azimuth 방위각azimuth circle 방위환azimuth compass 방위컴퍼스azimuth mirror 방위경azimuth propulsion system 선회식추진장치azimuth ring 방위눈금azimuth stabilization 방위안정azimuth table 방위표azimuth thruster 선회식추진기azimuth vane 방위날개AZIPOD 애지포드B class divisionBabbitt metal 배빗금속back angle 뒷댐형강back assembly 후면조립공사back bead 뒷면비드back board 배판back bracket 이면 브래킷back cavitation 뒷면캐비테이션back chipping 뒷면다듬질back end plate 뒷막음판back gouging 뒷면가우징back hook 뒷면문걸이back piece 뒷댐재back pitch 횡피치back plate 배판back pressureback pressure turbine 배압터빈back rope 백로프back stayback wash filter 역세척여과기back wash strainer 역세척여과기back weld 이면용접back windback-column 뒷기둥backfire 역화backhand welding 후진용접back-housing 뒷기둥backing angle 뒷댐형강backing materials 뒷댐재료backing pass 이면용접backing plate 전선도판backing power 후진출력backing strip 뒷댐편backlashbackside marking 후면마킹backside undercut 후면언더컷backstay 백스테이back-step sequence 후진용접법back-step welding 후진용접back-strip weldingbackup 백업backup breaker 뒷받침차단기backup pump 백업펌프

B급구획

배압

뒷당김줄

뒷바람 (순풍)

백래시

뒷댐편용접

Page 303: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

backward curved vane 뒤로휜날개backward scheduling 후진계획법baffle plate 조절판bag rack 옷선반baggage room 소화물실bailer 물푸개bait 미끼bait tank 활어창bait well 활어창balance 평형balance factor 평형계수balance weight 평형추balanced chain 밸런스드 체인balanced rudder 평형타balanced weight method 평형추식하역법balancer 밸런서balancing machine 평형시험기balancing test 평형시험bale capacity 포장화물용적bale cargo 포장화물bale cargo capacity 포장화물용적bale sling 포장화물하역고리ball and socket couplingball bearing 볼베어링ball joint 볼조인트ball launching 볼진수ball thrust bearing 추력볼베어링ball valve 볼밸브ballast 밸러스트ballast condition 밸러스트상태Ballast Control Room (BCR) 밸러스트조정실ballast pump 밸러스트펌프ballast pump diesel engine 밸러스트펌프용디젤기관ballast pump turbine 밸러스트펌프용터빈ballast stripping pump 밸러스트스트리핑펌프ballast suction pipe 밸러스트흡입관ballast tank 밸러스트탱크ballast water exchange 밸러스트수교환밸러스트수탱크가속도오차ballistic plate 방탄판balloon hatch 벌룬탑

발틱국제해운동맹Baltic Freight Index (BFI) 발틱운임지수Baltic ice class 발틱해 내빙band 띠band brake 밴드브레이크band level 밴드레벨band plate 띠판bank 뱅크bar 바bar element 봉요소bar gauge 봉게이지bar grating 봉격자bar keel 방형용골bar steel 봉강bar stem 바 선수재

볼-소켓연결

ballast water tank     ballistic deflection 

Baltic and International Maritime Council (BIMCO)

Page 304: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

bar thermometer 막대온도계barbette 포탑장갑Bare Boat Charter (BBC) 나용선bare electrode 알몸용접봉bare hull 알몸선체bare live part 나충전부barge 부선

부선적립식펌프준설선Barge Mounted Plant (BMP) 부선형해상플랜트barge type platform 부선형플랫폼barge-carrying ship 부선운반선bark 바크barkentine 바컨틴barnacle 따개비barometer 기압계barometric pressure 대기압barque 바크barred speed range 연속운전금지구역barrel 배럴barrel hoisting winch 중추가이드윈치barrier 배리어barrow 손수레base block 바닥받침목base cargo 밑짐base metal 모재base metal test specimen 모재시험편base plate 밑판baseline 기선base-vented flows 밑면공기공급흐름basic design 기본설계basic insulation 기본절연basic steel 염기성강basin trial 계류시운전basket armor 외장batch processing 일괄처리batch purification 일괄청정batcher 배처batcher plant barge 콘크리트믹서용 부선bathy thermograph 수심수온기록기Bathyscaphe 바티스카프batten 배튼battening arrangement 죔장치battered section 경사단면battery charger 충전기

배터리내장형비상등battery operated lamp 축전지식 전등battle cruiser 순양전함battle ship 전함battle tracer 항적추적기록기Baume's hydrometer 보메 비중계Baume's scale 보메 눈금Bauschinger effect 바우싱거 효과 bay 베이bayonet base 베이어닛꼭지bayonet joint 베이어닛연결beach mark 비치 마크

barge loading cutter suction dredger

battery integrated emergency light

Page 305: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

beacon 표지beacon sign 표지부호beacon station 표지국bead welding 비드용접beading 비딩beading line 비딩곡선beam 갑판보beam 선폭beam bender 보굽히개beam bracket 갑판보브래킷beam camber 갑판보캠버beam clamp 갑판보클램프beam column 보기둥 beam column buckling 보기둥좌굴beam compass 빔컴퍼스beam draft ratio 폭흘수비beam element 보요소beam length ratio 폭길이비beam mold 보본beam runner 빔러너beam sea 횡파beam shelf 갑판보받침대beam space 갑판보간격beam theory 보이론beam trawler 빔트롤러beam width 빔폭beam wind 옆바람bear away 밀리기bearding line 비어딩라인bearer 받침bearing 방위bearing 베어링bearing accuracy 방위정도bearing bush 베어링부시bearing cap 베어링캡bearing compass 방위컴퍼스bearing cursor 방위용움직눈금bearing discrimination 방위식별능bearing error 방위오차bearing force 축기진력bearing keep 베어링캡bearing marker 방위눈금bearing metal 베어링메탈베어링빼내기공구베어링면압bearing resolution 방위분해능bearing ring 베어링링beat 울림Beaufort force 보퍼트풍력Beaufort wind scale 보퍼트풍력등급bedplate 받침판behind schedulebelaying cleat 클리트belaying pin 빌레잉핀bell 호종bell buoy 타종부표bell mouth 벨마우스bell mouth forming tool 관끝성형공구

bearing metal removing devicebearing pressure 

공정지연

Page 306: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

bell push 누름단추bell whistle 종형기적bell with a pilot lamp 표시등붙이 벨bellows 주름통bellows pressure gauge 주름통식압력계

벨로즈식신축관이음쇠belt conveyor 벨트컨베이어belt driving 벨트구동belt pulley 벨트풀리benchmark test 벤치마크검사bend 벤드bending 굽힘bending moment 굽힘모멘트bending moment curve 굽힘모멘트곡선bending radius 굽힘반지름bending roll 굽힘가공장비bending slab 벌집정반bending stress 굽힘응력bending template 굽힘본bending test 굽힘시험bending vibration 굽힘진동bent pipe fabricationBernoulli's theorem 베르누이정리 berth 선대berth 정박지berth declivity 선대경사berth light 침대등berth schedule 선대사용예정표Bessemer converter 베서머전로Bessemer steel 베서머강best bower 우현큰닻between deck cargo space 갑판간 화물구역between deck compartment 갑판간 구획실between decks 갑판간bevelbevel 베벨베벨각도bevel board 베벨판bevel frame 베벨늑골bevel gear 베벨기어bevel groove anglebevel wheel 베벨바퀴beveling frame 베벨측정기beveling machine 베벨기계beveller 베벨지레bi-colored light 양색등bidet 비데bifurcation buoy 하단부표bilge 빌지bilge 선저만곡부bilge block 빌지블록bilge board 빌지보드bilge circle 빌지부원호bilge cord 빌지코드bilge curvature 빌지 외판bilge ejector 빌지이젝터bilge hat 빌지햇

bellows type expansion pipe joint

곡관제작

개선bevel angle    

개선각도

Page 307: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

bilge holding tank 빌지저장탱크bilge hopper 빌지호퍼bilge hopper tank 빌지호퍼탱크bilge injection 빌지흡입장치bilge keel 빌지킬bilge keelson 빌지부내용골bilge main pipe 빌지주관bilge pipe 빌지관bilge plate 선저만곡부 외판bilge plug 빌지마개bilge pump 빌지펌프bilge radius 선저만곡부 반지름bilge separated oil tank 빌지분리유탱크bilge separator 빌지분리기bilge shore 선저만곡부 받침목bilge strake 선저만곡부 외판bilge stringer 빌지스트링거bilge suction pipe 빌지흡입관bilge tank 빌지탱크bilge timber 선저만곡부재bilge water 빌지수bilge well 빌지웰bilged compartment 침수구획bilinear interpolation 쌍선형보간법Bill of Lading (B/L) 선하증권Bill Of Material (BOM) 자재명세서billboard 빌보드billet 빌릿bin 빈binary fluid cycle 유체병용사이클binder 고착제binnacle 비너클binnacle lamp 비너클 등binocular 쌍안경

생화학적산소요구량bio-fouling 생물오손biologic shield 생체보호차폐bipod mast 이각마스트bismuth 창연bit 비트bite type union 물림형유니언bituminous cement 역청시멘트bituminous coal 역청탄bituminous enamel 역청에나멜bituminous solution 역청액black ball 흑구black bolt 블랙볼트black conical shape 흑색원추형상물

흑심가단주철black lead 흑연black wall hitch 블랙월히치blackout 블랙아웃blackout test 블랙아웃시험blacksmith welded joint 단접이음blacksmith welding 단접blacksmith welding quality 단접성

Biochemical Oxygen Demand (BOD)

black heart malleable cast iron

Page 308: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

blade 날개blade 배토판blade angle 날개각blade angle indicator 날개각지시계blade area ratio 날개면적비blade arrangement 날개배열blade back 날개뒷면blade clearance 날개열간격blade efficiency 날개효율blade element theory 날개요소이론blade face 날개앞면blade following edge 날개뒷날blade inlet angle 날개입구각blade lattice 날개열blade leading edge 날개앞날blade loss 날개손실blade opening 날개사이blade outlet angle 날개출구각blade pressure side 날개압력면blade profile 날개프로파일blade rake 날개레이크blade reference line 날개단면기준선blade ring 날개링blade root 날개뿌리blade section 날개단면blade section 날개단면기준점blade stopper 날개고정쇠blade suction side 날개흡입면blade thickness 날개두께blade thickness fraction 날개두께비blade thickness ratio 날개두께비blade tip 날개끝blade tip clearance 날개끝단간극blade trailing edge 날개뒷날blade vortex flow 날개끝소용돌이흐름blade width 날개나비blading 날개배열blank flange 맹플랜지blank plate 맹판blast 폭풍blast air 분사공기blast air bottle 분사공기병blast air gauge 분사공기압력계blast air pipe 분사공기관blast air strainer 분사공기여과기blast furnace 용광로blast heater 송풍가열기blast injection 공기분사blast pipe 송풍관blast screen 폭풍막이bleached tar 탈색타르도료bleed 추기bleed steam pipe 추기증기관bleeder 추기구멍blend oil heater 블렌드연료유가열기blended fuel oil tank 블렌드연료유탱크blended oil 블렌드유blender 배합기

Page 309: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

blind cover 가림덮개blind curtain 가림커튼blind flange 맹 플랜지blind patch 막음판blind plate 맹판blind sector 맹목구간blister 블리스터blister steel 침탄강block 도르래block 블록block assemblyblock building 블록건조block coefficient 방형계수block division 블록분할block inspection 블록검사block joint 블록조인트block loading 블록적하block outfitting 블록의장block survey 블록검사block system 블록식건조법block welding sequence 블록용접과정blockage 위벽효과blockage correction 위벽효과수정blooming mill 분괴압연기blow down

동압과급방식blowerblowholeblowlamp 블로램프blowoff cock 분출콕blowoff valve 분출밸브blowout 분출blowout cock 분출콕blowout preventer 분출방지기blowout valve 분출밸브blowpipe torch 블로파이프토치blue brittleness 청열취성blue flare 푸른불꽃신호Blue Peter 출범기board measure 목재용적단위boat 단정단정장치도boat block 단정도르래boat chock 단정 촉boat compass 단정컴퍼스boat cover 단정덮개boat davit 단정대빗boat deck 단정갑판boat deck light 단정갑판등boat derrick 단정데릭boat drill 단정훈련boat embarkation light 단정갑판등boat equipment 단정비품boat fall 단정 폴boat gripe 단정고정띠boat handling gear 단정올림내림장치boat hoist 단정호이스트

블록대조립

배출blow down turbo charging system 송풍기용접기공

boat arrangement 

Page 310: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

boat hook 단정훅boat lamp 단정등boat launching arrangement 단정진수장치boat light 단정등boat seaplane 비행정boat skate 보트스케이트boat skid 보트스키드boat spar 단정스파boat stowage 단정적재boat test 단정시험boat winch 보트윈치boatswain 갑판장boatswain store 갑판장창고boatswain's chair 걸이식의자bob weight 연직추bobstay 봅스테이body axes 물체고정축body plan 정면도boiler 보일러boiler bearer 보일러받침boiler blow off pipe 보일러수빼기관boiler casing 보일러케이싱boiler clearance 보일러주위간격boiler clothing 보일러피복boiler compound 보일러청정제

보일러청정제주입펌프boiler compound tank 보일러청정제탱크boiler compound vessel 보일러청정제용기boiler drum 보일러동체boiler efficiency 보일러효율boiler feed water 보일러급수boiler fittings 보일러부품boiler foundation 보일러지지대boiler fuel oil heater 보일러연료유가열기보일러연료유 침전탱크boiler graphite 보일러흑연boiler horsepower 보일러마력boiler ignition oil tank 보일러점화유탱크boiler incrustation 보일러스케일boiler lagging 보일러피복boiler maker's shop 보일러공장boiler mountings 보일러부품boiler oil 보일러유boiler pedestal 보일러발boiler plate 보일러판boiler pressure 보일러압력boiler room 보일러실boiler room casing 보일러실케이싱boiler room grating 보일러실격자boiler room opening 보일러실개구boiler scale 보일러 침전물boiler seating 보일러받침boiler shell 보일러동체boiler shop 보일러공장boiler soda boiling 보일러소다끓임boiler space 보일러실boiler stay 보일러버팀

boiler compound injection pump

boiler fuel oil settling tank

Page 311: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

boiler steel 보일러용강재boiler stool 보일러받침boiler support 보일러지주Boiler Survey (BS) 보일러검사boiler test 보일러시험boiler test pump 보일러시험펌프boiler trial 보일러시험boiler tube 보일러튜브boiler water 보일러수보일러수순환관보일러수순환펌프

보일러 시험용수 채취장치보일러 시험용수 채취밸브보일러수시험기

boiling point 비등점boiling water reactor 비등수형원자로Boil-Off Gas (BOG) 증발가스증발가스 가열기bollard 볼러드bollard pull 볼러드당김bollard test 볼러드시험bolster 볼스터bolt cutter 나사깍기기계bolt head 볼트머리bolt head trimming 볼트머리깍기bolt point 볼트끝bolt rope 볼트로프bond 접속재bond 접착제Bonjean's curve 본전곡선bonnet 보닛booby hatch 갑판출입구boom 붐boom head guy 스팬가이boom rest 붐받침대boom sheet 붐시트boom support 붐받침대boom vang 붐 당김줄boomkin 범킨booster 부스터booster heater 부스터가열기booster pump 부스터펌프booster system 부스터방식boot topping 수선부boot topping paint 수선부도장bore 안지름borer 조개류boring 보링boring machine 보링머신boss 보스boss plate 보스외판boss ratio 내외 지름비bossed frame 보스늑골bossing 보싱bossing angle 보싱각

boiler water circulating pipeboiler water circulating pumpboiler water sampling deviceboiler water sampling valveboiler water testing apparatus

boil-off gas warm-up heater

Page 312: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

both-sides weldingbottom block 선저블록bottom board 선저내장bottom cement 선저시멘트bottom cover 밑뚜껑bottom dead center 하사점bottom frame 선저늑골bottom girder 선저거더bottom heavy 보텀헤비bottom liner extension 하부라이너연장부bottom longitudinal 선저종늑골bottom member 선저부재bottom paint 선저도료bottom plank 선저목판bottom plate 선저외판bottom plug 선저플러그bottom raking damage 선저긁힘손상bottom sampler 채니기bottom sheathing 선저피복bottom shell platingbottom sighting 선저계측bottom survey 선저검사bottom transverse 선저트랜스버스bottom valve 선저밸브bottoms 선복량boundary condition 경계조건경계요소법

경계적분법boundary interface 경계면boundary layer 경계층boundary layer ingestion 경계층 유입boundary layer thickness 경계층두께boundary line 외판선boundary plate 날개끝판

부르동관압력계bow 선수bow and stern construction 선수미구조bow area 선수부bow chock 선수촉bow chock screen 선수바람막이천막bow constructionbow construction profile 선수구조도bow deck 선수갑판bow door 선수문bow down 선수를 아래로bow flare 선수플레어bow flare slamming 선수플레어슬래밍bow line 바우라인bow propeller 선수프로펠러bow roller 바우롤러bow rudder 선수타bow sea 선수측면파bow sheave 선수시브bow swing tackle 바우스윙태클bow thruster 선수스러스터bow visor 바이저형 선수문

양면용접

선저외판

boundary element method(BEM)boundary integral method (BIM)

Bourdon tube pressure gauge

선수구조

Page 313: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

bow warning light 구상선수주의등bow wave 선수파bower anchor 선수 앵커bowline knot 바우라인매듭bowsprit 바우스프릿box beam 상자형 보box coupling 박스형 커플링box girder 상자형 거더box spanner 박스스패너brace 브레이스bracket 브래킷bracket attachment 브래킷붙임bracket connection 브래킷고착bracket floorbracket frame 브래킷늑골bracket light 벽붙이등bracket system 브래킷방식bracket toe 브래킷토bracketed end connection 브래킷단부연결bracketless-system 무브래킷방식braided rope 땋은로프braided wire 땋은와이어brail 브레일brake 제동기brake band 제동띠brake disc 제동반brake drum 제동드럼Brake Horse Power (BHP)brake lining 브레이크라이닝brake output 제동출력brake power 제동동력brake shoe 브레이크슈brake-in system 브레이크인방식branch anchor 보조앵커branch bilge pipe 빌지지관branch box 분기함branch chain cable 보조체인branch circuit 최종지회로branch duct 분지관덕트branch pipe 분지관brassbrass casting 황동주물Brayton cycle 브레이톤사이클brazing 경납땜brazing socket 경납땜소켓brazing union 경납땜유니언breadth 폭breadth depth ratio 폭깊이비breadth extreme 최대폭break away flutter 박리성진동break bulkhead 선루단격벽breakage 파손breakdown 파손breaker 물통break-in period 적응기간breaking criterion 쇄파기준breaking joint 브레이킹조인트breaking load 파괴하중

조립늑판

제동마력

황동

Page 314: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

breaking strength 파괴강도breaking test 파괴시험breaking wave 쇄파breakwater 쇄파기breakwater 방파제breaming 선저굽기breast hook 브레스트훅breast line 브레스트라인breather valve 브리더밸브breathing apparatus 호흡구breathing device 호흡구breathing gas system 호흡가스장치breeches pipe 쌍가닥파이프breeding 증식brick cork 코르크벽돌brickwork 벽돌쌓기bridge 선교bridge after bulkhead 선교후단격벽bridge control 선교제어bridge deck 선교루갑판bridge design 선교설계 bridge gauge 브리지게이지bridge house 선교갑판실bridge maneuvering 선교 원격조정bridge piece 아치선미재bridge spot welding 브리지스폿용접

선교대선교통신 brig 브리그brigantine 브리건틴bright display 고휘도표시brightness control 휘도조정brilliance control 휘도조정brine 브라인brine agitator 브라인혼합기brine cooler 브라인냉각기brine pipe 브라인관brine pump 브라인펌프brine system 브라인식brine tank 브라인탱크Brinell hardness 브리넬경도briquette 연탄British Standards 영국표준공업규격영국식 열단위brittle fracturebroaching 브로칭broad reach 넓은 바람각broad seam 넓은 이음매broadside 현측broadside torpedo tube 현측어뢰발사관broken space 화물틈새broken stowage 화물틈새bronze casting 청동주물brown coal 갈탄brush coatingbrush holder 브러시홀더bubble cavitation 버블캐비테이션bubble plume 기포군

bridge to bridge communication

British Thermal Unit(BTU) 취성파괴

붓도장

Page 315: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

bubblingbubbling point 거품점bucket 버킷bucket dredger 버킷식준설선bucket elevator 버킷엘리베이터bucket guide roller 버킷가이드롤러bucket ladder 버킷래더bucket link 버킷링크bucket pin 버킷핀bucket pump 버킷펌프버킷휠식리클레이머buckler 호저파이프뚜껑buckling 좌굴buckling factor 좌굴계수buckling load 좌굴하중buckling strength 좌굴강도

buffer 완충기buffer spring 완충스프링buffing machine 버핑머신build strategy

조선소공급품builder's certificate 건조자 증명서건조자안벽시운전Builder's Sea Trial (BST) 건조자해상시운전Builder's Trial (BT) 건조자시운전선대building dock 건조독building slip 선대 building specification 건조시방서built block 조립도르래

수중검사를 위한 마킹built-up beam 조립보built-up crankshaft 조립크랭크축built-up frame 조립늑골built-up propeller 조립프로펠러built-up section 조립단면재built-up type 조립형built-up weldingbuilt-up welding sequence 적층용접순서bulb 벌브bulb angle 구평강bulb keel 벌브 용골bulb plate 구평강bulb section 구평강bulb teebulbous bow 구상선수bulbous bow warning light 구상선수주의등bulge 벌지

구상선수 종단면적계수

기포발생

bucket wheel type reclaimer

Budgeted Hours of Work Performed (BHWP) 작업완료분 예산시수Budgeted Hours of Work Scheduled (BHWS) 작업미완료분 예산시수

건조전략Builder Furnished Equipment (BFE)

Builder's Harbor Trial (BHT)

building berth  

Built for In-water Survey (BIS) mark

육성용접

벌브형 티(T)형강

bulge area coefficient for bulbous bow

Page 316: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

bulging shell 벌지외판bulk cargo 산적화물bulk carrier 산적화물선bulk modulus 체적탄성계수bulkhead 격벽bulkhead block 격벽블록bulkhead deck 격벽갑판bulkhead floor plate 격벽늑판bulkhead light 벽붙이등bulkhead liner 격벽라이너bulkhead piece 격벽관통 피스bulkhead plan 격벽구조도bulkhead recess 격벽골bulkhead stiffener 격벽보강재bulkhead stool 격벽스툴bulkhead stop valve 격벽스톱밸브bulkhead stuffing box 격벽패킹상자bulkhead valve 격벽밸브bull ring 패킹누름링bullet proof plate 방탄판bull's eye 눈알유리bull's eye lamp 꼬마전등bulwark 불워크bulwark freeing port 불워크배수구bulwark ladder 불워크사다리bulwark line 불워크선bulwark netting 불워크망bulwark plating 불워크판bulwark stanchion 불워크기둥bulwark stay 불워크지주bulwark strake 불워크스트레이크bumped head 접시형끝판bumpkin 범킨bunker 연료고bunker bulkhead 연료고격벽bunker capacity 연료고용량bunker coal 연료탄bunker oil 연료유bunker price 연료유가격bunkering 연료유적재bunkering station 연료공급지bunt line 번트라인buoy 부이buoy 부표buoy davit 부표대빗buoy hook 부표훅buoy mooring 부표계류buoy rope 부표줄buoy shackle 부표섀클buoy skid 부표스키드buoy tender 부표설치선buoyancy 부력buoyancy chamber 부력실buoyancy curve 부력곡선buoyancy flux 부력플럭스buoyancy tank 부력탱크

Page 317: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

buoyant apparatus 구명부기buoyant material 부력재료buoyant smoke signal 발연부신호burden 재화능력burdened vessel 침로유지선Bureau Veritas (BV)burgee 쌍꼬리깃발burn up 핵연료소모율burned damage 소손burner 버너burner master valve 버너마스터밸브burner tip 버너팁burner work bench 버너용청소대burner working table 버너용청소대burning furnace 연소로bursting 파열bursting pressure 파열압burthen 재화능력burtoning method 맞당김식하역법bus duct 버스덕트bush 부시butt 버트butt forge weld 맞대기단접butt joint 맞대기이음butt resistance weld 맞대기저항용접butt seam welding 맞대기심용접butt strap 맞대기덧판butt strap joint 맞대기덧판이음butt weld 맞대기용접butterfly nut 나비형너트butterfly valve 나비형밸브buttering 버터링 butterworth heater 버터워스가열기butterworth opening 버터워스 개구butterworth pump 버터워스펌프buttock line 수직종단면선buttock plane 수직종단면buzzer 버저by the wind 맞바람돛달기로bypass 바이패스bypass filter 바이패스필터bypass line 바이패스라인bypass pipe 바이패스관bypass purifying 바이패스청정bypass valve 바이패스밸브bypath 바이패스by-productbyte 바이트 cabin 선실cabin compass 선실컴퍼스cabin door 선실문cabin passenger 선실여객cabin plan 선실배치도cabin store 선실용품창고cabin stores 선실용품cable 케이블cable band 전선밴드cable bundle 전선다발

프랑스선급

부산물

Page 318: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

cable burying equipment 케이블매설기cable clench 케이블클렌치cable clip 케이블클립cable drum 케이블드럼cable duct 케이블덕트cable dynamometer 장력계cable entrance 케이블도입구cable gland 전선관통붙이cable gripper 케이블그라이퍼cable hanger 전선지지붙이cable hauling gear 케이블인양장치cable holder 케이블홀더cable layer 케이블부설선cable laying barge 케이블부설부선cable laying ship 케이블부설선케이블길이측정장치cable lifter 체인홈바퀴cable penetration 케이블관통부

케이블부설기cable precutting 케이블선행절단cable recess 케이블리세스cable run 전로cable saddle 전선고정붙이cable socket 케이블소켓cable stopper 케이블멈추개cable tank 케이블탱크cable tie 전선결속띠cable trough 케이블홈통cable trunk 전로배치함cable way 전로cable winch 케이블윈치cabtyre cable 캡타이어 케이블cadet 실습생cage mast 케이지마스트caisson 케이슨

케이슨제작용작업부선점결탄칼슘브라인규산칼슘보온재검교정용레버

calibration 검교정캘리퍼스calking 코킹코킹끌코킹홈코킹해머코킹끌코킹맬릿코킹피스코킹편코킹공구호출부호칼로리열용량발열량

cable length measuring device

cable picking and laying machine 

caisson fabricating barge       caking coal    calcium brine  calcium silicate heat insulating material calibrating lever 

calipers 

calking chisel  calking groove calking hammer calking iron    calking mallet  calking piece   calking strip   calking tool    call sign       calorie calorific capacity       calorific value  

Page 319: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

열발생calorifier 온수기열량계cam 캠캠간격캠선도캠레버캠롤러camber 캠버캠버곡선수중날개캠버캠버비camouflage 위장camshaft 캠축

캠축윤활유냉각기캠축윤활유펌프캠축윤활유탱크원통형부표원통형거르개원통형거르개원통연소실운하부선

양쪽열림독건조법운하용타운하통행료운하톤수통조림공장선통조림공장카누양면팽창식구명뗏목

canopy 캐노피canopy light 캐노피등

캔트보선미캔트부캔트늑골cantilever 외팔보외팔늑골선canvas 캔버스캔버스보트canvas cover 캔버스덮개캔버스호스캔버스공사캡너트

정전용량액면계capacitor 축전기capacity control 용적도

calorification   

calorimeter     

cam clearance cam diagram   cam lever      cam roller     

camber line    camber of a hydrofoil  camber ratio   

camshaft lubricating oil cooler camshaft lubricating oil pump  camshaft lubricating oil tank   can buoy       can filter       can strainer    can type chamber      

canal barge    

canal dock building system     

canal rudder   

canal toll      canal tonnage  canning factory ship   canning plant  canoe  canopied reversible inflatable liferaft

cant beam     cant body      cant frame     

cantilever framed ship 

canvas boat    

canvas hose   canvas work   cap nut capacitance type level gauge   

용량제어capacity plan      

Page 320: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Cape size 케이프급Cape size bulk carrier 케이프급 산적화물선capillarity 모세관현상모세관주력함capsizing 전복 capstan 캡스턴캡스턴 막대캡스턴 원통선장갑판선장창고선장선장실선장실captyre cable 켑타이어케이블

자동차운반선자동차갑판자동차도선자동차운반부선자동차겸 산적 화물선침수식아세틸렌가스발생기

carbon arc 탄소아크탄소아크절단carbon arc gouging 탄소아크가우징탄소아크용접탄소브러시탄산가스용기탄산가스용기

탄산가스소화기탄산가스소화장치탄산가스기록계탄산가스흡수장치탄소봉전극탄소봉집게

carbon monoxide 일산화탄소탄소패킹탄소패킹글랜드탄소봉압력배관용탄소강관고압배관용 탄소강관고온배관용탄소강관배관용 탄소강관탄소강탄소섬유강화플라스틱탄화탄소첨가탄화염방위기점

capillary tube  capital ship    

capstan bar    capstan barrel captain deck   captain room store     captain captain's cabin captain's room 

car carrier     car deck       car ferry       car float       car/bulk carrier       carbide to water gas generator 

carbon arc cutting     

carbon arc welding     carbon brush   carbon dioxide bottle   carbon dioxide cylinder carbon dioxide fire extinguisher carbon dioxide fire extinguishing system       carbon dioxide recorder carbon dioxide scrubber carbon electrode       carbon holder  

carbon packing carbon ring gland  carbon rod     Carbon Steel Pipe for Pressure Service (SPPS)Carbon Steel Pipes for High Pressure Service (SPPH)Carbon Steel Pipes for High Temperature Service (SPHT)Carbon Steel Pipes for Orinary Piping (SPP)carbon steel   Carbon-glass Reinforced Plastic (CRP)carbonization   carburization   carburizing flame       cardinal points 

Page 321: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선창내장재하역용도르래cargo capacity tonnage 재화용적톤수하역제어실하역체인하역등cargo containment system 화물격납장치하역제어반하역제어반하역제어실하역줄cargo gear 하역장치cargo gear survey 하역장치검사하역장치cargo handling machine 하역기계cargo handling system 하역설비화물창구cargo hold 화물창화물창용적cargo hook 하역고리cargo insurance 적하보험하역등화물리프트하역등cargo loading door 화물적재문카고매니폴드하역망cargo oil 화물유

화물유집합펌프화물유가열관

cargo oil pipe 화물유관화물유관장치cargo oil pump 화물유펌프cargo oil pump condenser 화물유펌프복수기

화물유펌프자동흡기장치cargo oil pump turbine 화물유펌프용 터빈

화물유펌프터빈복수기화물유탱크적하배치도

cargo port 재화문현측화물적재문화물창냉동기냉각수펌프하역줄화물고박지침서

cargo segregation 하역섀클cargo ship 화물선

화물선안전구조증서화물선안전설비증서

cargo batten   cargo block    

cargo center   cargo chain    cargo cluster   

cargo control console  cargo control panel    cargo control room    cargo fall      

cargo handling gear    

cargo hatchway 

cargo hold capacity    

cargo lamp     cargo lift       cargo light     

cargo manifold cargo net      

cargo oil collecting pump      cargo oil heating pipe  

cargo oil piping system 

cargo oil pump self-priming system

cargo oil pump turbine condensercargo oil tank  cargo plan     

cargo port door cargo refrigerator cooling water pumpcargo runner   Cargo Securing Manual (CSM) 화물격리cargo shackle  

cargo ship Safety Construction (SC) certificate       cargo ship Safety Equipment (SE) certificate 

Page 322: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

화물선안전무선전신증서cargo sling 화물하역고리화물구역하역윈치하역와이어로프하역와이어로프칼링카르노사이클carpenter 목공목공공사도래송곳carpenter's store 목공창고목공용품Carpenter's workshopcarpentry shop 목공장통로용양탄자carrier 해치빔받침배출손실직교좌표계cascade 익렬익렬영향다단탱크익렬풍동익렬전향각다단용접법case hardeningcasing 케이싱케이싱파이프사용후 핵연료수송용기주철주강castings 주강품캐슬너트casualty 해난앵커대빗캣폴촉매화학반응catamaran 쌍동선catamaran dinghy 쌍동딩기

쌍동형 준설선catamaran yacht 쌍동요트캐터펄트어로선음극선관

음극선관방위측정기cathodic protection system 음극방식시스템cattle carrier 가축운반선가축우리catwalk 상설보행로caulker 코커caulking 코킹caulking chisel 코킹 정 알칼리취성주의판

cargo ship Safety Radiotelegraphy (SR) certificate   

cargo space    cargo winch    cargo wire rope cargo wire runner      carling Carnot's cycle 

carpenter work carpenter's ring auger 

carpenter's stores     목공소carpet runner  

carry over loss Cartesian co-ordinate system

cascade effect cascade tank   cascade tunnel cascade turning angle  cascade welding sequence      표면경화casing pipe    cask      cast iron       cast steel      

castle nut      

cat davit       cat fall catalytic chemical reaction

catamaran type dredging vessel

catapult catcher boat   Cathode Ray Tube (CRT)  cathode-ray direction finder    

cattle stall     

caustic brittleness      caution plate   

Page 323: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

cavitation 캐비테이션cavitation 공동현상캐비테이션제어cavitation corrosion 케비테이션부식캐비테이션손상캐비테이션흐름캐비테이션이력현상캐비테이션초생캐비테이션수캐비테이션탱크캐비테이션반류cavity 공동cavity 캐비티캐비티길이캐비티압력캐비티두께ceiling board 내장판자내장선창천장등천장돌림테ceiling panel 천장패널cell guide 셀가이드cell-centered scheme 셀중심법cellular construction 셀구조cellular double bottom 시멘트운반선시멘팅펌프시멘트사일로시멘트칠cementation 침탄침탄법침탄강시멘팅유닛시멘타이트중심선내저판센터보드center bottom girder 선저중심거더중심선칸막이center flange 중간플랜지중심주파수중앙로센터게이지중심선거더center keelson 중심선 내용골center line 중심선중심선격벽

중심선종통판부심곡률중심풍압중심무게중심충격중심투영측면적중심횡저항중심동요중심충격중심

cavitation control      

cavitation damage      cavitation flow cavitation hysteresis   cavitation inception     cavitation number      cavitation tank cavitation wakes       

cavity length cavity pressure cavity thickness 

ceiling hold    ceiling light    ceiling molding 

구획식이중저cement carrier cement pump  cement silo    cement wash   

cementation process   cemented steel cementing unit cementite      center (line) strake  center board   

center division 

center frequency       center furnace center gauge   center girder   

center line bulkhead   center line through plate       center of buoyancy    center of curvature    center of effort center of gravity       center of impact       center of lateral area  center of lateral resistance     center of oscillation    center of percussion   

Page 324: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

압력중심center of symmetry 대칭중심중심면중심펀치중심찾기자center tank 중앙탱크centering 중심내기센터펀치centerline bulkhead 중심선격벽centipoise 센티포이즈Centistocks 센티스톡스central control station 중앙제어장소 central control unit 중앙제어장치

중앙집중식청수냉각시스템집중난방중심선종단면

central locking device 중앙식잠금장치집중주유central operating console 중앙작동제어반중앙동력실중앙처리장치원심주조원심압축기원심송풍기원심력원심조속기원심주유기원심청정기원심펌프원심분리기centrifugal spindle torque 원심스핀들토크

원심스핀들토크계수원심응력

centroid 도심ceramic backing 세라믹 백킹도자기타일certain load 특정부하certificate 증서

냉장설비증서선급증서

certificate of inspection만재흘수선증서선박국적증서여객 정원세탄가마모방지매트마모방지덧판마모방지띠

chain 체인체인용 봉강체인블록

center of pressure     

center plane   center punch   center square  

centering punch 

central fresh water cooling systemcentral heating central lateral plane    

central lubrication      

central power station  Central Processing Unit (CPU)centrifugal casting     centrifugal compressor centrifugal fan centrifugal force       centrifugal governor    centrifugal lubricator   centrifugal oil purifier  centrifugal pump       centrifugal separator   

centrifugal spindle torque coefficientcentrifugal stress      

ceramic tile    

certificate for refrigerating installationcertificate of classification

선박검사증서certificate of load line certificate of ship's nationality certified number of passengerscetane number chafing mat    chafing plate   chafing strip   

chain bar steel      chain block    

Page 325: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

체인케이블체인콤프레서체인콤프레서체인구동체인홈바퀴체인구동장치체인호이스트체인훅병렬단속필릿용접쇄선체인로커

chain pipe 체인파이프체인파이프뚜껑체인플레이트체인섀클체인용 강체인스토퍼체인시험기chain tightener wheel 체인조임 휠체인휠chainlet 분필시험chamber 체임버모따기끝chamfering 모따기모따기기계chamfering tool 모따기공구change order (C/O) 주문주사양변경요청전환피스change-over switch 전환스위치전환밸브channel 수로channel 해협해협연락선channel flow 채널유동해협연락선선급부호특성곡선목탄철목탄선철충전장치충방전용배전반Charpy test 샤르피충격시험 chart 해도해도서랍해도실chart table 해도대해도대등charter 용선용선료용선계약용선료체이서chattering 채터링멈춤볼트체크헬름

chain cable    chain compressor      chain controller chain drive     chain drum  chain gearing  chain hoist     chain hook     chain intermittent fillet weld chain line      chain locker   

chain pipe cover       chain plate     chain shackle  chain steel     chain stopper  chain tester    

chain wheel     쇠사슬chalk test      

chamfered edge 

chamfering machine    

change over piece     

change-over valve 

channel boat   

channel steamer       character of classificationcharacteristic curve    charcoal iron   charcoal pig iron charging equipment    charging switchboard   

chart rack     chart room     

chart table light 

charter base   charter party   charterage     chaser 

check bolt     check helm    

Page 326: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

멈춤너트멈춤핀제한링체크밸브바둑무늬판

checking criteria 검토기준checkpoint 점검항목checkpoint review meeting 점검항목검토회의화학분석chemical cleaning 화학세정chemical composition 화학성분

청정제주입밸브화학탈수기화학소화기화학적산소요구량분말소화장치

chemical tanker 화학제품운반선화학측심관화학적발광cherry pickerchief engineer 기관장어로장

통신장주방장냉각주형냉장실뒷댐편냉각주물냉장실냉장실chilling water plant 냉수기

중국선급chine 차인

차인선chip carrier 칩 운반선chipping 치핑평면끌녹털이망치중추가이드중추탑chock 촉촉라이너chockfast 촉패스트

질식캐비테이션수촉라인질식흐름

choking 초킹초킹코일chord 현

check nut      

check pin      check ring     check valve    checkered plate 

chemical analysis      

chemical compound injection valvechemical dehydrator    chemical fire extinguisher      Chemical Oxygen Demand (COD)chemical powder fire extinguishing apparatus   

chemical tube  chemo-luminescence     고소차chief fisherman chief officer     1등 항해사chief radio officer      chief steward  chill mold      chill room      chill strip      chilled casting chilling chamber       chilling room   

China Classification Society (CCS)

chine line      

chipping chisel chipping hammer       chisel barrel   chisel suspension tower 

chock liner 

chocking cavitation number     choke line     choked flow    

choking coil    

Page 327: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

chord length 현길이코드선christening ceremonyChristmas tree 크리스마스트리Christmas tree post 크리스마스트리포스트Christmas tree winch 크리스마스트리윈치

크리스마스트리와이어로프크롬피복크롬강크로노그래프

chronometer 크로노미터척슈트쓰레기구멍회로차단기감속장치의경사각원호형뒷면

circular cylinder 원형실린더원진동수호도법circular mils 전선의 단면적단위

고유원진동수원주피치원형톱원호꼴단면

circular vang 원형당김줄순환윤활순환펌프circulating water 순환수

회류수조circulating water pipe 순환수관

순환수여과기circulation 순환회로circumferential joint 원주이음원주피치원주이음매시스턴중앙부대갑판실클랙밸브clad steelclad steel pipe 클래드강관clamp 클램프clamp plate 클램프 판clamping device 조임장치

클램셸형그래브버킷클래리파이어클라크사이클클라크엔진클라시우스사이클

Class 1 pipe

chord line       명명식

Christmas tree wire rope   chrome plating chrome steel   chronograph   

chuck  chute  chute  circuit breaker circular angle of obliquity      circular back   

circular frequency      circular measure       

circular natural frequency      circular pitch   circular saw   circular section 

circulating lubrication  circulating pump       

Circulating Water Channel (CWC)

circulating water strainer        순환 circulator      

circumferential pitch   circumferential seam   cistern citadel deck house     clack valve     클래드 강

clamshell type grab bucket     clarifier Clark cycle    Clark engine   Clasius cycle   

1급관

Page 328: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Class A firesclass comment itemclass material 선급규격재 class notation 선급부기부호 class renewal survey 선급정기검사선급증서선급부기부호선급부기부호classification rule 선급규칙선급협회

제조후등록검사제조중등록검사선급검사

claw 클로물음클러치물음커플링못뽑이해머도자기타일클리딩clean ballast 클린밸러스트클린밸러스트펌프냉로cleaning ship 청소선클리어호저슬립clear height 클리어하이트clear sector 가시 구간선회스크린clear view window 선회창clearance 틈새틈새조정기틈새각헐거운맞춤절연간격틈새용적클리트클렌치볼트clew 클루클루클링글클루가넷클루라인client request item 선주요구사항클렌치볼트클링커클리노미터clip connection 클립연결클립훅clipper 클리퍼클리퍼형 선수close hauledclose reach 좁은 바람각밀폐식재받이틈없는내장닫힌촉closed circuit 폐쇄회로

폐쇄회로 텔레비전

A급 화재선급지적사항

classification certificate classification character classification notation  

classification society   classification survey after constructionclassification survey during constructionclassification survey    

claw clutch    claw coupling  claw hammer   clay tile cleading 

clean ballast pump     clean reactor   

clear hawser slip       

clear view screen      

clearance adjuster      clearance angle clearance fit   clearance for insulation clearance volume      cleat   clenched bolt  

clew cringle    clew garnet    clew line       

clinched bolt   clinker clinometer     

clip hook      

clipper stem    상행 (역풍범주)

closed ash pit   closed ceiling  closed chock   

Closed Circuit Television (CCTV)

Page 329: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

밀폐사이클closed exhaust 밀폐배기밀폐배기밸브폐쇄형페어리더밀폐급수장치밀폐식보일러실밀폐형계측장치폐쇄연결밀폐식보일러실폐쇄선루밀폐식연료밸브

밀폐형추력베어링맞바람돛달기로근접방어체계중실원형기둥최단접근점

close-up inspection 정밀검사close-up survey 정밀검사폐쇄장치closing arrangement 폐쇄장치 closing device 폐쇄장치closing plate 막음판closure time 폐쇄시간클로브매듭clutch coupling 클러치이음클러치클러치작동시험클러터탄산가스실린더탄산가스실린더탄산가스미터탄산가스기록계석탄파쇄기석탄고석탄보일러석탄운반선석탄슈트석탄소비량석탄파쇄기석탄보일러석탄해머재탄구양탄기석탄호퍼석탄계량기석탄적재문석탄적재구멍석탄슈트콜타르석탄윈치coaling port 재탄문coaming 코밍코밍판coaming stay 코밍스테이코밍보강재

closed cycle   

closed exhaust valve   closed fair-leader      closed feed system    closed fire room       closed gauging closed joint    closed stokehold       closed superstructure  closed type fuel valve closed type thrust bearing     close-hauled   Close-In Weapon System (CIWS)closely spaced pillar   closest point of approach(CPA)

closing appliance       

clove hitch     

clutch  clutching test  clutter CO2 bottle     CO2 cylinder   CO2 meter     CO2 recorder   coal beater    coal bunker    coal burning boiler     coal carrier    coal chute     coal consumption       coal crusher   coal firing boiler       coal hammer   coal hatchway  coal hoist      coal hopper    coal measure  coal port       coal scuttle    coal shoot     coal tar coal winch     

coaming plate  

coaming stiffener      

Page 330: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

coarse mesh 성긴요소분할coarse mesh 성긴그물망보통나사연안방위함연안경비대연안무선국coast station 해안국 coastal area 연해구역coastal discharges 연안유출수연안경비정연안항법연안항로선연해구역연해구역항행연해항해선피복아크용접봉coated fabric 피복 직물coating 도장coating 피복제도장성능기준코팅스테이션동축케이블동축운전콕위치다각형코킹다운코킹업선미좌석코코아매트부호호출법신호기신호부호

미국연방규격선각부재기호부여체계압축성계수팽창계수비척계수

coefficient of friction 마찰계수열대류계수열전달계수동점성계수투영측면적계수열통과율동작계수피토계수변동계수점성계수

coercivity 보자력

coarse pitch thread    coast defense ship     coast guard    coast radio station     

coastal motorboat      coastal navigation      coaster coasting area  coasting service        coasting vessel coated electrode       

coating performance standardcoating station co-axial cable co-axial drive  cock   cocked hat     cocking down  cocking-up     cockpit cocoa mat     code calling system    code flag      code letters    Code of Federal Regulations (CFR)coding system of hull structure piececoefficient of compressibility   coefficient of expansion coefficient of fineness  

coefficient of heat convection  coefficient of heat transfer     coefficient of kinematic viscosity       coefficient of lateral area      coefficient of overall heat transmission coefficient of performance     coefficient of pitot tube Coefficient Of Variation (COV)coefficient of viscosity 

Page 331: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

코퍼댐코그휠응집coil 코일코일보일러코일스프링코일냉각기coincidence frequency 일치주파수동일루프배열야자매트야자밧줄야자깔개코크스선철코크스용석탄냉풍식cold bending 냉간굽힘냉간굽힘시험cold condition 저온상태cold crack 저온균열상간인발관상온기름거르개cold forming 냉간가공cold galvanizing 도금손상부 아연도포

냉로cold rolling 냉간압연cold running test 저온시동시험냉간취성

시동용급수펌프

시동용분연펌프시동용연료유가열기

cold starting test 상온시동시험 cold storage 냉장냉장선냉장고냉간가공collapse 붕괴붕괴압력접는보트collar 칼라칼라베어링칼라판칼라스러스트베어링집합호퍼집합관집전고리collier 석탄운반선collisioncollision avoidance 충돌방지

레이더충돌예방장치

cofferdam      cogwheel      cohesion       

coil boiler      coil spring     coiled pipe cooler      

coincident loop configuration coir mat       coir rope      coir runner    coke pig iron  coking coal    cold air blast system   

cold bending test      

cold drawn pipe cold filter      

cold reactor    

cold shortness 

cold start feed water pump 

cold start fuel oil burning pump 

cold start fuel oil heater       

cold storage boat      cold store      cold working   

collapse pressure      collapsible boat 

collar bearing  collar plate    collar thrust bearing   collecting hopper       collecting pipe collector ring  

충돌collision avoidance radar system      

Page 332: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선수격벽방수매트콜로이드연료color scheme

column 지주지주안정형 시추선전투정보실

combination carrier 겸용선혼합기관혼합식추진방식복합식터빈합성날개화합탄소

종합효율combined equivalent stress 조합등가응력복합급수가열기혼합늑골식구조

복합충동터빈조합응력혼합늑골식구조복합식터빈가연성가스연소손실가연성재료

combustion 연소

combustion chamber 연소실압력연소실천장판연소노킹연소압력연소율탄산가스기록계연소행정연소기

commanding officer room 함장실commissary equipmentcommissioning engineering 시운전common battery telephone 공전식전화기

collision bulkhead      collision mat   colloidal fuel   

배색column stabilized drilling unit  Combat Information Center (CIC)

combination machinery combination propulsion system combination turbine    combined blade combined carbon       Combined Diesel And Diesel (CODAD) 복합추진체계-CODADCombined Diesel Or Gas turbine (CODOG) 복합추진체계-CODOGcombined efficiency    

combined feed water heater combined framing system      Combined Gas turbine And Gas turbine (COGAG) 복합추진체계-COGAGCombined Gas turbine Or Gas turbine (COGOG) 복합추진체계-COGOGcombined impulse turbine      combined stress combined system       combined turbine       combustible gas combustible loss combustible material   

combustion chamber crown plate     combustion knock      combustion pressure   combustion rate combustion recorder   combustion stroke      combustor     

조리설비

Page 333: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

보통링크 공통구조규칙communal aerial system 방송 공시청장치

수신공중선공용장치communication 통신통신관

유럽조선공업협회정류극정류

commutator 정류자commutator motor 정류자전동기companion

승강구사다리승강구실

company-wide program 전사적프로그램콤퍼레이터compartment 구획compartmentation 구획화compass 컴퍼스자차수정compass bearing device 나침반 방위 장치나침반볼나침반선교나침반카드나침반자차보정나침반침로나침반갑판나침반자차 나침반오차나침반스크린compatibility condition 적합조건

표준화물선환산톤수보정형전리상자

compensating device

자기나침반보정장치compensation for opening 보강링보정탱크compensator 보상기complement 승무원 정원완전연소전사이클complete depletion 완전소모

완전용입이음전통선루선완성검사

component 부품소조립 공장

common link   Common Structural Rules (CSR)

communal aerial system for receiver  

communication tube    Community of European Shipyards' Associations (CESA)commutating pole      commutation   

승강구실companion ladder      

companionway 

comparator     

compass adjustment    

compass bowl  compass bridge compass card  compass compensation compass course compass deck  compass deviation      compass error compass screen 

Compensated Gross Tonnage (CGT)compensating chamber  보정장치compensating device of magnetic compass      개구부보강compensation ring      compensation tank     

complete combustion   complete cycle 

Complete Joint Penetration (CJP)complete superstructure vessel   complete survey       

Component Assembly Shop (CAS)

Page 334: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

합성보콤퍼짓보일러복합형플랜지composite grid system 중첩격자계혼용이음composite material 복합소재composite sailing 연성항법목철선복장갑복권직류발전기

복권발전기연성충격터빈복권전동기

compound pressure gauge 복합압력계연성반동터빈복합터빈

compressed air 압축공기압축공기관압축코르크압축하중가압천연가스운반선압축행정압축성압축봉압축실린더압축효율압축착화기관압축재압축비압축냉동기

compression temperature 압축온도압축시험압축변형률압축강도압축응력압축기compulsory item 의무선박국청취의무

계산유체역학컴퓨터이용설계시스템컴퓨터이용생산시스템컴퓨터이용공정계획컴퓨터이용생산관리시스템

composite beam composite boiler       composite flange       

composite joint 

composite vessel       compound armor       compound dynamo     compound engine       2단팽창기관compound generator   compound impulse turbine      compound motor       

compound reaction turbine     compound turbine      

compressed air pipe   compressed cork       compressed load       Compressed Natural Gas (CNG) Carriercompressed stroke     compressibility compression bar       compression cylinder   compression efficiency compression ignition engine    compression member   compression ratio      compression refrigeration machine

compression test       compressive strain     compressive strength  compressive stress     compressor     필수항목compulsory ship station compulsory watch      Computational Fluid Dynamics (CFD)Computer Aided Design system(CAD)Computer Aided Manufacturing(CAM)Computer Aided Process Planning(CAPP) computer aided production management system(CAPM)

Page 335: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

컴퓨터통합제조시스템컴퓨터시뮬레이션컴퓨터수치제어컴퓨팅로거오목필릿용접집중하중

concentric reducer 동심리듀서동심성concept designconcept design approval 개념설계승인콘크리트선

동시공학보열동시조달부품

condensate pump 복수펌프복수관복수condenser 복수기복수기도출밸브condenser tube 복수기관복수관페룰condenser vacuum 복수기진공복수관복수장치

상태평가계획상태곡선전도도전부

conductivity 도전성전도율도체도관원추클러치cone coupling 콘 커플링콘게이지원추풀리confined area 좁은 구역conformal mapping 등각사상 거친바다congested area 혼잡 구역원추형부이원추형밸브conjugate gradient method 공액경사도방법접속벤드연락교connecting rod 연접봉연결섀클connection diagramconning position 조종위치conning station 조종위치consequential damage 하송인consolidated service 혼재수송

computer integrated manufacturing system(CIMS) computer simulation    Computerized Numerical Control (CNC)computing logger       concave fillet weld     concentrated load      

concentricity    개념설계concrete ship  Concurrent Engineering(CE) concurrent heating     Concurrent Spare Part (CSP)

condensate water pipe  condensation   

condenser relief valve 

condenser tube ferrule 

condenser water pipe  condensing plant       Condition Assessment Scheme (CAS)condition curve conduction     conductive part 

conductivity    conductor      conduit(tube) cone clutch    

cone gauge    cone pulley    

confused sea   

conical buoy   conical valve   

connecting bend connecting bridge      

connecting shackle      접속도

간접손해consigner      

Page 336: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

consortium agreement 분담이행 협약정전력용접기

constant pitch 일정피치일정피치프로펠러등반동날개연속운전급수방식정치제어정온사이클

constant tension winch 자동장력계선윈치정전압용접기정적사이클콘스탄탄와이어

constitutive equation 구성방정식 constitutive equationconstruction periodconstruction profile 강재배치도

강재배치도consultation room 진찰실소모품창고consumables 소비량contact conditioncontact damage 접촉집개접촉장치접점정압사이클contact ratiocontact stress 접촉응력 접촉기

컨테이너고박장치컨테이너냉동기냉각청수펌프컨테이너냉동기냉각해수펌프컨테이너선격납용기

containment vessel 격납용기contingency plan 우발계획

연속필릿용접continuous flange 연속플랜지

연속단조흐름선체계속검사일체라이너기관계속검사연속부재연속청정연속정격부하

constant energy welding machine

constant pitch propeller constant reaction blade constant running water service systemconstant set point control      constant temperature cycle     

constant voltage welding machineconstant volume cycle constantan wire 

응력-변형률 관계식 건조기간construction profile and deck plan

consumable stores      소모품consumption    접촉상태접촉손상contact jaw    contact maker  contact point   contact pressure cycle  접촉률contactor      container lashing equipment    container refrigerator cooling fresh water pump container refrigerator cooling sea water pump    container ship  containment shell    

Continuous Fillet Weld (C.F.W.)

Continuous Grain F+A2676low (CGF)Continuous Hull Survey (CHS)continuous liner Continuous Machinery Survey (CMS)continuous member    continuous purifying    continuous rating       

Page 337: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

continuous survey

선박이력기록부 지속전파연속용접연속선원구역등고선윤곽역류콘트라타비대칭선미

contract design

해상운송계약contract reviewcontract work change 계약사양변경축척현도contraction 수축contraction coefficientcontraction nozzle 수축부단면수축

단면수축률contraction scale

상반회전프로펠러control 제어제어용공기압축기제어공기제습장치제어용공기관제어용공기탱크제어반control chart 제어반제어기기control drilling 관리용구멍control effectiveness 제어효율성control handle 제어손잡이제어용유압관제어반운전대control rod 제어봉

제어봉구동장치제어봉장치

control room 제어실control span 제어장소control surface 제어판제어판각제어판면적

방폭등용제어스위치제어계통제어테이블제어성

계속검사Continuous Synopsis Record (CSR)continuous wave continuous welding continuously manned spaces    contour line     contour contra flow     contra rudder  contra type stern       계약설계Contract Of Affreightment (COA) 계약검토contracted mould       

수축계수contraction of area     contraction ratio of area        축척Contra-Rotating Propeller (CRP)

control air compressor control air dehydrator  control air pipe control air reservoir   control board   관리도표control console control device  

control oil pipe control panel   control platform 

control rod driving system     control rod system     

관리범위control station 

control surface angle   control surface area       control switch for explosion-proof lightcontrol system control table   controllability  

Page 338: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

가변피치프로펠러controlled rolled steel 제어압연강controlled system 제어대상

정위제어대상무정위제어대상제어량제어기조종장치

convection 대류대류가열기대류방열기convenient flag ship 수렴노즐conversion 개조conversion project 개장순양함converter 변환기볼록필릿용접컨베이어호송함coolant 냉각제냉각액펌프냉각액냉각제방사능냉각식터빈cooler 냉각기냉각공기재킷냉각면냉각식날개냉각코일cooling down 냉각냉각효과cooling fresh water

냉각용청수냉각기냉각용청수팽창탱크냉각용청수유수분리탱크냉각청수관냉각청수펌프냉각용청수저장탱크냉각관냉각속도냉각해수관냉각해수펌프냉각면냉각시험

cooling tower 냉각탑cooling water 냉각수cooling water jacket 냉각수재킷cooling water pump 냉각수펌프

Controllable Pitch Propeller (CPP)

controlled system with self regulation  controlled system without self regulation       controlled variable     controller      controlling gear 

convection heater      convector       편의치적선convergent nozzle      

개조공사converted cruiser      

convex fillet weld      conveyor       convoy 

coolant pump  coolant quenching liquid coolants radioactivity   cooled turbine 

cooling air jacket      cooling area   cooling blade  cooling coil    

cooling effect   냉각용청수cooling fresh water cooler     cooling fresh water expansion tank    cooling fresh water oil separating tankcooling fresh water pipe       cooling fresh water pump      cooling fresh water storage tankcooling pipe    cooling rate    cooling sea water pipe cooling sea water pump cooling surface cooling test    

Page 339: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소도구창고음료품창고좌표축동합금동손copper nickel 백동copper nickel pipe 백동관복사기산호채취어선밧줄core 심재유심용접봉core material 심재 재질주상채니기심모래심선코어링Coriolis force 코리올리력코르크판코르크벽돌코르크카펫코르크가루코르크방현재코르크매트코르크페인트모서리덧댐판corner fitting 코너피팅corner joint 모서리이음모서리이음용접코너반사기수정유량보정곡선correction factor 보정계수

전류정격보정계수시정조치요구

corrective maintenance 개량보전보정용자석상관수정계수correlation factor 상관계수대응속력corridor 통로통로격벽corrosion 부식corrosion addition 부식추가corrosion allowance 부식여유부식조절부식균열부식피로corrosion inhibitor 부식억제제부식여유corrosion potential 부식전위corrosion protection 방식corrosion rate 부식율

방수보호피복

cooperage store cooper's store co-ordinate    copper alloy   copper loss    

copying machine       coral boat      cordage 

core electrode 

core sampler   core sand      core wire      coring 

cork board     cork brick     cork carpet    cork dust      cork fender    cork mat       cork paint      corner doubling 

corner joint welding    corner reflector corrected mass flow   correction curve       

correction factor for current ratingCorrective Action Request (CAR)

corrector magnet       correlation coefficient  

corresponding speed   

corridor bulkhead      

corrosion control       corrosion cracking     corrosion fatigue       

corrosion margin       

corrosion resistance protected cover   

Page 340: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

내식성합금강부식시험부식쇠모허용치부식 및 방식파형격벽

corrugated furnace 파형로통주름창구덮개주름관모음주름외판주름외판선corrugation 파형Corvette (CC) 초계함스펙트럼실수부cost accountingcost benefit assessment 비용편익평가 cost controlcost of obsolescence 진부화 손실cost reimbursable contract 실비정산계획cost savings 원가절감cotter 코터조립식받침목면캔버스면봉사counter 선미돌출부카운터보어counter flow 역류역류복수기

역류식열교환기카운터싱킹선미목골재카운터형선미균형추식하역법

counter-balance valve 카운터밸런스밸브countershaft 중계축접시머리리벳

접시머리리벳끝coupling 커플링coupling bolt 커플링볼트축커플링볼트및너트커플링플랜지coupling loss factor 결합손실계수course 침로course keeping 침로유지course keeping ability 시운전항로진로기록기침로안정성평균침로선수상방표시보호유리피복아크용접봉covering 피복

Corrosion Resistant Alloy (CRA)corrosion test  corrosion wastage allowance corrosion and protectioncorrugated bulkhead    

corrugated hatch cover corrugated header      corrugated shell corrugated vessel      

co-spectrum    원가계산원가관리

Cost·Insurance and Freight (CIF) 운임·보험료 포함가격cotter block    cotton canvas  cotton twine   

counter bore   

counter flow condenser counter flow heat exchanger    counter sinking counter timber counter type stern counter weight method 

countersunk head rivet 

countersunk point      

coupling bolt and nut  coupling flange 

침로유지성능course measured       course recorder course stability course steered course-up      cover glass    covered electrode      

Page 341: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

현연재덮판고깔형통풍통정장CPP oil cooler

CPP oil pump 가변피치프로펠러 작동유펌프

crab 이동윈치게가공선게잡이모선crack arrester 균열멈추개crack growth 균열성장crack initiation 균열발생

균열 발생 및 전파crack initiation life 균열발생수명crack propagation 균열전파crack sensitivity 균열감도

균열선단개구변위시험크래들

craft 소형선박crane 기중기기중기부선기중기선기중기조종실crank 크랭크크랭크각crank arm 크랭크암크랭크암개폐량crank case relief valve 크랭크실 도출밸브크랭크실 소기크랭크실크랭크회전모멘트선도크랭크저널크랭크피트크랭크식펌프크랭크식셰이퍼crank throw 크랭크스로중두선crankcase 크랭크실무크랭크펌프crankpin 크랭크핀크랭크핀베어링크랭크핀볼트crankshaft 크랭크축크랭크축베어링crankshaft deflection 크랭크축암개폐량crash ahead 급속전진crash astern 급속후진crash astern test 급속후진시험

covering board covering plate  cowl head ventilator   coxswain        가변피치프로펠러

작동유냉각기CPP oil gravity tank      가변피치프로펠러

작동유중력탱크

CPP oil storage tank     가변피치프로펠러 작동유저장탱크

CPP oil sump tank       가변피치프로펠러 작동유섬프탱크

crab factory ship       crab mother ship       

crack initiation and propagation

Crack Tip Opening Displacement (CTOD) testcradle  

crane barge    crane ship     craneman's house     

crank angle    

crank arm deflection   

crank case scavenging crank chamber crank effort diagram   crank journal   crank pit       crank pump    crank shaper   

crank vessel   

crankless pump 

crankpin bearing      crankpin bolt  

crankshaft bearing     

Page 342: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

crash stopping 급속정지비상역추진crater 크레이터crawler crane 크롤러기중기크롤러주행장치creep 크리프크리프한계크리프율creep speed 크리프속력creepage 크리페이지

연면거리crevice corrosion 틈새부식crew 선원해원명부선원실

선원거주지역크링글

criteria for rework 재작업기준criteria of acceptance 합격판정기준criterion numeral 표준수

용도표준수임계캐비테이션수

critical column buckling 임계기둥좌굴critical damping 임계감쇠

위험회전수임계점임계압력임계레이놀즈수

critical speed 임계속력위험회전수구역critical stress 임계응력critical structural area 주요구조부구역핵심성공요소임계온도

임계비틀림진동임계속도횡보십자비트크로스벙커크로스콤파운드터빈복원력교차곡선도

cross deck 크로스갑판cross flooding 교차침수cross flooding arrangement 교차침수설비

crash-back 

crawler unit    

creep limit     creep rate     

creepage distance for insulation 

crew list       crew space    

crew's quarter 

cringle 

criterion numeral of service    critical cavitation number      

critical number of revolution   critical point   critical pressure       critical Reynolds number       

critical speed range    

Critical Success Factor (CSF)critical temperature    critical torsional vibration      critical velocity cross beam    cross bitt      cross bunker   cross compound turbine cross curves of stability       

Page 343: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

직교흐름형열교환기십자표횡단소기

cross sea 역파횡단면크로스튜브보일러해협연락선crosscut 홈파기끌가로켜기톱crosshead 크로스헤드crosshead engine 크로스헤드형기관크로스헤드가이드

크로스헤드윤활유펌프크로스헤드핀크로스헤드슈횡단선크로스잭

crossover way 크로스타이크로스트리스쇠지레crown 정부망대도가니로도가니강cruciform bollard 십자형 볼라드cruciform connection 십자형 이음부cruciform joint 십자형 이음부crude oil 원유

원유운반선crude oil tanker 원유운반선Crude Oil Washing (COW) 원유세정cruise ship 크루즈선cruiser 순양함cruiser stern 순양함형선미순항권순항거리cruising range 순항속력순항터빈cruising yacht 순항요트crusher 분쇄기압괴강도압괴응력압괴시험cryogenic temperature 극저온CS1 type membranecubic assembly 입체조립재화용적cubical cavitycumulative damage ratio 누적손상도

누적확률밀도함수

cross flow heat exchanger     cross mark     cross scavenging       

cross section  cross tube boiler       cross-channel vessel   cross-compound engine  병렬2단팽창기관교차 crosscut chisel crosscut saw   

crosshead guide crosshead lubricating oil pump crosshead pin  crosshead shoe crossing vessel crossjack       교차통로crosstie crosstrees     crowbar 

crow's nest   crucible furnace crucible steel  

crude oil carrier       

cruising circle  cruising distance        순항거리cruising speed cruising turbine 

crushing strength      crushing stress crushing test   

CS1형식 멤브레인cubic capacity  

3차원 캐비티Cumulative Probability Density Function (CPDF)

Page 344: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

cupboard 식기선반 전류용량유속계정류판

current power generation 조류발전조류항법변류기도전부커튼판curvature 곡률curvature increment 곡률증분curve fairing 곡교정작업curve forming 곡가공

부심곡선감멸곡선도가침장곡선메타센터곡선

curved face plate 굽은 면재곡선운동cushion air 부양공기cushion area (Ac) 부양면적cushion chamber 부양실cushion pressure 부양압력완충밸브custom boat 세관감시선관세cutoff 차단차단밸브cutout 차단차단장치cutter 커터커터모터

커터실링장치커터축

cutter suction dredger 커터흡입준설선cutting dragline 절단선 cutting drawing 절단변절단염cutting tip 절단팁절단토치꺾어올림클리퍼형선수물가르게cycle 행정cycle 사이클주기적변동률cyclic load 주기적 하중연직축프로펠러cylinder 실린더실린더배럴실린더블록cylinder bore 실린더안지름실린더안지름게이지

current carrying capacity       current meter  current plate   

current sailing current transformer    current-carrying part  curtain plate     

curve of center of buoyancy   curve of extinction     curve of floodable length       curve of metacenter   

curvilinear motion      

cushion valve  

customs duty  

cutoff valve    

cutout gear    

cutter motor   cutter sealing equipment       cutter shaft    

절단도면cutting edge   cutting flame   

cutting torch   cut-up cutwater stem  cutwater       

cyclic irregularity      

cycloidal propeller     

cylinder barrel cylinder block  

cylinder bore gauge    

Page 345: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

실린더바닥실린더컬럼실린더상수실린더커버실린더컷오프시험실린더가스실린더커버실린더재킷냉각수펌프실린더보온피복실린더라이너실린더윤활펌프

cylinder oil 실린더유실린더유계량탱크실린더유서비스펌프실린더유저장탱크실린더유이송펌프

cylinder shaft 실린더축cylinder volume 실린더용적cylinder wall 실린더벽원통형보일러cylindrical stiffeners 원통형보강재D type end shackleDacron 데크론데일리서비스탱크Damage Control Book (DCB) 보수서손상도면damage repair 손상부위 수리damage stability 손상복원성손상복원성 규정damage survey 손상검사damage survey report 손상검사보고서damaged condition 손상상태damp space 습한장소감쇠진동감쇠파damper 댐퍼댐퍼도어댐퍼장치damping 감쇠감쇠계수감쇠율감쇠모멘트위험각위험통보위험화물dangerous chemical 위험화학품위험화물dangerous space 위험장소dangerous zone 위험구역저인망어선다뉴브규칙암실

cylinder bottom cylinder column cylinder constant       cylinder cover cylinder cut off test    cylinder gas   cylinder head  cylinder jacket water pump    cylinder lagging cylinder liner  cylinder lubricating pump       

cylinder oil measuring tank    cylinder oil service pump      cylinder oil storage tank       cylinder oil transfer pump      

cylindrical boiler       

디(D)형 엔드 섀클daily service tank   

damage plan   

damage stability regulation

damped oscillation     damped wave  

damper door   damper gear   

damping coefficient    damping factor damping moment       danger angle   danger message dangerous cargo       

dangerous goods       

Danish trawler Danube rule    dark room     

Page 346: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

암적열물막이판대시폿data base 데이터베이스

데이터베이스관리시스템data book 데이터북자료흐름도데이터로거자료모형자료처리진수일자datum linedavit 대빗대빗소켓대빗스팬day shift 주간근무고휘도표시daylight signaling lamp 주간신호등주간신호등

일광신호거울속임채색법직류아크용접

DC reversed polarityDC straight polarity 정온데드아이데드플랫추측항법dead ship 데드쉽데드쉽상태최저속무효공간dead stockdead-end corridor 막다른복도데드후론트형배전반deadlight 안덮개선저기울기중량화물중력식압력계시험기중사시험중력식안전밸브재화중량척도재화중량톤수재화중량데드우드탈기급수가열기탈기deaerator 공기분리기deballasting capability 밸러스트 배출용량청소선붕괴열제거계데카방식감속영역dechlorinating 데시벨deck 갑판

dark-red heat  dash plate     dash pot       

Data Base Management System(DBMS)

data flow diagram      data logger    data model     data processing date of launch  기준선davit socket    davit span     

daylight display 

daylight signaling light daylight signaling mirror       dazzle system  DC arc welding  역극성정극성dead calm      dead eye      dead flat       dead reckoning 

dead ship condition    dead slow      dead space     사장재고dead-front type switchboard

deadrise       deadweight cargo     deadweight gauge tester      deadweight measurement deadweight safety valve      deadweight scale       deadweight tonnage    deadweight(DWT) deadwood      deaerating feed water heaterdeaeration     

debris collecting vessel decay heat system     Decca system  deceleration zone       탈염소decibel (dB)

Page 347: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

deck barge 데크부선갑판보갑판의자deck block 갑판블록갑판볼트갑판버킷갑판화물갑판중심선갑판콤퍼지션deck covering 갑판피복갑판피복도갑판기중기선상감압실갑판부목갑판막음판갑판끝롤러갑판상구조물갑판배기관deck fittings 갑판플랜지deck foam system 갑판포말장치갑판거더deck head 상부갑판갑판높이갑판훅갑판속구목록갑판사다리갑판채광유리갑판선deck load 갑판하중항해일지deck longitudinal 갑판기계항해사deck opening 갑판여객갑판기둥갑판상배관deck plan 갑판구조도목갑판대패갑판채광프리즘갑판장갑갑판펌프갑판하종통재갑판배수구갑판의자갑판피복갑판현측선갑판기둥갑판증기관갑판스토퍼deck store 갑판창고갑판창고지기deck stowage 갑판적재갑판스트링거deck strip 갑판스트립갑판탱크갑판트랜스버스

deck beam     deck bench    

deck bolt      deck bucket    deck cargo     deck center line       deck composition      

deck covering plan     deck crane     deck decompression chamber  deck department       deck end plate deck end roller deck erection  deck exhaust pipe      갑판의장품deck flange    

deck girder    

deck height    deck hook     deck inventory deck ladder    deck light      deck line       

deck logbook   갑판종통재deck machinery deck officer     갑판개구부deck passenger deck pillar     deck piping    

deck planer    deck prism light       deck protection deck pump     deck runner    deck scupper  deck seat      deck sheathing deck side line  deck stanchion deck steam pipe       deck stopper   

deck store keeper     

deck stringer  

deck tank      deck transverse 

Page 348: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

갑판청소관갑판청소펌프deck watch 갑판시계deck water seal 갑판가스역류방지장치갑판침수유갑판정deckhouse 갑판실

갑판수밀기기declaration of security 보안선언서decompression chamber 감압챔버decontamination 오염제거decontamination room 제독실

체감피치프로펠러Decree of MOMAF 해양수산부령deddendum 디덴덤이뿌리원전용배전반

전용해수밸러스트탱크흘수제한표시등심층혼합처리부선양면개선깊은용입용접

deep penetration weld 깊은 용입용접deep sea 심해 심해측심추심해측심기

잠수함구난정심해잠수정

deep tank 디프탱크디프탱크격벽잠수펌프최대구획만재흘수선deep-well pump 탱크내부설치 펌프디폴트지정deflection 처짐처짐각개폐량계측기deflection plate 처짐계편침의deformation 변형

창구변형연료빼내기

degaussing 소자degaussing room 소자장비실소자장치degradation 열화degreasingdegree of fixation 고정도자유도

외피의보호등급

deck wash pipe deck wash pump       

deck wetness  decked boat    

deck-watertight apparatus      

decreasing pitch propeller      

deddendum circle      dedicated distribution boarddedicated seawater ballast tankdeep draft vessel light      deep mixing barge     deep penetration double bevel weld

deep sea lead  deep sounding machine Deep Submarine Rescue Vehicle (DSRV)Deep Submergence Vehicle (DSV)

deep tank bulkhead    deep well pump deepest subdivision load line

default setting 

deflection angle deflection gauge        반사판deflectometer  deflector       

deformation of cargo hatch     defueling       

degaussing system     

탈지degree of freedom     degree of protection of enclosures

Page 349: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

반동도탈습dehumidifierdeicing 얼음제거deicing analysis 탈빙해석지발중성자Delivered HorsePower (DHP) 전달마력전달출력전달동력delivery 인도송출콕송출수두delivery lead time 납품소요기간송출관송출압력송출밸브상자송출밸브소자수요율광물질제거기순수장치demonstration 시연demurrage 체선료디오일러deoxidation practiceDepartment of Trade (DOT) 영국통산성

미국운수성departure 출항departure 동서거리departure condition 출항상태dependability 의존도감극화deposit metal 용착부deposited metal 용착금속

용착금속부용착률용착속도모함감가상각폭뢰

depth gauge 깊이측정기용입깊이틈새깊이화물창깊이용입깊이디레이팅출력구서면제증서디레이팅

derrick 데릭데릭붐데릭크레인데릭포스트데릭장치

degree of reaction     dehumidification  제습기delayed neutron 

delivered output delivered power 

delivery cock  delivery head  

delivery pipe   delivery pressure      delivery valve box     delivery valve  demagnetization demand factor demineralizer  demineralizing  

de-oiler  탈산방법Department of Transportation (DOT)

depolarization   용착금속deposit zone   

deposited metal zone   

deposition efficiency   deposition rate depot ship     depreciation    depth charge   

depth of fusion depth of gap   depth of hold  depth of penetration     derated output derating exemption certificatederating 

derrick boom  derrick crane  derrick post    derrick rigs    

Page 350: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

데릭슈데릭소켓데릭테이블기복장치de-rustingdesiccantdesign by zone 구획별설계design category 설계범주design changedesign conditiondesign contractor 설계계약업자design criteria

Design Data Sheet (DDS)

design detailsdesign draft 설계흘수Design Fatigue Life (DFL) 설계피로수명design for production 생산고려설계design head 설계수두design life 설계수명design loaddesign load draft 계획만재흘수 design load water line 계획만재흘수선design loading criteria 설계적하기준design modeldesign optimization 설계최적화design requirements 설계요구사항design reviewdesign spiral 설계나선design standard

설계정수중굽힘모멘트design wave 설계파designed load draft 계획만재흘수소멸캐비테이션목표값탁상등destroyer 구축함구축함모함

완열증기관과열완화기노르웨이선급

detachable 착탈가능조립식날개부분선루상세설계상세도상세도detail scheduling 소일정계획세부조립절차서detailed stress assessment 상세응력평가detector 탐지기detergent 계면활성제deterioration 저하detuner 디튜너독일공업규격developed area 전개면적

derrick shoe   derrick socket derrick table   derricking gear  녹제거건조제

설계변경설계조건설계기준설계기준 및 절차서 (미 해군)설계상세

설계하중

설계모형

설계검토설계표준

design still water bending moment

desinent cavitation     desired value  desk light      

destroyer tender       desuperheated steam pipe      desuperheater  Det Norske Veritas (DNV)    

detachable blade       detached superstructure detail design   detail drawing  detail plan     

detailed assembly procedure

Deutche Industrie Norm (DIN)

Page 351: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전개면적비날개전개넓이deviationdeviation 항로이탈항로이탈경보자차곡선

반원자차수정장치자차수정장치데블클로

dew pointde-watering system 배수시스템 탈아연다우대각선판붙임대각선맞댐식판붙임diagonal line 빗댐판diagram 도표선도효율선도계수약도다이얼게이지다이얼스위치다이얼온도계내외지름비다이아몬드매듭다이아몬드판diaphragm 다이어프램다이어프램판

규조토보온재정장석

die 다이형단조다이스톡다이캐스팅dielectric strength 절연내력절연내력시험디젤사이클디젤전기추진

디젤전기추진선디젤전기추진디젤기관디젤기관구동발전기

diesel oil 디젤유디젤유청정기디젤파일해머디젤선디젤요트위도차차동도르래디퍼렌셜드레인트랩

developed area ratio   developed blade area   편차deviation alarm deviation curve device for correcting semicircular deviation    device for correcting deviation  devil's claw   이슬점dezincing       dhow  diagonal built  diagonal carvel built    대각선diagonal tie plate      

diagram efficiency     diagram factor diagrammatic sketch     dial gauge     dial switch     dial thermometer       diameter ratio  diamond knot  diamond plate  

diamond soot blower        다이아몬드 수트블로어 diaphragm plate diatomaceous earth heat insulating material    dicky  

die forging     die stock      die-casting      

dielectric strength test diesel cycle    diesel electric drive    diesel electric motor ship      diesel electric propulsion       diesel engine   diesel generator        

diesel oil purifier      diesel pile hammer     diesel ship     diesel yacht    difference of latitude   differential block       differential drain trap  

Page 352: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

차동기어정밀위성항법방치

differential pressure

차압계차압식유량계차압식액면계확산음장

diffuser 디퓨저확산펌프diffusible hydrogen 확산성수소digital mock-up 디지털 목업

디지털선택호출장치디지털신호이면각차원치수차원해석무차원

diminution 감소량dimmer 광도가감기눈금밝기조정밝기조정dimmer switch 밝기조정스위치딩기딥브레이징딥로프디퍼암디퍼붐디퍼버킷디퍼준설선독립빌지관독립빌지흡입direct calculation 직접계산직류직결구동

직접팽창식직화연관보일러

direct labor cost 직접노무비direct method 직접법

직접수치모사direct printing telegraphy 직접인쇄전신

자기역전디젤기관direct reversing gear 자기역전장치direct strength analysis 직접강도해석direct strength assessment 직접강도평가

직접강도계산direct suction 직접흡수관방향탐지기방향검출장치

differential gear Differential Global Positioning System (DGPS) 차압differential pressure gauge     differential pressure type flow meterdifferential pressure type level gaugediffuse sound field     

diffuser pump  

Digital Selective-Calling (DSC)systemdigital signal   dihedral angle  dimension      dimension      dimensional analysis   dimensionless  

dimmer for scale       dimmer illumination    

dinghy dip brazing     dip rope       dipper arm     dipper boom   dipper bucket  dipper dredger direct bilge pipe       direct bilge suction    

Direct Current(DC) direct drive    direct expansion system       direct fire tube boiler  

Direct Numerical Simulation (DNS)

direct reversible diesel engine 

direct strength calculation      

direction finder direction finding system 

Page 353: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

direction indicating light 방향지시등방향지시기directional control valve 방향제어밸브directional error 방위오차방향불안정성directional spectrum waves 방향스펙트럼 파침로안정성가름밸브비행기구disassembledisassemble tool 분해공구disc 디스크

면적비원판면적원판클러치원판크랭크디스크커터원판로터디스크밸브discharge 방전discharge 배출구discharge flap 배출플랩discharge period 방전기간배출관배출밸브원판윤활식베어링disconnection 불연속

이산푸리에변환discrete variable 이산화 변수선택차단접시형경판접시형끝판붕괴disk 날개차날개차dismantling dispensary 진찰실진료등배수용적배수중량displacement 배수량displacement 변위배수량계수용적식압축기배수량곡선

배수량길이비displacement method 변위법배수량눈금displacement ship 배수량형 선박배수톤수display 표시display unitdisposal of garbage 폐기물처리dissimilar metals 이종금속

direction indicator      

directional instability   

directional stability     director valve  dirigible balloon  분해disc and drum turbine   디스크-드럼터빈disc area ratio disc area      disc clutch     disc crank     disc cutter     disc rotor      disc valve      

discharge pipe discharge valve disc-oiled bearing       분리discontinuity   Discrete Fourier Transform (DFT)

discriminative trip      dished end plate       dished head    disintegration  

disk wheel      해체dispensary light displaced volume       displaced weight       

displacement coefficient displacement compressor displacement curve     displacement length ratio       

displacement scale     

displacement tonnage  

표시장치

Page 354: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용해아세틸렌용존산소계최단접근거리절연거리항정지시기거리눈금

distance piece 디스턴스피스거리분해능distilled water 증류수증류수관증류수탱크증류기증류복수기distilling plant 조수장치

조수장치해수펌프조수장치순환펌프조수장치청정제탱크조수장치증류수펌프조수장치이젝터펌프호출부호선박번호

distortion 일그러짐distortion control method 변형제어법distress 조난distress alarm panel 조난경보제어반 distress alerts 조난경보distress flares 조난화염신호조난통보distress panel 조난신호제어반 조난신호distributed computing 분산 컴퓨팅

분산자료처리distributed loads 분포하중분배관머리분배밸브distribution 분전분전함

잠수부 선발산노즐발산파부등률분류터빈디바이더잠수종잠수챔버수평타잠수작업지원선칸막이벽dock 독독케이슨

dissolved acetylene    dissolved oxygen meter Distance at Closest Point of Approach(DCPA) distance for insulation  distance indicator      distance marker 

distance resolution     

distilled water pipe    distilled water tank    distiller distilling condenser    

distilling plant brine pump    distilling plant circulating pump       distilling plant compound tank  distilling plant distillate pump distilling plant ejector pump  distinctive letter       distinctive number     

distress message       

distress signal 

distributed data processing     

distributing header     distributing valve       

distribution box distribution panel        분전반diver boat     divergent nozzle       diverging wave diversity factor divided flow turbine    dividers diving bell     diving chamber diving rudder  diving support vessel  division wall   

dock caisson  

Page 355: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

갑문독 하우스독 진수독마스터독 문턱독 시험독 사용료docking 입거docking bracket 입거 브래킷docking bridge 선미선교선미선교갑판도킹용골docking plan 입거배치도

입거선박위치검지장치입거검사도킹텔레그래프조선소항해선교내다지

dog 도그멈춤지주풍향기도그워치dogs 조임 핸들dolphin 돌핀돌핀스트라이커돔천창내항선donkey boiler 보조보일러문매트문지방도플러로그도플러소너복동기관쌍좌정양좌밸브double bevel 양면 개선쌍도르래double bottom 이중저double bottom construction 이중저구조

이중저구조도이단침상양면덧판양용캘리퍼스체인용 이륜활차양면연속필릿용접

double continuous weld 양면연속용접새집모양비트이중곡률쌍기통기관double door 이중문

복효증류기양면보일러

double ender system 양두기관시스템

dock gate      dock house    dock launching dock master    dock sill       dock trial      dockage 

docking bridge deck   docking keel   

docking ship position indicator Docking Survey (DS)docking telegraph      dockyard       dodger 

dog shore      dog vane      dog watch     

dolphin striker dome skylight  domestic vessel 

door mat       door sill       Doppler log    Doppler sonar  double acting engine   double banked boat    double beat valve      double berth cabin      2인용선실double block   

double bottom construction profile     double bunk    double butts strap      double calipers double chain sheave   double continuous fillet welding

double cross bitt       double curvature       double cylinder engine 

double effect evaporator       double ended boiler    

Page 356: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이중증발보일러

double fillet weld 양면필릿용접분류터빈복합늑골양면홈 개선 두줄난간이중나선톱니바퀴double hull 이중선각double hull 이중선체이중선체구조복식인젝터이중절연double nut 이중너트

이중관브라인냉각기이중관복수기복판타쌍극

겹판타양좌밸브양면보호임펠러양면흡입날개

double skin construction 이중선측구조양면덧판연결이중나사쌍크랭크축쌍투스위치이언식케이형홈

double-leaf door 쌍립문doubler 이중판double-side skin 이중선측외판더블릿doubling 덧댐이중판dovetail 도브테일도브테일이음도브테일홈도브테일판dowel 다월다월핀다월이음down light 국부조명등하향행정down wash 세류세류각강하관모음강수관

double evaporation boiler      double expansion engine        2단팽창기관double flow turbine    double frame   double groove preparationdouble handrail double helical gear   

double hull structure   double injector double insulation       

double pipe brine cooler       double pipe condenser double plate rudder    double pole    double reduction gear   2단감속장치double riveted joint     2열리벳이음double riveting  2열리벳박기double rudder  double seat valve      double shrouded impeller       double sided impeller  

double strapped joint   double threaded screw double throw crank-shaft      double throw switch   double wire system    double-bevel groove   double-J groove        양면제이(J)홈double-pole switch      2극스위치doublet 

doubling plate  

dovetail joint   dovetail mortise dovetail plate  

dowel pin      doweling       

down stroke   

down wash angle      downcast header       downcast pipe 

Page 357: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

강수관down-hand welding 하향용접다운홀downstreamdowntime 비가동시간다운톤펌프downwash 하향유동downwind 풍하향draft 통풍draft 흘수송풍로흘수계통풍계draft indicating system 흘수지시장치흘수사다리흘수표흘수눈금draft stop 통풍정지판draft survey 흘수검사송풍로제도사drag 항력drag arm 드래그암

드래그암조작반드래그암모양지시기드래그암윈치제동체인항력계수

drag force 항력드래그헤드심도계드래그헤드드래그래더서스펜션로드드래그석션준설선드래깅항양비드레인탱크드레인콕드레인집합탱크드레인냉각기

drain hole 배수구드레인관드레인플러그드레인폿드레인펌프선저플러그드레인분리기드레인소음기드레인탱크드레인트랩배수밸브

downcomer    

downhaul       후속공정downton pump 

draft air duct  draft gauge  draft gauge    

draft ladder draft marks    draft scale     

draft trunk draftsman      

drag arm control panel     drag arm figure indicator       drag arm winch drag chain     drag coefficient 

drag head depth meter 

drag head      

drag ladder    drag link       drag suction hopper dredger   dragging       drag-lift ratio  drain cistern   drain cock     drain collecting tank   drain cooler    

drain pipe      drain plug      drain pot       drain pump     drain screw    drain separator drain silencer  drain tank      drain trap      drain valve     

Page 358: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

drainage 배수장치배수관드로카드장력조절기드로바이스drawing issue schedule 도면출도 일정계획인발관드로워크초대형전함준설조작판준설토사수유량계준설관dredge pump 준설펌프

준설펌프실링장치준설흡입관준설밸브

dredger 준설선준설토량계준설심도계편류각

drift force 표류력유망유망어선drill 훈련drill 시추drill bit 드릴비트시추데릭드릴프레스시추선시추탑부선형 시추선시추날개시추기drilling mud 드릴링머드drilling platforms 드릴링플랫홈drilling rigdrilling tender 시추보급선드릴시험drilling unit 시추장치drinking water fountain

음료수압력탱크음료수압력탱크음료수펌프음료수탱크방적형

drip tray 기름받이피동바퀴두드려맞춤drop 선수침하중추윈치낙하단조낙하해머드롭킬드롭판

drainage pipe  draw card      draw off holdback gear       draw vice      

drawn tube    drawworks     dreadnaught    dredge control panel   dredge flow meter     dredge pipe    

dredge pump sealing equipment dredge suction pipe    dredge valve   

dredging capacity indicator     dredging depth meter  drift angle     

drift net       drifter 

drill derrick    drill press     drill ship    drill tower     drilling barge  drilling blade   drilling machine 

시추선drilling test    

냉식수기drinking water hydrophore tank drinking water pressure tank   drinking water pump   drinking water tank    drip proof type 

driven wheel   driving fit      

drop chisel winch      drop forging   drop hammer   drop keel      drop strake    

Page 359: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

낙하시험분리형웨이트drum 드럼드럼로터드럼스테이지건식공기펌프건연식보일러dry bulk cargo 건산적화물dry cargo 건화물dry cargo ship 건화물선건연식보일러건식연소실건식나침반dry dock 건식 독건식독물넣기dry drop test 건식낙하시험dry film thickness 건도막 두께dry friction 건조마찰

분말소화기건식보일러보존법건조식량고마른썩음

dry space 건구역건증기dry-docking 입거dry-docking plan 입거계획도건조제건조실drying tumbler 세탁물건조기복합공기펌프복합사이클쌍덕트

이중연료디젤기관이중연료기관

duck 범포범포범포덮개듀콜강duct 덕트duct keel 상자형 용골덕트손실duct propeller 덕트프로펠러연강ductility 연성ductility testdue date 만기일due date priority rule 납기우선순위규칙암적열덤카드dumbwaiter 소화물용승강기가짜굴둑더미링가짜굴둑덤프시험

drop test       droppable weight       

drum rotor     drum stage    dry air pump   dry back boiler 

dry combustion chamber boilerdry combustion chamber       dry compass   

dry dock flood 

dry powder fire extinguisher   dry process    dry provision store    dry rot 

dry steam      

dryer  drying room    

dual air pump  dual cycle     dual duct      Dual Fuel Diesel Engine (DFDE)dual fuel engine dual tandem articulated type reduction gear       

듀얼탠덤아티큘레이티드형감속장치

duck canvas   duck cover     Ducol steel    

duct loss       

ductile steel 

연성시험dull-red heat   dumb card     

dummy funnel  dummy ring    dummy stack   dump test      

Page 360: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

dumping condenser 과잉증기복수기dunnage 화물깔개화물깔개판자화물깔개매트화물깔개판자복식여과기복식인젝터복식노즐복식펌프복식여과기이중급전duplicated equipment 이중장비durability 내구성듀랄루민듀로스코프먼지막이격벽

집진기미분탄집진기코르크가루먼지막이먼지막이

dye penetrant inspection 염색침투탐상시험dye penetrant test 액체침투탐상시험dynamic balance test 동적평형시험dynamic balancing 동적평형동적특성운동특성보정모델링

충격설계해석법동하중 조합 계수자동위치유지장치

dynamic pressure 동적압력동복원력동적응력dynamic tank pressure 동적탱크압력동적시험dynamic vibration absorber 동흡진기dynamic wave pressure 동적파랑압력

동적지지정

dynamo 발전기발전용기관동력계이벤드이어링

dunnage board dunnage mat   dunnage wood duplex filter   duplex injector duplex nozzle  duplex pump   duplex strainer duplicate supply 

duralumin      duroscope      dust bulkhead  

dust catcher   

dust coal       dust collector  dust cork      dust proof     dust tight      

dynamic characteristics dynamic compensation modelingDynamic Design Analysis Method (DDAM)Dynamic Load Combination Factor (DLCF)Dynamic Positioning System (DPS)

dynamic stability       dynamic stress 

dynamic test   

dynamically supported craft    

dynamo engine dynamometer   E bend earing  

Page 361: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

earning capacity 수입능력earth 접지누전검출기earth fault 누전검출등접지선

접지식배전방식밸브개폐장치썰물에보나이트편심하중

eccentric reducer 편심리듀서편심봉편심슬리브편심륜eccentricity 편심편심률echo 에코에코박스echo sounder 음향측심기음향측심수신기

음향측심송신기음향측심송신기

echo sounding 음향측심echo sounding device 음향측심기레이더단면적economic order quantity 경제적주문량economical speed 경제속력economizer 이코너마이저eddy 와류eddy current 와전류Eddy current Test (ET) 와류탐상법와류저항와류방지판edge 가장자리edge factor 변 계수edge function 경계함수곧은결널판edge joint 변두리이음변두리이음용접가장자리대패edge preparation 개선edge stiffening 자유변 보강edge stress ratio 변 응력비가장자리덧판edge welding 가장자리용접배기관eductor 이덕터에드워드펌프유효전진각

유효받음각effective bending span 유효굽힘스팬effective breadth 유효폭유효통달거리

earth detector  전기누전earth lamp     earth wire     earthed distribution system     easing gear    ebb (tide) ebonite eccentric load  

eccentric rod  eccentric sleeve       eccentric wheel 

eccentricity ratio       

echo box      

echo sounder receiver echo sounder transducer       echo sounder transmitter       

echoing area  

eddy making resistance eddy plate     

edge grain     

edge joint welding     edge planer    

edge strip      

eduction pipe  

Edwards pump effective advance angle effective angle of attack       

effective communication 

Page 362: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

유효갑판유효효율유효마력유효용접길이effective pitch 유효피치유효피치비유효동력유효압력effective sectional area 유효단면적유효행정effective superstructure 유효선루

유효열효율유효목두께

effective wake 유효반류유효반류계수유효파경사effective width 유효폭

열교환율efficiency 효율efficiency curve 효율곡선유출각ejector 이젝터이젝터복수기이젝터펌프선수미갑판끝받침대탄성후기효과탄성좌굴탄성커플링탄성컵형와셔탄성변형탄성한도탄성계수탄성변형에너지탄성안정성탄성변형에너지탄성변형률탄성응력elastic support 탄성지지탄성진동elasticity 탄성elasto-plastic domain 탄소성영역elbow 엘보

전기식도킹텔레그래프electric apparatus 전기설비electric arc welding 아크용접electric bonding 전기접지전기브레이징electric cable pipe 전선관전기전도율전기도체전류

전기식도킹텔레그래프전기식흘수계

effective deck  effective efficiency     Effective Horse Power (EHP) effective length of weld 

effective pitch ratio    effective power effective pressure      

effective stroke 

effective thermal efficiency    effective throat thickness      

effective wake fraction effective wave slope   

effectiveness of regenerator   

efflux angle    

ejector condenser      ejector pump   ekeing elastic after-effect     elastic buckling  elastic coupling elastic cup washer     elastic deformation     elastic limit    elastic modulus elastic resilience       elastic stability elastic strain energy   elastic strain   elastic stress  

elastic vibration 

electric anchor and lookout telegraph

electric brazing 

electric conductivity    electric conductor       electric current electric docking telegraph      electric draft gauge    

Page 363: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전기식비상용엔진텔레그래프electric engine telegraph 전기식엔진텔레그래프

전기식엔진텔레그래프로거전기식엔진텔레그래프리피터전기로전기식징전기혼전기점화기관

electric load analysis 전기부하분석전기로그electric motor 전동기

전기식프로펠러축회전계electric propulsion 전기추진전기추진선전기방식법전기방열기

전기저항용접저항선스트레인게이지전기식타각지시기전기안전등

electric shock 전기충격전기식매연지시기전기로강전동조타기전동조타장치전기식조타텔레그래프전기창고전기식온도조절기전기용접기전기용접전동윈치전동양묘기

electrical hazard 전기적위해요소electrical Installation 전기설비electrical starting system 전기식시동장치electrical supply system 급전장치electrical workelectrically continuous 전기적 연속Electro Gas Welding (EGW) 일렉트로가스용접electro photo marking 전자사진마킹electrode 용접봉electrode 전극

용접봉 집게전극팁

electro-hydraulic 전동유압전동유압조타장치

electric emergency engine telegraph

electric engine telegraph logger electric engine telegraph repeaterelectric furnace electric gong   electric horn   electric ignition engine 

electric log    

electric propeller shaft revolution indicator     

electric propulsion ship electric protection      electric radiator electric resistance welding     electric resistance wire strain gaugeelectric rudder angle indicator electric safety lamp    

electric smoke indicator electric steel   electric steering engine electric steering gear  electric steering telegraph     electric store  electric thermostat     electric welder electric welding electric winch  electric windlass       

전장공사

electrode holder       

electrode tip   

electro-hydraulic steering gear 

Page 364: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

electro-hydraulic system 전동유압장치전기분해전해질전기부식전해효과전자석전자기식제동기전자파 적합성전자기식커플링

electromagnetic fields 전자장전자기유량계전자파간섭현상

electromagnetic log 전자식선속측정장치전자파펄스electromagnetic valve 전자밸브전자빔용접

전자식움직눈금전자부저전자해도

electronic chart system 간이전자해도시스템전자식움직눈금전파항법electronic plotting aids 전자표시장치전자식 트레이서

전파식액면계electroplating 전기도금전기도금조electro-print marking 전기식사진마킹electrostatic charge 정전기electrostatic hazard 정전기적위해요소요소판패널elevated passageway 고가통로elevation 타원법칙타원형날개타원형선미elongation 연신율

승정장치승정갑판승정용사다리승정등

embarkation lightembarkation station 승정장소압출프레스취화특성노출쐐기비상용공기압축기

비상용공기탱크비상용빌지관

electrolysis    electrolyte     electrolytic corrosion   electrolytic effects     electromagnet  electromagnetic brake  ElectroMagnetic Compatibility (EMC)electromagnetic coupling       

electromagnetic flow meter    ElectroMagnetic Interference (EMI)

ElectroMagnetic Pulse (EMP)

electron beam welding electronic bearing maker       electronic buzzer       Electronic Chart Display and Information System (ECDIS)

electronic cursor       electronic navigation   

electronic tracer       electronic wave type level gauge      

electroplating bath     

Elementary Plate Panel (EPP)

측면도ellipse law     elliptical blade elliptical stern 

embarkation arrangement       embarkation deck      embarkation ladder     embarkation lamp       승정등embossing press       embrittlement characteristicemerged wedge emergency air compressor     emergency air reservoir        emergency bilge pipe  

Page 365: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

비상빌지펌프비상용빌지흡입밸브비상단정

emergency condition 비상상태비상배전회로

emergency door

비상조명장치비상전원비상전기설비

emergency electrical load 비상부하emergency engine telegraph 비상엔진텔레그라프emergency escape system 비상탈출장치emergency escape trunk 비상탈출용 트렁크emergency exit 비상탈출구비상급전선emergency fire pump 비상소화펌프emergency generator 비상발전기

비상발전기용디젤기관비상발전기용연료유탱크

emergency generator room 비상발전기실emergency generator space 비상발전기구역emergency governor 비상용조속기emergency light 비상등emergency message 긴급전달사항emergency mooring 비상계류경계윈치경계와이어로프emergency operation 비상작동

비상조난위치발신기emergency power supply 비상전원공급장치비상식량비상차단시험

비상차단밸브용공기탱크비상정지시험

emergency stopping device 비상정지장치비상배전반비상스위치비상예인장치비상밸브비상급수시스템이민선이미터empty hold 공창유화작용emulsify 유화성enclosed space 폐위구역

emergency bilge pump 

emergency bilge suction valve emergency boat 

emergency distribution circuit   비상문emergency electric lighting systememergency electric power sourceemergency electrical appliance 

emergency feeder      

emergency generator diesel engine     emergency generator engine fuel oil tank      

emergency mooring winch      emergency mooring wire rope  Emergency Position Indicating Radio Beacon(EPIRB) emergency ration      emergency shutdown test     emergency shut-off valve air reservoir emergency stop test   

Emergency Switch Board (ESB)emergency switch      emergency towing arrangementemergency valve       emergency water supply systememigrant ship  emitter 

emulsification  

Page 366: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

밀폐형그래브버킷둘레막이격벽파만남진동수

end bracket 단부브래킷end connection 단부연결부단말링크end plate 경판end plate effect 끝판 효과end shackle 단말 새클축단 추력맞은편에endurance 항속거리endurance limit 피로한도endurance test 내구시험energy 에너지에너지선도energy equation 에너지 방정식

와류실손실기관베드기관베드실린더컬럼

engine control console 기관제어콘솔engine control room 기관제어실

기관제어실공기조화장치기관제어실냉방장치기관효율기관기진력

engine room 기관실engine room arrangement 기관실배치도기관실격벽기관실위벽기관실구멍

기관실통풍기기관베드

engine shop 엔진공장기관창고engine telegraph 엔진텔레그라프기관무인화운전시험기관당직

기관사거주구역 기관사

engineer's alarm 기관사호출장치engineers' cabin 기관사실engineer's log book 기관일지engineers' public room 기관사공용실검사강화제도확대링크선미깃대상선기enthalpy 엔탈피enthalpy method 엔탈피 방법갇힌기체함유량

enclosed type grab bucket     enclosure bulkhead     encounter frequency   

end link 

end thrust     endon  

energy diagram 

energy loss in exit volute      engine bearer  engine bed     engine column 

engine control room air conditionerengine control room unit cooler engine efficiency       engine exciting force   

engine room bulkhead  engine room casing    engine room opening   engine room ventilating fan    engine seat    

engine store   

engine unmanned control testengine watch   engineer officers' accommodationengineer   

Enhanced Survey Program(ESP)enlarged link   ensign staff    ensign 

entrained gas content  

Page 367: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

entrainment 유입류entrance 물가름부물가름각entropy 엔트로피엔트로피선도entry angleentry flow 입구유동envelope 포락선envelope results 포락선 결과유성기어감속장치epoxy 에폭시equal angle 등변형강시차율equilibrium water line 평형상태수선평형equipment 의장품호밍설비equipment list 장비목록표의장수equipment replacement 장비대체등퍼텐셜선equivalent breadth 등가폭

등가소음레벨equivalent criteria 등가기준등가설계파등가증발량등가길이equivalent notch stress 등가노치응력등가반지름

등가거칠기equivalent sectional area 등가단면적

등가응력등가비틀림모멘트

erection 탑재erection inspectionerection network schedule 탑재연결일정erection schedule 탑재일정계획erection sequenceergonomics 에릭슨사이클erosion 침식erosion corrosion 난류부식침식보호escape hood 비상탈출용 보호구비상사다리도출관escape route 탈출로탈출구escape trunk 탈출 트렁크

도출밸브선미선명판

entrance angle 

entropy chart   유입각

epicycle reduction gear 

equation of time       

equilibrium     

equipment for homing  

equipment number     

equipotential line       

equivalent continuous sound level

equivalent design wave (EDW)equivalent evaporation equivalent length       

equivalent radius       equivalent sand roughness     

equivalent stress       equivalent twisting moment     

탑재검사

탑재순서인간공학Ericsson cycle 

erosion shield  

escape ladder  escape pipe    

escape scuttle 

escape valve   escutcheon     

Page 368: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

중요보기중요용도

estimated labor load 추정인력부하estimated mass 추정중량

도착예정시간출발예정시간부식시험에칭유럽해사안전청공정점공정용접

evaluation of alternatives 대안평가현행방법평가생산실적분석

evaporating coil 증발 코일evaporation 증발증발력증발계수증발력evaporator 증발기even keel 이븐킬Event Tree Analysis (ETA) 사건수목분석evolution strategies 진화전략excavator 굴삭기

초과배율창구초과적량

exciter 여자기exciter 기진기exciter test 가진시험여자전류exciting frequency 기진진동수강제모멘트배타적경제수역exclusive surveyor 전임검사원회유선공작법면제증서exhaust 배기배기캠exhaust gas 배기가스배기가스보일러exhaust gas economizer 배기가스이코노마이저

배기가스이코노마이저급수펌프배기가스관배기가스소음기배기가스터빈배기손실

exhaust manifold 배기 매니폴드배기노즐배기관배기구

essential auxiliary machinery   essential service       

Estimated Time of Arrival (ETA)Estimated Time of Departure (ETD)etch test       etching European Maritime Safety Agency (EMSA)eutectic point  eutectic welding       

evaluation of current methodsevaluation of production performance

evaporative capacity   evaporative factor      evaporative power     

excess multiplication factor    excess of hatchway    

exciting current 

exciting moment       Exclusive Economic Zone (EEZ)

excursion boat execution of work     exemption certificate   

exhaust cam   

exhaust gas boiler     

exhaust gas economizer feed water pump  exhaust gas pipe       exhaust gas silencer   exhaust gas turbine    exhaust loss   

exhaust nozzle exhaust pipe   exhaust port   

Page 369: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

배기받이배기구exhaust steam 배출증기

배기유분분리기배출증기관배기행정

exhaust valve 배기밸브배기밸브개방장치배기밸브개방장치배기통풍기현존선유출각출구면적준자오선고도

expanded area 확장면적확장면적비날개 전개넓이expanded metal 인장철망판인장철망판격자expansion 전개expansion 팽창신축조절용곡관팽창계수디퍼렌셜드레인트랩팽창기관팽창해치팽창창구신축환expansion joint 신축이음expansion loop 신축루프신축관이음전개도팽창비신축환팽창행정팽창탱크확장시험expansion trunk 팽창트렁크

팽창트렁크식창구expansion U bandexpansion valve 팽창밸브expected load history 기대하중이력 experimental model basin 모형실험수조experimental tank 시험탱크expert system 전문가시스템전문가시스템셸explosion 폭발폭발실폭발등급방폭형구조explosion risk 폭발행정폭발시험explosion-proof apparatus 방폭기기방폭천장등

exhaust receiver       exhaust slot    

exhaust steam oil separator    exhaust steam pipe    exhaust stroke 

exhaust valve easing gear     exhaust valve lifting   exhaust ventilating fan existing ship     exit angle      exit area       exmeridian altitude     

expanded area ratio    expanded blade area   

expanded metal grating 

expansion bend expansion coefficient   expansion drain trap   expansion engine       expansion hatch expansion hatchway    expansion hoop 

expansion pipe joint    expansion plan expansion ratio expansion ring expansion stroke       expansion tank expansion test 

expansion trunk hatchway       유(U)자형 신축관이음

expert system shell    

explosion chamber     explosion class explosion proof type    폭발 위험explosion stroke       explosion test  

explosion-proof ceiling light

Page 370: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

explosion-proof lampexplosion-proof motor 방폭형전동기explosive atmosphere 폭발위험구역

폭발성가스지수함수실험노출심노출갑판

exposed metal part 노출금속부exposed weather deck 노천갑판바람맞이면적extension 연장부주물자신장계extent of work

외연기관external design agency 외부완열기외연보일러외압감멸계수extinguishing medium 소화제부급수밸브과당치수비extra work 추출펌프extraction towerextrapolation 외삽법최대폭최대흘수전장극치압출알루미늄압출재extruded plating 압출판재압출기extrusion 압출형재압출법eye plate 아이플레이트eye slit 아이슬릿아이스플라이스아이볼트eyebrow 눈구멍fabric 직물fabrication line plan 가공 송선계획

제작절차서fabrication shop 가공공장face 면재face 앞면면재앞면캐비테이션face flat 면재표면경화

방폭등

explosive gas  

exponential experiment exposed core  exposed deck  

exposed wind area     

extension scale extensometer   작업범위external combustion engine     설계용역external desuperheater external firing boiler   external pressure      extinction coefficient   

extra feed valve       extra proportion        추가공사extraction pump  추출탑extreme breadth       extreme draft  extreme length extreme value       extruded aluminum     extruded material      

extruding machine     

extrusion process      

eye splice     eyebolt  물받이eyelet hole     

Fabrication Sequence Diagram (FSD)

face bar       face cavitation 

face hardening 

Page 371: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

마스크용접면앞면피치면재손얼굴가리개

face width 치폭표면굽힘시험편표면굽힘시험facilities layoutfacing 자리고르기와셔맞비빔맞춤팩시밀factor of safety 안전계수 factor of subdivision 구획계수

인수자 공장시운전factory automation 공장자동화공모선fail-safe 고장대비형fail-safe hold-back unit 이중안전 홀드백장치 fail-safe principle 고장대비원리failure 고장failure 파손

고장모드영향분석failure rate 순정류순정곡선순풍fairing 순정작업fairlead cleat 페어리더 클리트페어리더fairway 항로항로입구부표플레어썰물falls 폴false bottomfalse ceiling 가천장가상가상용골보호판선수재보호판fan 송풍기송풍기케이싱Fan Coil Unit (FCU) 공기조화기송풍부양기관fashion plate

군수지원함패스트푸리에변환조임볼트가열공구고착못

fathom 패덤

face mask      face of weld   

face pitch    

face plate      face shield     

face-bend specimen    face-bend test  설비배치facing ring     facing up      facsimile       

Factory Acceptance Trial (FAT)

factory ship    

Failure Mode Effect Analysis (FMEA) 고장율fair current    fair curve      fair wind       

fairleader     

fairway buoy   fall out falling tide     

가저false echo     false image    false keel      false stem     

fan casing     

fan engine      선수재 판Fast Combat Support Ship (AOE)Fast Fourier Transform (FFT)fastening bolt heating device   fastening nail  

Page 372: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

fatigue 피로fatigue allowancefatigue analysis 피로해석fatigue check 피로검토fatigue corrosion 피로부식fatigue crack 피로균열fatigue crack initiation 피로균열발생fatigue crack propagation 피로균열전파fatigue damage 피로손상피로한계fatigue notch factor 피로 노치계수fatigue resistance 피로강도fatigue strength 피로시험faucet 수도꼭지스피것이음fault 고장fault condition 고장조건 Fault Tree Analysis(FTA) 고장수목분석페잉플랜지접합면페더키날개수차수평유지디딤판되먹임feed pump 급수펌프

급수조절밸브캐스케이드탱크급수가열기급수넘침탱크급수관급수펌프급수조절 밸브급수조절기급수탱크

feedback operation 역급전 feeder 피더장치급전반feeder service 피더운송feeler gauge 틈새 게이지암로터fender 방현재펜더타워ferrite 페라이트페라이트입도ferrule 페룰ferry 도선도선핵연료전환물질fiber 파이버fiberglass 유리섬유

유리섬유강화플라스틱fid 피드피드구멍피들도르래

피로여유

fatigue limit    

피로강도fatigue test    

faucet joint    

faying flange   faying surface  feather key    feathering paddle wheel feathering step feed back      

feed water control valve       feed water filter tank  feed water heater      feed water overflow tank      feed water pipe feed water pump       feed water regulation valvefeed water regulator   feed water tank 

feeder panel   

female rotor   

fender tower   

ferrite grain size       

ferry boat      fertile material 

Fiberglass Reinforced Plastics (FRP)

fid hole fiddle block    

Page 373: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선수장식fiddly opening 보일러실 통풍구field 필드field engineerfield fabricationfield plan 현업생산계획field welding 현장용접돌출난간선수상장갑관통계수줄솔줄솔용가재fillet 필릿

전달필릿용접옆면필릿용접필릿용접크기필릿용접선수충전재

filling height 주입수높이filling level 적재수준주입관filling ratio 적하율필름배지film cooling 필름냉각필름냉각날개필름냉각구멍유막윤활filter 필터fin 핀fin keel 핀 용골fin stabilizerfin tube 핀 붙이관핀튜브형열교환기겉칠final damage water line 최종손상수선final drawing 완성도final inspection 완성검사final sighting 최종지회로final survey 완성검사fine controlfine grain 세립 fine mesh 상세요소분할가는나사fineness 비척도finish paint 마감도장finish symbol 다듬질기호마감검사유한익렬

유한차분법유한요소법

Finite Volume Method (FVM) 유한체적법fire alarm 화재경보 fire alarm system 화재경보장치

fiddle head     

현장기사현장제작fife rail figure head    figure of merit file brush      file card       filler metal     

fillet weld in normal shear     fillet weld in parallel shear       fillet weld size fillet welding   filling chock    

filling pipe     

film badge     

film cooling blade      film cooling hole       film lubrication 

핀 안정기fin tube type heat exchangerfinal coating   

최종축심투시final subcircuit 

미세조정fine thread     

finish-turn inspection  finite cascade  Finite Difference Method (FDM)Finite Element Method (FEM)

Page 374: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소방도끼fire bar 불격자봉불격자받침소방버킷fire classification 내화점토화재제어도소화제어실방화댐퍼fire dangerous zone 화재위험구역선수역재화재탐지장치화재탐지기fire door 방화문fire door indicator panel 방화문 표시기패널fire drill 화재훈련fire endurance 내화성소화기소화설비

소화설비소화설비

fire extinguishing system 소화장치소방설비포말소화제불격자

fire hose 소화호스소화호스상자소화노즐fire insulationfire main 소화주관소화주관소화마스크방사총화재순찰소화관발화점fire precaution 화재 예방fire prevention 화재 방지fire protection

방화구조fire pump 소화펌프불갈퀴fire resistance cable 내화성케이블내화격벽fire resisting division 내화구획 내화도료내화시험내화목재fire retardant paint 난연성페인트방화구획방화문난연재보일러실격자

fire axe 

fire bar bearer fire bucket      화재 분류fire clay       fire control plan       fire control station     fire damper    

fire deadwood  fire detecting system  fire detector   

fire extinguisher       fire extinguishing apparatusfire extinguishing appliance    fire extinguishing equipment

fire fighting system    fire foam       

fire grate      

fire hose box  fire hose nozzle  방화재fire main pipe  fire mask      fire monitor    fire patrol      fire pipe       fire point      

방화fire protection construction     

fire rake       

fire resisting bulkhead 

fire resisting paint     fire resisting test      fire resisting wood     

fire retarding division  fire retarding door     fire retarding material  fire room grating       

Page 375: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

화재 안전 장치 코드fire simulation 화재시뮬레이션불갈퀴봉소화제어실연관보일러소화줄소방선내화벽돌Fire-Control System (FCS) 사격통제체계fire-fighting 소방fire-fighting boat 소방선소방원장구방화격벽내화시험fire-protected free-fall li 내화자유낙하구명정fire-protected lifeboat 내화구명정

진화가스착화순서발화점연소압력점화봉부삽우현큰닻초벌칠first moment

first-aid kit 응급의료구first-in first-out method 선입선출법first-line supervisor 일선감독자톱날형날개어획물운반선은점어군탐지기활어창어류가공선활어창

어업시험선어업지도선어로감시선어로감시선어업조사선어업실습선

fishing boat 어로장어구어로등낚시대판어업제한어선덧댐판fission 핵분열핵분열계수관핵분열생성물

Fire Safety Systems (FSS) code

fire slice       fire station     fire tube boiler fire wire       fireboat firebrick      

fireman's outfit       fireproof bulkhead      fireproof test 

fire-smothering gas    firing order    firing point     firing pressure firing rod      firing shovel   first bower anchor    first coat       first engineer   1등기관사first mate       1등항해사단면1차모멘트first officer     1등항해사

fir-tree blade  fish carrier    fish eye fish finder     fish hold       fish meal factory ship  fish well       fisheries examination boat      fisheries guidance boat      fisheries inspection boat       fisheries patrol boat    fisheries research boat fisheries training boat   어선fishing chief   fishing gear    fishing light    fishing platform fishing restriction      fishing vessel  fishplate       

fission counter fission product 

Page 376: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

핵분열수율fit 맞춤완성공완성공장fitting 부착물fitting 의장fitting length 부착길이선구고의장부두완성공장fit-up 선행부착공간고정축fixed deck foam system 고정식갑판포말장치fixed end 고정단fixed end moment 고정단모멘트 고정식화재탐지장치

고정식소화장치fixed gas sampling system 고정식가스시료채취관장치 fixed gas warning system 고정식가스경보장치고정식크레인fixed jig 고정지그고정원형창고정라이너불휘발성기름고정식거리눈금고정식거리눈금고정식드래그헤드

고정식 사수소화장치fixture 기상자기상자flag of convenience 편의치적기서랍flag state 기국흰반점flaking 플레이킹불꽃조정불꽃어닐링불꽃막이불꽃청소불꽃심flame cutting 불꽃절단flame cutting flash 불꽃절단자국flame failure 불꽃꺼짐불꽃홈파기불꽃경화불꽃절삭플레임플레이너화염판화염전파flame retardant 난연성난연성전선난연성재료

내연소시험

fission yield    

fitter   fitter's shop  

fitting locker   fitting out basin fitting shop    

fixed axes     

fixed fire detection systemfixed fire-extinguishing system

fixed jib       

fixed light     fixed liner     fixed oil       fixed range marker    fixed range ring       fixed type drag head   fixed water fire-extinguishing system 고정구flag chest      flag locker     

flag rack       

flakes  

flame adjustment       flame annealing flame arrester flame cleaning flame cone     

flame gouging  flame hardening flame machining flame planer   flame plate     flame propagation      

flame retardant cable  flame retardant material flame retardant test on bunched cables

Page 377: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

화염스카핑flame screen 화염차폐그물망flame-proof apparatus 방폭기기

방폭격벽등flame-proof ceiling light 방폭천장등폭발등급flammable 가연성flammable gas 가연성가스flammable gas detector 가연성가스 탐지기 flammable liquid locker 가연성액체창고flammable mixture 인화성가스 flammable vapor 가연성 증기flange 플랜지flange 면재플랜지커플링플랜지이음플랜지브래킷플랜지끝용접끝꺾음판플랜지기계플랜지품질플랜지시험flap 플랩덮개문나비형밸브flare 플레어flare angle 플레어각플레어형유니언불꽃flaring 플레어flaring test 확관시험인화점인화점시험기역화flashing light 섬광등

거대선표시등위험물적재선박표시등섬광신호섬광비틀림동력계인화점

flat 평판flat bar 평강평강격자평강일반보강재flat bottom 평저flat bottom forward area 선수선저평편부평면끌평철flat panel base 평판베이스flat position welding 하향용접평강플랫밸브하향용접flatness 편평도

flame scarfing  

flame-proof bulkhead light     

flame-proof grade     

flange coupling flange joint    flanged bracket flanged edge weld     flanged plate   flanging machine       flanging quality flanging test   

flap door       flap valve      

flare type union flare-up light  

flash point     flash tester    flashback      

flashing light for huge vessel  flashing light for vessel carrying dangerous cargo flashing light signal    flashing light torsion meter     flashing point  

flat bar grating flat bar ordinary stiffeners

flat chisel      flat iron 

flat steel       flat valve      flat welding     

Page 378: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

편평시험흠탐지기fleet 선대fleet insurance 선대보험fleet race 선단경기플레트너식 타flexibility 유연성유연베어링유연성전선유연성전선유연연결플렉시블호스플렉시블조인트유연 생산체계flexible mounting 플렉시블 거치flexible pipe 플렉시블관플렉시블관이음플렉시블축flexible wing 유연날개굽힘강성flight deck 비행갑판연직변위각플린더스바장치float 플로트부양이탈진수float gauge 플로트게이지플로트액면계float on/off shipfloat time 공정여유시간플로트트랩float valve 플로트 밸브floater 플로터유동도르래floating body 부유체기중기선부양식 독유동축받이베어링부유잔교유동레버

콘크리트믹서부선floating out 부분진수부유잔교

부유식생산설비선부유식생산저장하역설비선유동링부표신호부유식저장하역설비선부유식저장재기화설비선부유식저장설비선

flood 침수수문flood lightfloodability 침수성

flattening test  flaw detector  

Flettner's rudder     

flexible bearing flexible cable  flexible cord   flexible coupling       flexible hose   flexible joint   flexible manufacturing system

flexible pipe joint      flexible shaft   

flexural rigidity   

flight path angle       Flinders bar    

float free launching    

float level gauge        플로트 온/오프 선float trap      

floating block  

floating crane  floating dock   floating frame bearing  floating landing stage  floating lever  floating mixing plant barge     

floating pier    Floating Production Unit (FPU)Floating Production, Storage and Off-loading (FPSO) unitfloating ring    floating sign   Floating Storage and Off-loading (FSO) unitFloating Storage Regasification Unit (FSRU)Floating Storage Unit (FSU)

flood gate       투광등

Page 379: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

가침장침수상태flooding 침수침수계산flooding level 침수수위침수관침수시험flooding time 침수시간floor 늑판현도못floor plate 바닥판바닥판받침늑재목플루어링플로틸러리더flow 흐름flow chart 흐름도표유량계수flow control 유동제어flow diagram 흐름도표flow flux 유동플럭스flow measurement 유량계유동가공방식유량유동상태flow through method 범람방법flow topology 유동위상

유동가시화장치flue 연도flue gas 연도가스연도가스분석

연도가스소화장치fluid 유체fluid borne noise 액체나침반유체커플링액체소화기유입각fluid level 액면레벨유출각형광등fluorescent paint 형광페인트flush deck 평갑판flush deck ship 평갑판선평갑판선평갑판선평면필릿용접접시머리리벳flush scuttle 평갑판구평면판붙임평면용접플러싱flux 플럭스flux and reflux 조수간만

floodable length flooded condition       

flooding calculation     

flooding pipe   flooding test   

floor pin       

floor plate bearer      floor timber    flooring flotilla leader  

flow coefficient 

유량측정flow meter     flow pattern    flow rate       flow regime    

flow visualization installation

flue gas analysis       flue gas fire extinguisher      

유체전달소음fluid compass  fluid coupling  fluid fire extinguisher  fluid inlet angle   

fluid outlet angle       fluorescent lamp       

flush deck vessel      flush decker   flush fillet weld flush head rivet 

flush system   flush weld     flushing 

Page 380: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

플럭스석면뒷댐법flux cored arc welding 용융제분사식절단비행정flying bridge 최상층선교최상층선교갑판플라잉지브플라잉패시지비행갑판flywheel 플라이휠플라이휠펌프포말방사기거품 캐비테이션foam concentrate supply 포말 소화기

포말소화장치터릿노즐포말원액

foam monitor 포말분사장치포말스프링클러푀팅거수력커플링안개종안개호각분무노즐안개신호무중표적날개폭포일스트레인게이지접는세면대추종제어추종장치

following current 순조류following operationfollowing sea 선미파반류순풍food ration 구난식량food wastes 음식쓰레기foot belt 풋 벨트풋 로프풋 밸브

발판강제맞춤압상펌프forced circulation 강제순환forced draft fan 강제통풍 팬강제통풍아궁이forced draft trunk 강제 송풍로강제윤활강제윤활기강제동요장치강제횡동요강제진동fore and aft rigged 종돛장치

Flux Asbestos Backing (FAB) method 플럭스 코어드 아크 용접flux injection cutting   flying boat     

flying bridge deck      flying jib       flying passage flying-off deck 

flywheel pump foam applicator foam cavitation  포말 원(농축)액 공급foam extinguisher   foam fire extinguishing system foam gun      foam liquid     

foam sprinkler Foettinger hydraulic coupling   fog bell fog horn       fog nozzle     fog signal      fog target      foil span       foil strain gauge       folding lavatory follow up control       follow up mechanism   

후속공정following wake following wind 

foot rope      foot valve      footing  늦추기 footstep force fit       force pump    

forced draft front      

forced lubrication      forced lubricator       forced oscillator       forced rolling  forced vibration 

Page 381: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

종범선종통재세로돛종돛스쿠너창구덮개받이종통재

fore block 선수블록선수방사형늑골fore construction 선수구조도예냉기포어코스선수데드우드용골단부전부선창fore peak 최선수fore perpendicular (FP) 선수수선선수포핏포어톱갤런트마스트선체전반부forecastle 선수루선수루후단격벽선수루갑판선수루현측외판foreign matter 포어록직장foremast 선수마스트선수격벽선수피크탱크앞돛포어시트앞당김줄앞당김줄돛포어톱마스트foreward 풀무단접단강forging 단조단조해머단조기단조비단조공장가압테르밋쌍발끝fork plate 포크 판forklift truck 지게차

형상흘수형상계수형상건현형상저항공식안전평가

forming formular class 포뮬러 급

fore and aft rigged vessel     fore and aft runner    fore and aft sail       fore and aft schooner  fore and afters 

fore cant frame 

fore cooler     fore course    fore deadwood fore foot       fore hold       

fore poppet    fore top gallent mast   forebody       

forecastle bulkhead    forecastle deck forecastle side plate    이물질forelock foreman 

forepeak bulkhead     forepeak tank  foresail foresheet      forestay forestaysail    fore-topmast    선수방향forge and bellow forge welding  forged steel    

forging hammer forging machine forging ratio   forging shop   forging thermit fork end       

form draft     

form factor    form freeboard form resistance Formal Safety Assessment(FSA) 성형Forty-feet Equivalent Unit (FEU) 40피트컨테이너 등가적재량

Page 382: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

앞으로굽은날개선수흘수forward perpendicular (FP) 선수수선앞쪽스퍼드

선미관전부실링유냉각기선미관전부실링유펌프선미관전부실링유탱크

forward superstructure 전부선루전진용접닻줄엉킴오손거치볼트주물공장

네바퀴도르래Fourier transform 푸리에변환fractional rig 부분범장fractional sloop 부분범장 슬루프fractional step method 다단계 방법fractography 프랙토그래피 fracture 파괴파단면파단면시험파괴인성값frame 늑골늑골재늑골정면도늑골브래킷늑골세우기늑골선늑골라이너늑골단면계수늑골번호늑골단면늑골간격늑골재정보흐름 체계늑골정면도제일수framing system 늑골방식free bend 자유굽힘free bend test 자유굽힘시험

자유굽힘시험편free decay test 자유감쇠시험free edge 자유변자유낙하진수free flow area 자유유동면적자유기체함유량Free On-Board (FOB) 수출항 본선인도 가격자유동요자유항자유회전프로펠러자유음장

forward curved vane   forward draft  

forward spud   forward stern tube sealing oil coolerforward stern tube sealing oil pumpforward stern tube sealing oil tank 

forward welding foul anchor    fouling foundation bolt foundry four cycle diesel engine  4행정디젤기관four point bearing       4점방위법four-fold block 

fracture surface fracture test   fracture toughness     

frame bar      frame body plan       frame bracket  frame erection frame line      frame liner     frame modulus frame number  frame section  frame space   frame timber   framework of information flowframing body plan      framing number 

free bend test specimen       

free fall launching      

free gas content       

free oscillation free port       free rotating propeller free sound field 

Page 383: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

자유유선흐름free surface 자유수면free surface effect 자유수면효과free surface flow 자유수면유동자유진동자유소용돌이free water 자유수자유수면효과freeboard 건현건현지정건현폭건현갑판건현길이만재흘수선표지건현비건현규칙free-fall lifeboat 자유낙하식 구명정

공기자급식자유낙하식구명정방수구냉동선냉동실

freezing point 빙점냉동실냉동고

freight container 화물콘테이너운임률freight ton 운임계산중량톤프레온가스frequency 주파수frequency 진동수frequency 빈도주파수밴드주파수변환기주파수필터주파수계주파수변조주파수분해능frequency response 주파수응답

주파수응답함수주파수보정레벨생식품청수여과기조수장치해수펌프조수장치순환펌프조수장치증류수펌프조수장치이젝터펌프조수장치

free streamline flow   

free vibration  free vortex    

free water effect       

freeboard assignment  freeboard breadth      freeboard deck freeboard length       freeboard mark freeboard ratio freeboard rule 

free-fall lifeboat with a self-contained air support systemfreeing port    freezing carrier freezing chamber       

freezing room  freezing store  

freight rate    

Freon  

frequency band frequency changer     frequency filter frequency meter       Frequency Modulation (FM)frequency resolution   

Frequency Response Function(FRF) frequency weighted sound level fresh provision fresh-water filter      fresh-water generator brine pump fresh-water generator circulating pumpfresh-water generator distillate pumpfresh-water generator ejector pumpfresh-water generator  

Page 384: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

청수가열기청수압력탱크담수만재흘수선청수압력탱크청수펌프청수여과기청수탱크

fretting corrosion 프레팅부식friction 마찰마찰브레이크마찰클러치friction coefficient 마찰계수마찰수정마찰커플링friction drag reduction 마찰저항감소friction head 마찰수두마찰손실마찰톱마찰교반용접마찰반류마찰바퀴frictional resistance 마찰저항

마찰저항계수Frigate (FF) 호위함프리깃선전단격벽앞기둥정면도전단필릿용접전부헤더거품일기프루드수Froude's similitude 프루드의 상사법칙냉동화물냉동육류프륄링형드래그헤드과일운반선fuel 연료핵연료집합체fuel canning 핵연료피복핵연료피복재fuel consumption 연료소비량연료소비량시험연료조절핸들fuel cut-off device 연료차단장치연료절약핵연료체연료가스핵연료취급캐스크연료분사펌프연료분사밸브fuel oil 연료유조연제주입펌프조연제탱크연료유블랜더장치

fresh-water heater     fresh-water hydrophore tank   fresh-water load line   fresh-water pressure tank      fresh-water pump      fresh-water strainer    fresh-water tank       

friction brake  friction clutch  

friction correction      friction coupling 

friction loss    friction saw    Friction Stir Welding (FSW)friction wake   friction wheel  

frictional resistance coefficient 

frigate ship    front bulkhead front column   front elevation front fillet weld front header   frothing Froude number 

frozen cargo   frozen meat    Fruhling type drag head fruit carrier    

fuel assembly  

fuel canning material   

fuel consumption test  fuel controlling handle 

fuel economy  fuel element   fuel gas fuel handling cask      fuel injection pump     fuel injection valve     

fuel oil additive pump  fuel oil additive tank   fuel oil blender 

Page 385: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

연료유가압펌프연료유중간탱크분연펌프연료유전환시험연료유순환펌프

fuel oil consumption 연료유소모량연료유분배함연료유드레인탱크연료유여과기연료유중력탱크연료유넘침탱크연료유관연료유전처리시스템시동연료펌프연료유청정기

fuel oil return chamber 연료유리턴체임버연료유리턴탱크연료유서비스관연료유서비스펌프fuel oil service tank 연료유서비스탱크연료유슬러지탱크연료유여과기연료유공급펌프fuel oil tank 연료유탱크

연료유탱크비상차단밸브연료유이송관연료유이송펌프

fuel pump 연료유펌프연료재처리fuel shut-off device 연료차단장치fuel spray 연료분무fuel valve 연료밸브

연료밸브냉각청수냉각기연료밸브냉각청수펌프연료밸브냉각청수탱크연료밸브냉각유냉각기연료밸브냉각유펌프연료밸브냉각유탱크연료분사밸브 래핑공구연료분사밸브 시험장치풀크럼축

full astern 전속후진full draft 만재흘수만선장식완전필릿용접full load 만재full load 전부하full load 전하중

fuel oil booster pump  fuel oil buffer tank     fuel oil burning pump  fuel oil change over test       fuel oil circulating pump       

fuel oil distributing box fuel oil drain tank      fuel oil filter   fuel oil gravity tank    fuel oil overflow tank  fuel oil pipe    fuel oil pretreatment system   fuel oil priming pump  fuel oil purifier 

fuel oil return tank       fuel oil service pipe    fuel oil service pump  

fuel oil sludge tank   fuel oil strainer fuel oil supply pump   

fuel oil tank emergency shut-off valve fuel oil transfer pipe   fuel oil transfer pump  

fuel reprocessing      

fuel valve cooling fresh water cooler  fuel valve cooling fresh water pump   fuel valve cooling fresh water tank    fuel valve cooling oil cooler    fuel valve cooling oil pump    fuel valve cooling oil tank     fuel valve lapping tool fuel valve testing device   fulcrum shaft   

full dressing ship      full fillet weld  

Page 386: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

full load condition 만재적하상태full load current 전부하전류

만재배수량만재흘수full penetration weld 완전용입용접full power 전출력전출력시운전full rated power 최대정격출력full rotate keel 전회전 용골full scale 현척중구선전선구조해석full size 현척현도전속중용접다듬이다듬이표토풀리그드선

실선 및 모형선자료완전평형타완전캐비테이션프로펠러완성캐비티

fully loaded 만재압력식가스운반선fume extraction 연무배출fumigationfunnel 연돌자연통풍

연돌비상차단장치연돌마크

furnace 노통노브레이징노천장노통변형측정기노아궁이문노앞면노게이지노앞면노용적퍼링

fuse 퓨즈퓨즈판퓨즈상자퓨즈스위치가융합금가융합금fusible plug 가융플러그용해용접융합부

full load displacement  full load draft      

full power trial 

full scantling vessel    full ship structural analysis 현척full size mold full speed      full welding    fuller  fullering tool   Fuller's earth full-rigged ship full-scale and model test datafully balanced rudder   fully cavitating propeller       fully developed cavity  

fully pressurized gas carrier

훈증소독funnel draft    funnel emergency shut-off devicefunnel mark    

furnace brazing furnace crown furnace deformation indicator  furnace door   furnace front   furnace gauge  furnace mouth furnace volume furring 

fuse board     fuse case      fuse switch    fusible alloy    fusible metal   

fusion welding fusion zone    

Page 387: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

futtock 퍼턱퍼턱리깅gaff 개프gaff rig 개프 리그개프캣개프커터개프슬루프개프욜gaff schooner riggaff sloopgain 이득이득조정Galerkin method 갤러킨기법gallery 난간galley 갤리선갤러웨이튜브갤로스galvanic action 전식작용galvanic corrosion 이종금속간부식galvanize 아연도금 아연도금강아연도금감마선검사갱gangway 현문보도다리현문돌쩌귀현측사다리현문등현문갠트리크레인간격효과garbage chute 폐기물배출구garbage record book 폐기물기록부가스분석기가스풀림가스브레이징gas carrier 가스운반선gas chromatography 가스크로마토그라피가스용석탄

가스농도계측기gas content 기체함유량

포화액기체함유량가스절단

gas detection system 가스탐지장치가스탐지기가스이젝터가스기관gas free 가스프리가스프리팬가스발생로가스가우징가스마스크gas measurement 가스측정gas metal arc welding 가스금속 아크용접

futtock rigging 

gaff rigged cat gaff rigged cutter      gaff rigged sloop       gaff rigged yawl        개프·스쿠너 범장개프·범장gain control   

조리실galley  Galloway tube  gallows 

galvanized steel galvanizing     gamma ray inspection  gang   

gangway bridge gangway hinge gangway ladder gangway light  gangway port  gantry crane   gap effect      

gas analyzer   gas annealing  gas brazing    

gas coal       gas concentration measurement instrument  

gas content of the saturated liquidgas cutting     

gas detector   gas ejector    gas engine     

gas free fan   gas generator  gas gouging    gas mask      

Page 388: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

가스감시기gas oil 가스 유가스관가스압력용접gas producer 가스발생기gas purging 가스제거장치gas sampling pipe 가스채취관가스실드가스표gas testing 가스성분검사가스토치가스트라이얼gas tungsten arc welding 가스텅스텐아크용접gas turbine 가스터빈가스터빈선가스배기관가스경보장치가스용접gaseous fuel 가스연료가스화개스킷가솔린기관gas-shielded arc welding 가스차폐 아크용접gastight 기밀기밀격벽기밀문기밀조명등 gate 탕구

압탕문형전단기게이트밸브

gauge 게이지gauge board 게이지계수gauge glass 수면계유리수면계유리보호장치표점간거리표점계기용 관게이지시험기거즈소독기가는눈철망gear coupling 기어커플링gear pump 기어 펌프gear ratio 톱니수의 비기어휠기어드디젤기관기어드트롤리전동장치Geislinger coupling 가이스링거커플링비상경보general arrangement 일반배치도

gas monitor    

gas pipe       gas pressure welding  

가스정화gas removal equipment 

gas shield      gas table       

gas torch      gas trial       

gas turbine ship gas vent pipe  gas warning system    gas welding    

gasification     gasket gasoline engine 

gastight bulkhead      gastight door gastight lighting enclosure

gate riser      

gate shear     

gate valve     

계기판gauge factor   

gauge glass protector  gauge length   gauge mark    gauge pipe     gauge tester   gauze sterilizer gauze wire     

gear wheel     geared diesel engine   geared trolley  gearing 

general alarm  

Page 389: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

기관실전체배치도공동해손

general cargo 일반화물general cargo ship 일반화물선general emergency alarm 총비상경보general outfitting 일반의장공사일반무선통신 잡용공기관잡용펌프

잡용증기관general stock item 일반저장자재일반공구발전장치발전선증발관generator 발전기

발전기용 기관청수냉각기발전기용 기관냉각청수펌프발전기용 기관냉각해수펌프발전기용 기관연료유가열기발전기용 기관윤활유침전탱크발전기용 기관윤활유저장탱크발전기용 기관윤활유섬프탱크제작기준선발전기실발전기용 증기터빈복수기발전기용 증기터빈직선모선

generic model 일반화 모델genetic algorithm 유전 알고리즘

전자해류계geometric inaccuracy 기하학적부정확형상흘수형상건현

기하학적응력집중계수geometry 형상지문항법상사모형Germanischer Lloyd (GL) 독일선급germicidal lamp 살균램프분비작용머리달린키gig 기그유자망어선gimbal 짐벌짐벌이음

general arrangement of engine roomgeneral average 

general radio communicationgeneral service air pipe  general service pump  general service steam pipe     

general tools   generating set generating ship generating tube 

generator engine cooling fresh water cooler    generator engine cooling fresh water pump    generator engine cooling sea water pump      generator engine fuel oil heater generator engine lubricating oil settling tank   generator engine lubricating oil storage tank   generator engine lubricating oil sump tank     generator line  generator room generator steam turbine condensergenerator steam turbine    generatrix      

geomagnetic electrokinematograph

geometrical draft    geometrical freeboard  geometrical stress concentration factor

geo-navigation geosim 

geyser action  gib-headed key 

gill netter      

gimbal joint    

Page 390: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Gimbals mechanism 수평유지기구진블록girder 거더거더블록거더간격거더스테이거더구조girth 거스거스길이gland 패킹누르개글랜드패킹 배기송풍기

글랜드패킹 누설증기관글랜드패킹 실증기관글랜드패킹 복수기

glass fiber 유리섬유유리섬유강화플라스틱선유리창틀유리수면계

glass wool 유리섬유유리섬유보온재유리직물진입각지시등

global displacement vector 전체변위벡터전세계 해상조난 및 안전 시스템위성항법시스템

global strength 전체강도global vibration analysis 전선진동해석globe valve 글로브밸브용융금속방울옹이후진Goal Based Standards (GBS) 목적기반기준보호안경Golden section search 황금분할탐색골리아스크레인gong 동라징부표표시등붙이징전파방위계goods vehicle 화물차량gooseneck 구즈넥구즈넥브래킷gooseneck ventilator 구즈넥 통풍통구멍끌gouging 가우징조정플런저governor 조속기조속장치조속기모터grab 그랩grab bucket 그랩버킷

gin block      

girder block    girder space   girder stay     girder work    

girth length    

gland exhaust fan      gland leak-off steam pipe      gland sealing steam pipe       gland steam condenser 

glass fiber reinforced plastic shipglass holder    glass water gauge     

glass wool heat insulating materialglass woven fabric     glide slope indicating lamp     

Global Maritime Distress & Safety System (GMDSS)Global Positioning System(GPS)

globule gnarl   go astern      

goggles 

goliath crane   

gong buoy     gong with a pilot lamp goniometer     

gooseneck bracket     

gouge  

governing plunger      

governor gear  governor motor 

Page 391: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

그랩버킷식리클레이머그랩준설선그랩히치그레이더선기울기기반 최적화법

gradual failuregraduation 눈금grain 입자낱알용적grain cargo 낱알화물낱알화물용량곡물운반선grand-block joining 대형블록조립입자코르크도식법도시패널graphic symbol 그래픽 심볼도식법

그래픽사용자인터페이스graphite 흑연흑연패킹흑연페인트graphitization 흑연화네발닻불격자면적불격자봉grating 격자격자받침건식 독

중력가속도gravity arc welding 중력식 아크용접중력식대빗중력주입량gravity tank 중력식탱크

중력식탱크급수방식중력파회선철그리스제거기

grease nipple 그리스주입구grease pump 그리스펌프great circle 대권대권항법오대호형 산적화물선근해구역근해구역선우현등green sea 그린파랑하중green sea forces 그린파랑하중그린파랑하중greenhouse gas 온실가스gridgrill 격자선객식당

grab bucket type reclaimer     grab dredger     grab hitch      grader vessel  gradient-based optimization method 열화고장grain capacity  

grain cargo capacity   grain carrier   

granulated cork graphic method graphic panel  

graphical method       Graphical User Interface(GUI) graphite packing graphite paint  

grapnel anchor grate area     grate bar      

grating bearer graving dock   gravitational acceleration       

gravity davit   gravity injection flow rate

gravity tank water service systemgravity wave   gray pig iron   grease extractor       

great circle sailing     Great Lake type bulk carriergreater coasting area  greater coasting vessel green light     

green water    

격자grill room      

Page 392: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

grillage analysis 그릴리지해석격자구조그라인더연마기groove 홈홈각도홈용접grooving 홈파기암수꼴이음홈파기기계총적량gross offered thickness 총 제공 두께gross scantling 총 부재치수gross thickness 총 두께gross thickness offered 제공총두께gross thickness required 요구총두께Gross Tonnage (GT) 총톤수ground 접지선체연결체인검루기대지속력정박용구좌초다섬광등다명암등group starter panel 전동기종합기동반GT No.96 type membrane 보증기사guarantee period 보증속력guarantee work 보호봉보호판guard rail 보호난간경보눈금환gudgeon 거전거전핀guidance 적용지침안내봉굽힘시험지그틀굽힘시험안내날개슬라이드블록안내면가이드라인텐셔너guide piece 가이드 피스안내판안내풀리안내롤러슬라이드블록슬라이드블록guide vane 유도깃

틀절단장치유도탄탑재 순양함유도탄탑재 구축함유도탄탑재호위함

grillage construction   grinder grinding machine       

groove angle   groove weld   

grooving and tonguing grooving machine      gross capacity 

ground chain   ground detector ground speed  ground tackle  grounding      group flashing light    group occulting light   

GT96형식 멤브레인guarantee engineer      보증기간guarantee speed        보증공사guard bar      guard plate    

guard ring     

gudgeon pin    

guide bar      guide bend jig guide bend test guide blade    guide block    guide face     guide line tensioner    

guide plate     guide pulley    guide roller    guide shoe     guide slipper   

guided cutting apparatus       Guided Missile Cruiser (CG)Guided Missile Destroyer (DDG)Guided Missile Frigate (FFG)

Page 393: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

guillotine 판절단기포금포좌포보호판포지지대건태클포함건다이오드거널포수통로gunwale 거널gunwale 현단거널형강거널탱크거싯형강거싯판거싯버팀돌풍거터형강gutter bar 거터 바gutter pipe 거터배수로guy 가이가이윈치gybing 운동실체인홈바퀴gyrocompass 자이로컴퍼스자이로컴퍼스 리피터자이로컴퍼스실회전수도시기자이로파일럿자이로스코프자이로작용자이로안정기

갑판시계미세균열반보반매듭반쪽모형half period 반주기half round bar 반환봉half speed 반속반폭선도반늑판반감기반원단면강평저부반폭

하프스퍼드형와이어가이드장치하프타인형그래브버킷핼리어드상하양부문마룻줄함부르크커스텀등해머마감질

gun metal      gun platform   gun shield     gun support    gun tackle     gunboat Gunn diode       gunnel gunner's bridge       

gunwale angle  gunwale tank   gusset angle   gusset plate    gusset stay    gust   gutter angle    

배수관gutter water way      

guy winch      돛돌리기 (자이빙)gymnasium     gypsy wheel   

gyrocompass repeater     gyrocompass room gyrograph      gyropilot      gyroscope      gyroscopic action      gyrostabilizer  H bend  에이치(H)벤드hack watch    hair crack      half beam      half hitch      half model     

half-breadth plan       half-floor frame   half-life half-round bar steel   half-siding     half-spud type wire guide device      half-tine type grab bucket     halliard halved door    halyard Hamburg custom light  hammer dressing       

Page 394: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

해머헤드크레인전기점화단접해머시공리벳타격식쇄석기해머링시험해먹수동빌지펌프hand bore machine 수동드릴수동급탄hand flag 수기수기신호hand flare 신호홍염

수동장치손구멍hand jig 수동지그측심추핸드로그hand pump 수동펌프

핸드리베팅핸드스파이크수동조타장치수동급탄손회전계수동용접handhold 손잡이handrail 난간난간지주handy-max 핸디막스handy-size 핸디사이즈 handy-size bulk carrier 핸디급 산적화물선hangar 격납고비행기격납고hanger point 매달린나침반행잉니현수식 타harbor 항구harbor 항만 harbor condition 항내상태하버갑판항세항내제한속력항장항박도항만레이더항만규칙대피정박지항내속력hard corner 강체요소하드오버하드패치전타좌회전hard protective coating 경화보호도장전타우회전담금강hardening 담금질hardness 경도

hammer head crane    hammer spark ignition hammer welding       hammered point rivet  hammering rock breaker       hammering test hammock       hand bilge pump       

hand firing     

hand flag signal 

hand gear      hand hole      

hand lead      hand log       

hand riveting   hand spike     hand steering gear     hand stroking  hand tachometer       hand welding   

handrail stanchion      

hangar shed     지지점hanging compass       hanging knee  hanging rudder 

harbor deck    harbor dues    harbor limit speed     harbor master  harbor plan    harbor radar   harbor regulation       harbor shelter  harbor speed   

hard over      hard patch     hard port      

hard starboard hardened steel 

Page 395: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

hardness testharm 위해harmful substance 유해물질조화곡선도하핀포경포hasp 걸쇠hatch 해치해치바해치배튼해치빔해치덮개판창별화물목록창구측면종통재해치바해치클리트창구코밍창구덮개

무개형컨테이너창구단보창구끝연재창구격자해치로킹바창구구멍창구덮개판받침해치링창구옆코밍창구옆거더해치타폴린해치쐐기손도끼

hatchway 화물창구hatchway coaming 창구코밍홀링캐리지홀링머신호저파이프호저팀버hawser 호저호저드럼hawser holes 호저홀호저릴hazard 위해성HAZard Analysis (HAZAN) 위해성분석

위해성 및 운전성위해성식별

hazard location 위험위치유해위험물질

hazardous area 위험구역hazardous substance 위험물질H-beamhead 수두head board 헤드 보드창구끝연재헤드라인윈치바우라인

경도시험harmonic diagram      harpin  harpoon gun   

hatch bar      hatch batten   hatch beam    hatch board    hatch cargo list hatch carline   hatch clamping beam   hatch cleat     hatch coaming hatch cover    hatch coverless container      hatch end beam hatch end coaming     hatch grating   hatch locking bar      hatch opening  hatch rest      hatch ring      hatch side coaming    hatch side girder       hatch tarpaulin hatch wedge   hatchet 

hauling carriage hauling machine hawse pipe    hawse timber  

hawser drum   

hawser reel    

HAZard and OPerability (HAZOP)HAZard IDentification (HAZID)

hazardous and noxious substances

에이치(H)형강head ledge     head line winch head line       

Page 396: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수두수두펌프최대정지거리헤드로프head sea 선수파선수좌판헤드시트주방장송출밸브head wind 역풍header 헤더헤더판

선수 및 항적조정장치 heading angle 침로각heading correction factor 진행방향 수정계수선수선선수선선수선선수선headroomhead-up 선수상방표시hearing line 던지기 줄하트불판열영향부heat balance 열평형heat balance diagram 열평형선도열용량열전도heat conductivity 열용량열감지기열낙차열기관열교환기보온판보온시멘트보온재보온매트리스열절연열부하열복사열소비율열회수축열식열교환기열발생heat removal 열제거heat resistant paint 내열성페인트heat straightening 열간교정히트트레이스heat transfer 열전달열전달률열처리난방기난방장치

head of water  head pump     head reach     head rope      

head seat      head sheet     head steward  head valve     

header plate   heading and track control system

heading flash  heading indicator       heading line    heading marker  상부공간Health, Safety and Environment (HSE) 보건·안전·환경heart   hearth Heat Affected Zone (HAZ)    

heat capacity  heat conduction  열전도도heat content   heat detector  heat drop      heat engine    heat exchanger heat insulating board   heat insulating cement heat insulating material heat insulating mattress heat insulation heat load      heat radiation  heat rate       heat recovery  heat regenerator       heat release   

heat trace     

heat transfer rate      heat treatment heater heating arrangement   

Page 397: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

난방보일러heating coil 가열코일가열코일점화기가열불꽃예열구heating method 전열면난방방식heating torch 가열토치

공기조화heat-sink 히트싱크heave 상하동요최저속력안전운항히빙라인heavy ballast condition 헤비 밸러스트 상태heavy cargo 중량화물중량물운반선대형주물중순양함중갑판선중갑판선heavy derrick 중량물데릭중량물데릭붐헤비데릭장치대형단조품Heavy Fuel Oil (HFO) 중질유중질유청정기

중질유저장탱크중질유침전탱크

Heavy Fuel Oil Tank (HFOT) 중질유탱크중질유이송펌프

heavy lift cargo ship 중량물운반선중량물운반선heavy oil 중질유중질유기관황천묘박중용접heel 횡경사힐거전힐디스크힐거전힐니힐피스힐핀틀경사상태힐링펌프헬리아크용접나선각나선기어나선형스프링나선면Helicopter Carrier (CVH) 헬기항모

헬리콥터갑판조명등

heating boiler  

heating coil igniter     heating flame  heating gate    가열방법heating surface heating system 

Heating, Ventilating and Air Conditioning (HVAC)

heave-to       heaving line    

heavy cargo ship       heavy casting  heavy cruiser  heavy deck vessel     heavy decker  

heavy derrick boom    heavy derrick rigs     heavy forging  

heavy fuel oil purifier  heavy fuel oil service tank     heavy fuel oil settling tank     

heavy fuel oil transfer pump   

heavy lifter    

heavy oil engine       heavy sea anchoring   heavy welding 

heel brace     heel disc       heel gudgeon  heel knee      heel piece     heel pintle     heeled and trimmed conditionheeling pump  heliarc welding helical angle   helical gear    helical spring  helicoidal surface      

helicopter deck surface flood light

Page 398: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

helideck 헬리콥터갑판helm 타륜helm angle 타각

보침타각타각지시기조타명령

helm position 조타위치helmet 헬멧

헬멧형잠수호흡기helmsman 조타수hemi-elliptical end plate 반타원형경판hemispherical 반구대마심대마로프헤링본기어Hertz (Hz)heuristic knowledge 체험적지식hexagon head bolt 육각머리 볼트hexagon wrench 육각렌치

계층별입력처리출력표계층도표고합금강고탄소강

high cycle fatigue 고사이클피로high density cargo 고밀도 화물high duty gas compressor 고압가스압축기

고팽창 포말 소화 장치high fire risk area 고화재위험구역

고주파발전기고주파전동발전기

high holding power anchor 고파지력앵커high lift rudder 고양력타

고압급수가열기고압증기관고압터빈고위해수흡입밸브

high stress zone high suction 상부흡입구상부흡입밸브

고온청수냉각기고온냉각청수펌프고온냉각수시스템고온부식고압점화만조고티탄계

helm angle for course keeping helm indicator  helm order     

helmet type diving apparatus   

hemp core     hemp rope     herringbone gear        주파수

hierarchy and input-process-output chart(HIPO) hierarchy chart high alloy steel high carbon steel      

high expansion foam fire-extinguishing system

high frequency generator       high frequency motor generator 

high pressure feed water heater   high pressure steam pipe      high pressure turbine  high sea suction valve  고응력부high suction valve     high temperature cooling fresh water cooler   high temperature cooling fresh water pump    high temperature cooling water systemhigh temperature corrosion     high tension ignition   high tide       high titanic type       

Page 399: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

고속배출장치high viscous fluid 고점성유체high voltage test 내전압시험high water 만조high water level alarm 고수위경보higher strength steel 고장력강higher tensile steel 고장력강고스큐프로펠러highly stressed area 고응력영역high-speed craft 고속선

고속선안전증서고속내연기관

high-speed passenger ship 고속여객선고속회전속력계hinge 힌지

여닫이문hinged inside deadlight 현창안쪽덮개경첩이음경첩식타

유사실적선자료호브호빙기계호깅호이스트호이스팅드럼올림속력선창내장재창내보창내격벽창내용적창내디프탱크창내늑골창내내용골창내사다리

hold mass curves 화물질량곡선창내기둥창내기둥창내종통재스트링거hold watching step 화물창점검대창내물고임통holdback 홀드백holdback hook 개방고정용후크홀더holding capacity 지지력거치볼트holding load of windlass 양묘기유지하중파지력뒷댐해머holiday 도장누락부hollow 파저중공날개

high velocity vent      

Highly Skewed Propeller(HSP)high-order spectral/boundary element method

고차 스펙트럴/경계요소법high-speed craft safety certificatehigh-speed internal combustion engine 

high-speed tachometer 

hinged door    

hinged joint    hinged rudder  historical data for similar vesselhob    hobbing machine       hogging hoist   hoisting drum  hoisting speed hold batten    hold beam     hold bulkhead  hold capacity   hold deep tank hold frame     hold keelson   hold ladder    

hold pillar      hold stanchion hold stringer   

hold well       

holder 

holding down bolt      

holding power  holding up hammer     

hollow blade   

Page 400: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

중공문파저선중공기둥중공축갑판숫돌homogeneous loading 균일적하honeycomb core 벌집형 심재honing 호닝가공호닝기계hood 차양hook 훅갈고리도르래훅볼트갈고리스카프hoop 보강봉원환응력hopper 호퍼호퍼부선hopper cover 호퍼커버호퍼도어호퍼준설선적재토량계진흙적재통

진흙흡입관hopper tank 호퍼탱크수평지시등수평연결수평기관수평필릿용접수평거더수평연결

수평면운동시험수평용접

horizontal ring 수평링horizontal ring frame 수평 링 프레임수평롤러수평타수평접합horizontal shaft 수평보강재horizontal vibration 수평진동

수평진동방지장치수평파랑굽힘모멘트수평용접

horn 경적horn buzzer 경적버저

표시등붙이경적버저혼클리트말굽형추력베어링

hollow door    hollow line     hollow pillar   hollow shaft    holy stone     

honing machine 

hook block     hook bolt      hook scarf     

hoop stress    

hopper barge    

hopper door   hopper dredger hopper load indicator  hopper loading trough  

hopper suction pipe    

horizon indicating lamp horizontal coupling     horizontal engine       horizontal fillet welding horizontal girder       horizontal joint Horizontal Planar Motion Mechanism (HPMM) testhorizontal position of welding 

horizontal roller horizontal rudder       horizontal scarf  수평축horizontal stiffener     

horizontal vibration stopper    horizontal wave bending moment horizontal welding      

horn buzzer with a pilot lamp  horn cleat      horse shoe type thrust bearing 

Page 401: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

코킹끌hose 호스호스연결호스커플링살수기hose reel 호스감개

호스릴윈치호스릴형탄산가스소화기

hose rest 호스받침대호스서포트사수시험호스밸브hospital 병실병원선온기난방열기건조hot bulb 소구소구기관소구식점화hot coil 핫코일hot cracking 고온균열hot cracking test 고온균열시험hot forming 열간가공열간압연강열간압연적열취성hot spot mean stress 평균핫스폿응력 hot spot stress 핫스폿응력온수보일러

온수순환펌프온수난방온수관열수처리온수관장치

hot well 온수조온수탱크열간가공hot-pressed 열간가공하운드시간각항행시간선주기호버크라프트hub 허브허브캐비테이션허브지름허브비허브보텍스캐비테이션huge vessel light 대형선박표시등hull 선각hull 선체선체부가물

horsing iron    

hose connection hose coupling  hose director  

hose reel handling winch       hose reel type carbon dioxide fire extinguisher 

hose support   hose test      hose valve     

hospital ship   hot air heating hot air seasoning      

hot bulb engine hot bulb ignition       

hot rolled steel hot rolling     hot shortness  

hot water boiler        hot water circulating pump     hot water heating      hot water pipe hot water process      hot water service system      

hot well tank  hot working    

hound  hour angle     hours underway house flag     hovercraft      H-type filter    에이치(H)형여과기H-type strainer  에이치(H)형여과기hub cavitation  hub diameter   hub ratio       hub vortex cavitation   

hull appendage 

Page 402: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선각공장선체블록건조법

hull block painting 선각구조선체처짐선체붙이디스턴스피스선체효율hull fitting 선체의장선체의장공사hull form 선형hull form coefficienthull form design 선형설계hull form development 선형개발hull foulinghull girder 선체거더

선체굽힘강도hull girder inertia

선체전단강도hull girder strength 선체거더강도

선체수평굽힘강도hull line 선형hull monitoring system 선체상태감시장치선체고유진동수선체중립면선번hull openinghull outfit 선체평행부hull parts list 선각부재표hull penetration plans 선체관통부구조도hull pipinghull preservationhull scantling 선체치수선체횡단면계수선체붙이밸브선체부명세서hull steelhull strength 선체강도선체응력감시장치선체비틀림강도선체비틀림진동hull transverse section 선체횡단면

선체진동대수감쇠율선체진동응답선각중량선체귀선방식

human engineering 조습기hump 험프hump drag 험프저항험프속력추종장치hurricane 허리케인

hull assembly shop     hull block construction method 선체블록도장hull construction       hull deflection  hull distance piece     hull efficiency  

hull fitting work 

선형계수

선체오손hull girder bending strength     선체거더 단면2차모멘트hull girder shear strength      

hull horizontal bending strength 

hull natural frequency  hull neutral plane      hull number     선체개구선체의장hull parallel part       

선체배관선체보존hull section modulus   hull side valve     hull specification        선각강재hull stress monitoring systemhull torsional strength  hull torsional vibration 

hull vibration logarithmic decrementhull vibration response hull weight     hull-return system      인간공학humidistat      

hump speed    hunting gear   

Page 403: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

허리케인갑판폭풍용등hybrid approach 하이브리드기법hybrid VOF methodhydrant 소화전소화전상자hydrant valve 소화밸브hydraulic 유압hydraulic accumulator 유압식축압기유압커플링유압크레인유압실린더hydraulic dredger 유압 준설선유압동력계유압식변속장치hydraulic jack 유압잭hydraulic lift 유압기계hydraulic oil 유압작동유유압관유압파워유닛유압피스톤펌프hydraulic power pack 유압발생장치유압프레스수압유압램

유압감속장치유압리베터유압리베팅

hydraulic starting system 유압시동장치유압조타장치유압탱크hydraulic telemotor 유압텔레모터 수압시험

유압전동장치유압방아쇠유압윈치유체역학적평활면수력학

hydro elastic response 유탄성 응답수중조도계hydro pneumatic test 수상비행기hydrochloric acid

동유체전진각hydrodynamic force 동유체력

동유체력성분hydrodynamic pitch 동유체피치

동유체피치각hydrodynamic pressure 동적수압hydrodynamic pressure 유체동압력동유체스핀들토크

hurricane deck hurricane lamp 

하이브리드 VOF법hydrant box    

hydraulic coupling      hydraulic crane hydraulic cylinder      

hydraulic dynamometer hydraulic gear 

고소차hydraulic machine      

hydraulic oil pipe      hydraulic oil power unit hydraulic piston pump  

hydraulic press hydraulic pressure     hydraulic ram  hydraulic reduction gear       hydraulic riveter       hydraulic riveting      

hydraulic steering gear hydraulic tank  

hydraulic test  hydraulic transmission gear    hydraulic trigger       hydraulic winch hydraulically smooth surface   hydraulics      

hydro illuminometer      수압-공기압 시험hydroaeroplane  염산hydrodynamic flow angle       

hydrodynamic force components 

hydrodynamic pitch angle      

hydrodynamic spindle torque

Page 404: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

동유체스핀들토크계수동유체스핀들토크지수유체역학전동유압조타장치

hydrofoil 수중익hydrofoil craft 수중익선수중날개단면

수소포집기수소시험

hydrographic office 수로국 hydrographic services 수로업무수로측량하이드로키네터비중계하이드로날륨소수성수중청음장치hydrophore unit 압력탱크장치하이드로플레인하이드로스코프hydrostatic balance 유체정력학적평형배수량등곡선도정수압수압이탈장치정수압시험hygrometer 쌍곡선항법이력손실히스테리시스 아이빔ice accretion 착빙얼음앵커빙대쇄빙선냉장고ice class rules 내빙선규칙쇄빙기ice detection radar 빙하탐지레이더대빙이중외판대빙방현재대빙이중외판ice load 빙하중제빙기유빙감시선Ice resistance 빙저항ice sea 빙해아이스토크icebreaker 쇄빙선부동항제빙능력제빙기대빙구조화물선

대빙보강구조

hydrodynamic spindle torque coefficient hydrodynamic spindle torque indexhydrodynamics hydroelectric steering gear     

hydrofoil section       hydrogen collecting apparatus  hydrogen test  

hydrographic survey   hydrokineter  hydrometer    hydronalium    hydrophobic    hydrophone    

hydroplane     hydroscope    

hydrostatic curve      hydrostatic pressure   hydrostatic release unit hydrostatic test   습도계hyperbolic navigation   hysteresis loss hysteresis I-beam 

ice anchor     ice belt ice breaker    ice chamber    

ice crusher    

ice doubling    ice fender     ice lining       

ice making machinery       ice patrol      

ice torque     

ice-free-port  ice-making capacity    ice-making machinery       ice-strengthened cargo vesselice-strengthening construction  

Page 405: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이상받음각이상효율이상유동피아식별기식별부호유동기어

idle running 무부하운전idle time 유동바퀴idling 공회전점화성igniter 점화기점화캠ignition 점화ignition 발화소구착화지연착화지연점화플러그발화온도ignition source 발화원 발화온도

점화시기조정취류등

illumination 조명illumination level 침수부최대폭침하쐐기부

가상경계법방수복

immersion test 침지시험immersion time 주수대기시간IMO Resolution 국제해사기구 의정서

impact analysis

충격경도시험기impact load 충격하중충격시험충격시험기충격렌치impeller 임펠러임펠러상자임펠러상자imperfection 초기변형불투명피복충격부식implementation budget

외부전원식음극방식장치 impulse 충격충격소음충반동터빈

ideal angle of attack   ideal efficiency ideal flow      Identification Friend or Foe (IFF)identification signal     idle gear       

유휴시간idle wheel     

ignitability     

igniter cam    

ignition ball    ignition delay  ignition lag     ignition plug   ignition point   

ignition temperature    ignition timing adjustment      illuminated windsock   

조도immersed maximum beam      immersed wedge       Immersed-Boundary Method (IBM)immersion suit 

IMO ship identification number IMO 선박식별번호IMO tonnage    IMO 톤수영향분석impact hardness testing machine

impact test     impact testing machine impact wrench 

impeller box   impeller casing 

impervious sheath      impingement corrosion  실행예산Impressed Cathodic Current Protection (ICCP)

impulse noise  impulse reaction turbine 

Page 406: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

충동행정충동터빈충격력inboard 선체내측inboard opening 선내개방장치선내측면도안쪽회전내측축incandescent lampincendiary sparking 발화성스파크

초생캐비테이션수입사각소각기

incipient breaking waves 초기쇄파초생캐비테이션경사식파일타워경사사다리경사시험경사시험홈각도개재물불연성재료

incomplete penetration 불완전용입incompressible 비압축성incompressible flow 비압축성유동

안전증가방폭기기increased stud link 확장스터드링크

점증피치프로펠러

물때잠복영역indent 흠집압입시험독립빌지관

독립빌지흡입독립제어계통

independent point 독립 절점독립형탱크도시평균유효압력

indicated power 지시동력표시등레이더표시방식

indicator 지압기indicator 표시기 지압선도용지지압기콕지압선도

impulse stroke impulse turbine impulsive force 

inboard profile inboard rotation inboard shaft    백열등inception cavitation number    incident angle  incinerator     

incipient cavitation     inclinable pile driving tower    inclined ladder inclining experiment    inclining test   included angel inclusion       incombustible material  

increased safety apparatus     

increasing pitch propeller      incremental- iterative procedure 증분-반복절차incremental resistance coefficient for model-ship correlation   

모형선-실선상관저항증가계수incrustation    incubation zone 

indentation test independent bilge pipe independent bilge suction      independent control system

independent tank       indicated mean effective pressure

indicating lamp indication method of radar     

indicator card  indicator cock  indicator diagram 

Page 407: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

도시마력지시등지압기파이프간접형계측장치indirect labor cost 간접노무비개별난방유도통풍유도항력유도방사능induced stream 유기유동induction 유도브레이징유도가열유도전동기industrial engineeringinert gas cylinder 불활성 가스 용기inert gas deck-seal 불활성가스덱실

불활성가스덱실펌프불활성가스디미스터불활성가스송풍기

inert gas generator 불활성가스발생장치불활성가스용접불활성가스관

inert gas scrubber 불활성가스세척기불활성가스세척기해수펌프불활성가스소화장치불활성가스장치

inertia starter 관성시동기inertia force 관성력타력시험inertial pressure 관성압무한익렬가연한계가연성재료inflammable gas 가연성가스inflammable gas detector 가연성 가스 검출기인화점inflatable boat 팽창식보트팽창식구명뗏목

팽창식구명부기inflatable type lifejacket 팽창식구명동의inflated type rescue boat 팽창식구조정

정보검색 시스템InfraRed (IR) signature 적외선신호infrared ray

적외선추적장치ingot 잉곳잉곳강Ingress Protection (IP) 외피보호등급당김줄inherent weakness failure 고유결함고장inhibit circuit

indicator horse power  indicator lamp  indicator pipe  indirect gauging 

individual heating      induced draft   induced drag   induced radioactivity   

유도(감응)induction brazing       induction heating       induction motor  산업공학inert gas deck-seal water pump inert gas demister     inert gas fan   

inert gas metal arc welding     inert gas pipe  

inert gas scrubber sea water pumpinert gas smothering system   inert gas system       

inertia test     

infinite cascade inflammability limit     inflammability material 

inflammation point      

inflatable liferaft       inflatable type buoyant apparatus

information retrieval system

적외선InfraRed Search and Track (IRST)

ingot steel     

inhaul  

억제회로

Page 408: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

억제제초기설계initial loading condition 초기적하상태초기압력초기복원력초기변형률초기응력initial survey 최초검사initiating event 초기사건injection 분사분사캠injection interval 분사간격injection lag 분사지연분사손실injection time delay 분사지연injector 분사노즐내수면 선박inlet 흡입구inlet and discharge 흡입구와 배출구날개입구각흡입구흡입밸브in-line engine 직렬기관INMARSAT identities

내저종늑골내저판내측클램프

inner door 내측문내항inner hull 내측선각이너지브내측판내측축inner skin 내측외판내측판inorganic zinc silicate 무기질아연실리케이트in-process inspection 공정중검사공정중자재관리방충망문insert block 삽입블록insert plate 삽입판inshore race 내해경기inshore sailing 항내 항해내측덧판안쪽선실안지름캘리퍼스원형창속덮개내측랩안치수내측판inspection 검사제조후검사inspection certificate 검사증서검사뚜껑

제조중검사

inhibition       initial design   

initial pressure initial stability  initial strain    initial stress   

injection cam   

injection loss   

inland water ship      

inlet blade angle       inlet port      inlet valve     

국제해사위성통신장치 식별부호

inner bottom longitudinal       inner bottom plate    inner clamp    

inner harbor   

inner jib       inner plating  inner shaft     

inner strake    

in-process material controlinsect net door 

inside butt strap       inside cabin    inside calipers inside deadlight     inside lap      inside measure inside strake   

inspection after construction

inspection door inspection during construction

Page 409: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

관찰해치검유탱크검사원installation drawinginstallation manual 설치매뉴얼

유분순간배출률순간변형률런던보험자협회화물약관미국전기전자학회

instruction 지침서instruction manual 취급설명서지시판instrument 기기계기조명등instrumentationinstrumentation circuit 계측기회로insulated funnel 단열 연돌단열화물창방열재절연재절연거리

절연레벨감시절연저항절연시험

intact bulkhead 무개구 격벽intact condition 비손상상태비손상복원성intake duct 유입관흡입다기관integral tank 일체형탱크

통합선교시스템integrated components 통합구성요소

통합군수지원통합항해시스템적분기휘도조정손상도상호작용전자화문서대화식언어호환성중간복수기중간접속피더연결관연결밸브

interconnector feeder 중간접속피더중간냉각기중간냉각intercostal 단절판

inspection hatch inspection tank inspector        설치도instantaneous rate of discharge of oil content  instantaneous strain    Institute Cargo Clauses (ICC)Institute of Electrical and Electronic Engineers (IEEE)

instruction plate 

instrument light  계장insulated hold  insulating material      insulating material      insulation distance     insulation level monitoring deviceinsulation resistance   insulation test  

intact stability  

intake manifold 

integrated bridge system (IBS)

Integrated Hull, Outfitting and Painting (IHOP)

선각·의장및 도장 종합관리Integrated Logistic Support (ILS)Integrated Navigation System (INS)integrator      intensity control intensity of damage    interaction     Interactive Electronic Technical Manual (IETM)interactive language    interchangeability      intercondenser inter-connecting feeder interconnection pipe    interconnection valve   

intercooler     intercooling    

Page 410: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

단절부재상호간섭점검interface management 인터페이스관리부분노출프로펠러interference 간섭interference fitting 억지끼워맞춤인터그래프interim-product 중간제품연동안전장치연동안전장치중간보intermediate flat 이중판중간늑골

중압실린더중압터빈

intermediate shaft 중간축중간축베어링중간차단밸브중간검사불연속캐비테이션

intermittent chain welding 단속체인용접intermittent failure

단속필릿용접intermittent operation 단속 사용

단속지그재그형용접단속용접간헐식폭기장치내부부력

internal canopy light 실내등internal combustion engine 내연기관

내연기관선선내통신장치

internal diameter 안지름내부효율내부확대기내부 관성압력내부제트internal loss factor 내부손실계수안쪽증기관내부응력

국제대기오염방지증서국제선급연합회

intercostal member     Inter-Discipline Check (IDC)

interface propeller     

intergraph      

interlock arrangement  interlocking gear       intermediate beam     

intermediate frame     intermediate pressure cylinderintermediate pressure turbine  

intermediate shaft bearing      intermediate stop valve Intermediate Survey (IS)   intermittent cavitation  

간헐고장intermittent fillet welding       

intermittent staggered weldingintermittent welding    intermittent-hydraulic-gun-aeratorinternal buoyancy      

internal combustion engine ship internal communication equipment

internal efficiency      internal expander      internal inertial pressure internal jets    

internal steam pipe     internal stress International Aeronautical & Maritime Search & Rescue (IAMSAR) Manual

국제 항 공·해 상 수색 및 구 조 지침

International Air Pollution Prevention (IAPP) CertificateInternational Association of Classification Societies(IACS)

Page 411: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

국제독립탱커선주협회국제원자력기구국제해운회의소국제민간항공기구

국제 액화가스 산적운반선 코드

국제고속선코드국제신호서해양오염방지협약

해상인명안전협약

어선의안전에관한국제협약

국제톤수협약국제전기기술위원회

국제용접학회국제노동기구국제구명설비코드국제만재흘수선증서국제만재흘수선협약국제만재흘수선면제증서국제해상위험물코드국제해사기구

International Association of Independent Tanker Owners (INTERTANKO)International Atomic Energy Agency (IAEA)International Chamber of Shipping (ICS)International Civil Aviation Organization (ICAO)International Code for the Construction and Equipment of Ships carrying Dangerous Chemicals in Bulk (IBC)

국제 위험화학품 산적운반선 코드

International Code for the Construction and Equipment of Ships Carrying Liquefied Gases in Bulk(IGC)International Code of Safety for High Speed Craft (HSC)international code of signal    International Convention for the Prevention of Pollution from Ships (MARPOL) International Convention for the Safety of Life at Sea(SOLAS)International Convention on Safety of Fishing Vessels(1977) International Convention on Standards of Training Certification and Watchkeeping for Seafarers (ITCW)

선원의 당직·교육 및 훈련에 관한 협약

International Convention on Tonnage Measurement of shipsInternational Electrotechnical Commission(IEC) International Hydrographic Office (IHO) 국제수로기구International Institute of Welding (IIW)International Labor Organization (ILO)international Life Saving Appliance (LSA) codeInternational Load Line CertificateInternational Load Line Convention (ILLC)International Load Line Exemption Certificate  International Maritime Dangerous Goods (IMDG) CodeInternational Maritime Organization(IMO)

Page 412: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

국제도선사협회국제해사위성통신장치국제복합운송국제나브텍스업무국제기름오염방지증서국제표준화기구국제무선통신자문위원회국제해상충돌예방규칙

국제하수오염방지증서

국제선박해양구조회의국제선박및항만시설보안코드국제안전관리코드국제선박관리자협회국제선주협회국제육상시설연결구국제신호기국제통신연맹국제수조회의국제해상보험연합국제항해

interpolation methodinterpole 보극

단속지속파단속급섬광단속점용접인터스캔단간밸브인터스위칭

intrinsic safety barrier 본질안전 배리어intrinsically safe

International Maritime Pilots' Association (IMPA)INternational MARitime SATellite communication apparatus(INMARSAT)International Multimodal Transport (IMT)international NAVTEX service  International Oil Pollution Prevention (IOPP) CertificateInternational Organization for Standardization(ISO) International Radio Consultative Committee (CCIR)International Regulations for Preventing Collisions at Sea (COLREG) International Sewage Pollution Prevention (ISPP) CertificateInternational Ship and Offshore Structures Congress(ISSC) International Ship and Port Facility Security (ISPS) CodeInternational Ship Management (ISM) Code International Ship Managers' Association (ISMA)International Shipowners' Association (INSA)international shore connection  international signal flag International Telecommunication Union (ITU)International Towing Tank Conference(ITTC) International Union of Marine Insurance(IUMI) international voyage     보간법Interrupted Continuous Wave(ICW)interrupted quick flashing light interrupted spot welding       interscan       interstage valve inter-switching 

본질안전

Page 413: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

본질안전방폭기기본질안전회로

invar 인바강inventory 비품목록inventory carrying cost 재고유지비용inventory controlinventory holding cost 재고유지비용inventory requirement 재고소요량역시한

인버터정밀주조invoice 송장송장면중량인벌류트톱니안쪽회전iron cast 주철주조공장철선철재중실기둥irregular variation 불규칙변동irregular wave 불규칙파비가역기관비회전유동이셔우드식등압팽창등시성조속기등시성횡동요등엔트로피효율isoentropic expansion 등엔트로피팽창isolating transformerisolating valve 차단밸브isometric drawing 등온변화등온압축등온팽창등온선중량구분jack 선수기jack bolt 잭 볼트줄사다리잭나사선수깃대jacket 재킷

재킷냉각청수냉각기재킷냉각청수펌프잭스테이

jack-up test 줄사다리잼너트잼리베터일본표준공업규격제트캐비테이션

intrinsically safe apparatus     intrinsically safe circuit 

재고관리inverse time limit      inverted angle  엘(L)형강inverted Y-type column  역와이(Y)형기둥inverter investment casting     

invoice weight involute tooth  inward rotation 

iron foundry   iron ship       iron solid pillar 

irreversible engine     irrotational flow Isherwood system      isobaric expansion     isochronous governor  isochronous rolling     isoentropic efficiency  

절연변압기입체도면

isothermal change      isothermal compression isothermal expansion   isothermal line itemize of weight      

Jack ladder    jack screw     jack staff      

jacket cooling fresh water coolerjacket cooling fresh water pumpjackstay  잭-업 시험Jacob's ladder jam nut jam riveter     Japanese Industrial Standard (JIS)jet cavitation   

Page 414: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

제트복수기제트기관제트노즐제트프로펠러제트추진제트펌프제트추력jet type 분무식화물비상투기돌출제방볼들이도르래jib 지브지브붐지브크레인jib foil 지브 날개jib furler 지브 감개지브핼리어드지브돛jib sheet 지브시트jib sheet leader 지브 조정줄 리더jib sheet track 지브 조정줄 궤도지브당김줄jig 지그jig and fixture 지그 및 고정구선광장치지거붐지거개프지거마스트joggling 턱붙임턱붙임 겹침이음턱붙임기계joiner 정밀목수선실목공도정밀목공사연결용섀클연결함joint detail 이음부상세이음효율joint length 이음부길이joint preparation 이음부개선joist 조이스트주코스키프로파일journal 저널저널베어링조이스틱중량물데릭붐jumboization 점프소기불꽃점화수평당김줄점핑스토퍼junction box 접속상자삼각주부표하급사관정크대용마스트

jet condenser  jet engine      jet nozzle      jet propeller   jet propulsion  jet pump       jet thrust      

jettison jetty   jewel block    

jib boom       jib crane       

jib halyard     jib sail 

jib stay 

jig drive       jigger boom    jigger gaff     jigger mast    

joggling lap joint    joggling machine       

joiner plan     joiner work    joining shackle joint box       

joint efficiency 

joint time-frequency analysis method 시간-주파수 해석법Joukowski profile      

journal bearing joy stick       jumbo boom     선박연장개조jump scavenging       jump spark ignition     jumper stay    jumping stopper 

junction buoy  junior officer   junk   jury mast      

Page 415: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

대용타jute 황마

와유량계카르만와류KC1 type membrane 한국형멤브레인화물격납설비

작은닻keel 용골선저직선보기용골굽힘기계용골반목keel boat 용골보트용골경사keel laying 용골거치keel laying block 최초탑재블록용골선킬피스keel plate 평판용골선저직선보기keel wing 용골날개내용골keep 누름쇠누름판부활켈리켈빈소스켄터섀클kerf 커프kerf allowance 절단부절취량kerosine 등유케치Keulegan-Carpenter numberkey 키key coil 키코일key plan

키홈파기밀링기키홈절삭기키붙이프로펠러

keyhole 키홀키리스프로펠러키홈바깥밀린거리킬드강kinematic viscosity 동점성운동학키네틱공기펌프키네틱펌프키네틱탱크kingpost 킹포스트킹스톤밸브kink 꼬임kitchenette 간이취사장키친식타

jury rudder    

K groove       케이(K)형홈Karman vortex flow meter     Karman vortex 

kedge anchor  

keel alignment keel bender    keel block     

keel grade     

keel line       keel piece     

keel sight      

keelson 

keep plate     keep-alive     kelly   Kelvin source  kenter shackle 

ketch   크리건-카펜터수

기본도key seating milling machine    key way cutting machine       keyed propeller 

keyless propeller       keyway      kick    killed steel     kind 1 shaft     제1종축kind 2 shaft     제2종축kinematics     kinetic air pump       kinetic pump   kinetic tank    

kingston valve 

Kitchen's rudder      

Page 416: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

클라이스트론knee 니니라이더나이프스위치나이트헤드녹오프노킹노트매듭지식습득지식베이스지식공학

지식표현knuckle 너클너클이음너클선너클몰딩knuckle point 너클포인트

한국무선국관리사업단한국산업규격한국선급한국수조회의코트노즐주코스키프로파일

labor costlaboratory 래빌린스더미래빌린스팩킹labyrinth seal 래비린스 씰레이싱그로밋누름쇠lack of fusion 융합부족lack of oxygen 산소결핍ladder 사다리사다리갠트리사다리웰사다리윈치사다리와이어로프laden voyagelagging 래깅늦은전류래깅재호수기선Lambda ratio 람다비lamellar tearing 라멜라균열층류경계층얇은층캐비테이션laminar flow 층류유동층류저층laminate reference 적층기준합판선적층lamp 전등

klystron 

knee rider     knife switch    knight head    knock off      knocking       knot   knot   knowledge acquisition  knowledge base knowledge engineering knowledge representation      

knuckle joint   knuckle line    knuckle molding 

Korea Radio Station Management Agency (KORA)Korean Industrial Standard (KS)Korean Register of Shipping (KR)Korean Towing Tank Conference (KTTC)  Kort nozzle    Kutta-Joukowski profile  노무비실험실labyrinth dummy       labyrinth packing       

lacing grommet lacing wire     

ladder gantry  ladder well     ladder winch   ladder wire rope        적하항해lagging current lagging material lake steamer   

laminar boundary layer laminar cavitation      

laminar sublayer       

laminated wooden ship lamination      

Page 417: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

등소켓육상보일러육상기관육상시운전상륙용주정중형상륙정대형상륙정비행갑판다목적 강습상륙함헬기상륙 강습함

Landing Ship Dock (LSD) 도크형 양륙함Landing Ship Tank (LST) 상륙함상륙용주정랜딩랭식꼼랜야드lap joint welding 겹치기 이음 용접lapped joint 겹침 연결lapping 랩핑대관형보일러laser class 레이저 급laser machining 레이저 가공lashing 래싱

축자유회전방지장치래싱줄

lashing wire 래싱줄latch 걸쇠latent defect 잠열투영측면적횡굽힘lateral buckling mode 면외좌굴모드횡수축가로힘lateral load 면외하중lateral load 횡하중면외압력lateral stability 횡방향안정성수중측면적lateral vibration 횡진동lathe 선반선반척북극성위도법위도오차래티스launch 주정launch preparations

착수양수장치launching 진수launching appliance 진수장치진수용 부선진수계산

lamp socket    land boiler     land engine    

land trial       

landing craft   Landing Craft, Mechanized (LCM)Landing Craft, Utility (LCU)landing deck   Landing Helicopter Dock (LHD)Landing Platform Helicopter (LPH)

landing ship    landing Lang's lay    lanyard 

large tube type boiler  

lashing gear for propeller free rotation lashing line    

잠재불량latent heat     lateral area    lateral bending 

lateral contraction      lateral force   

lateral pressure 

lateral underwater area 

lathe chuck    latitude by pole star   latitude of error lattice  

진수준비launch/retrieval system       

launching barge launching calculation   

Page 418: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

진수식launching cradle 진수크래들진수곡선진수드래그진수치수진수식대진수대진수중량laundrylavatory 비교법칙상사법칙꼼조선현도화법계선lead 납납피복선납망치측심줄lead storage battery 납축전지lead time 납땜줄납피복leader 리더leading block 유도도르래leading chain 유도체인leading edge 앞날leading marks 유도표leadman's platform 측심대leak detectionleak stopper 누설멈추개leak test 기밀시험누설배출손실레지판lee board 옆밀림 방지판lee helm 선수밀림lee side 풍하측leech 리치리치라인리치로프풍하측풍압변위왼편꼬임좌회전프로펠러left-handed screw 왼나사leg length 필릿용접의다리leg size 용접각장

수선간길이프루드의길이계수갑판보받침팔길이갑판보받침팔길이

length of the weld deposit 용착부길이수선상길이전장

launching ceremony    

launching curve launching drag launching particulars   launching platform     launching way  launching weight        세탁실화장실law of comparison     law of similarity       lay     laying off      lay-up 

lead covered wire      lead hammer   lead line       

조달기간lead wire      lead-alloy-sheathing   

누설탐지leak-off leaving loss    ledge plate     

leech line      leech rope     leeward side   leeway left hand lay   left-handed propeller   

용접각장leg of fillet weld       

Length Between Perpendiculars (LBP)length coefficient of Froude    length of beam arm    length of side arm     

length on water line   Length Over All(LOA)

Page 419: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

lengthening 선체연장개조닻연결체인렌즈반사기투묘lethal gas 유독가스Letter Of Credit (LOC)

Letter Of Intent (LOI) 발주 의향서액면조절기

level gauge 액면계액면계기판다목적크레인레벨스위치lever safety valve 지레식안전밸브leverage 지렛대비lie to 라이투

구명정승강시험구명부환

life cycle 라이프사이클life jacket 구명동의life jacket light 구명동의등구명동의용선반라이프재킷life ring 구명부환life vest 구명동의lifeboat 구명정구명정 비품

공기자급식구명정lifeline 구명줄liferaft 구명뗏목구명설비lifesaving equipment 구명설비lifesaving signal 구명신호lift 승강기liftlift 활대줄선미부양양력계수lift fan 부양송풍기흡입펌프lifting appliance 하역장치달아올림보달아올림볼트밸브개폐장치lifting guide 달아올림안내기구보트걸이훅lifting lug 탑재용 러그달아올림볼트

리프트온/리프트오프 방식ligament efficiency 리가먼트효율light 등경합금선등표

lengthening piece      lens reflector  let go anchor  

신용장

level controller 

level gauge board      level luffing crane     level switch    

life boats throwing and lowering test   life buoy       

life jacket rack life preserver  

lifeboat equipment     lifeboat with a self-contained air support system

lifesaving appliance   

양력lift by the stern    lift coefficient  

lift pump       

lifting beam    lifting bolt     lifting gear     

lifting hook    

lifting screw   lift-on/lift-off system(LO/LO system) light alloy ship       light beacon    

Page 420: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

등부표연속경용접light displacement 경하배수량Light Emitting Diode (LED) 발광 다이오드light gas oil 경유light line speed 라이트 라인 속력경금속선경유탱크경구조선light ship draft 경하흘수light ship weight 경하중량light welding 경용접lightening 경감lightening hole 경감구멍

래시선경부선

lightest forward draught 최소선수흘수lighthouse 등대등대표등대관리선lighting fitting 조명기구lighting system 조명장치lighting unit 조명장치피뢰기피뢰침피뢰기피뢰기피뢰기lightship 등대선lightweightlightweight distribution 경하중량 분포도리그넘바이티limber 림버림버보드limber hole 오수구측내후판limit gauge 한계게이지탄성한도limit of proportionality 비례한도제한링limit state 한계상태limit switch 리미트스위치limited earth system 한정적 접지장치limiting mean draft 한계평균흘수line balancing 공정간 균형화주낙줄감개선상가열line segment 선분구명줄발사기linear cumulative damage 선형누적손상linear expansion 선팽창선팽창계수리넨실정기선lines 선도lines plan 선도lining 라이닝

light buoy      light continuous welding 

light metallic ship      light oil tank   light scantling vessel   

Lighter Aboard SHip(LASH) lighter barge   

lighthouse list  lighthouse tender      

lightning arrester      lightning conductor     lightning discharger    lightning guard lightning protector     

경하중량lignum vitae     

limber board   

limber strake  

limit of elasticity       

limit ring       

line hauler     line heating    

line throwing appliance 

linear expansion coefficientlinen locker    liner   

Page 421: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

라이너link 링크링크운동텀블러스위치링크운동linoleumlip seal 립 실liquefaction 액화liquefied gas 액화가스liquefied gas carrier 액화가스운반선액화천연가스액화석유가스액체화물액체나침반액정표시장치liquid fuel 액체연료liquid gasket 액체 개스킷liquid oxygen 액화산소liquid penetrant test 액체침투탐상시험액체가감저항기list 횡경사

리스트프로그래밍청음봉

live 대전활어운반선활하중livestock carrier 가축운반선living quarter 거주구역

액화천연가스운반선

LNG spray pump 엘엔지 스프레이펌프LNG tanker 액화천연가스운반선LNG vaporizer 엘엔지 기화기load 부하load 하중

하중저항계수설계load balancing 하중계산점load carrying direction 하중전달방향load case 하중상태load combination 하중조합하중조합계수하중곡선load cycle 하중반복속도적재흘수load evening 부하 평준화

lining piece    

link motion     link switch     link work       리놀륨

Liquefied Natural Gas (LNG)Liquefied Petroleum Gas (LPG)liquid cargo    liquid compass Liquid Crystal Display (LCD)

liquid rheostat 

list programming(LISP) listening rod   

live fish carrier live load       

Lloyd's Register of Shipping (LR) 영국선급LNG carrier    LNG Floating Production Storage and Offloading 엘엔지 FPSOLNG Floating Storage and Offloading Unit 엘엔지 FSOLNG Floating Storage Regasification Unit 엘엔지 FSRULNG Regasification Vessel (LNG-RV) 엘엔지 RVLNG Shuttle and Regasification Vessel 엘엔지 SRV

load and resistance factor design 부하평준화Load Calculation Point (LCP)

Load Combination Factor (LCF)load curve     

load draft      

Page 422: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

부하계수부하율부하지시계load leveling 부하 평준화load line 만재흘수선만재흘수선지정만재흘수선증서만재흘수선원표식load line length 건현용길이만재흘수선표시load scenario 하중시나리오load shedding 부하차단장치 load water line 만재흘수선load-carrying capacity 하중부담능력load-end shortening curves 평균응력변형률곡선loading 적하 loading breadth 하중폭적하검사증명서적하지침기기적하상태loading equipment 하역설비적하지침기기적하지침서loading rate 적하속도loading station 로딩스테이션적하검사로비로브

근거리통신망기측제어

local detail 국부상세local displacement vector 국부변위벡터local lift coefficient 국부양력계수local static load 국부정하중국부강도local support stiffener 국부지지보강재local system 국부계국부진동국부중량locally earth system 국부접지장치locating 수색멈춤너트자물쇠붙이콕locked rotor 회전자구속locked-in stress 갇힌응력locking bar 로킹바로킹레버로킹핀틀로킹축로징니loft 현도현도공log 거리계log carrier 목재운반선로그줄

load factor     load fraction   load indicator  

load line assignment   load line certificate    load line disc  

load line mark 

loading certificate      loading computer       loading condition       

loading instrument     loading manual 

loading survey lobby  lobe   

Local Area Network(LAN) local control   

local strength  

local vibration  local weight    

lock nut locked cock    

locked train type reduction gear

듀얼탠덤아티큘레이티드형감속장치

locking lever   locking pintle  locking shaft   lodging knee   

loft man       

log line 

Page 423: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

대수속도대수감쇠율항해일지정지각장거리식별추적시스템

long and short armed floor 장단식늑판장단식늑골방식장선교루장염탄장늑판늑골장선수루장거리국제항해

long lead time material 장기납기자재주낙어선장선미루로란장파정불규칙파장파정파longitudinal (LONGI.) 종통재종방향보longitudinal bulkhead 종격벽종격벽판

종부심종중심세로이송컨베이어종늑골종늑골식구조선체종굽힘강도종이음선종부재종메타센터

longitudinal space (L.S) 종통재간격종안정성종보강재종강도종늑골식구조종진동선상하역작업장long-term effectslong-term response 장기응답

장기응력빈도분포곡선looking after 선미방향으로 봄looking forward 선수방향으로 봄망보기죔손실루프소기법조립식날개헐거운볼트헐거운커플링헐거운맞춤

log speed      logarithmic decrement  logbook loll     Long - Range Identification and Tracking (LRIT) system

long and short armed floor systemlong bridge    long flame coal long floor frame       long forecastle long international voyage       

long liner      long poop      LOng RAnge Navigation (LORAN)long-crested irregular waveslong-crested seas      

longitudinal beam      

longitudinal bulkhead plateLongitudinal Center of Buoyancy (LCB)Longitudinal Center of Gravity (LCG)longitudinal conveyor   longitudinal frame      longitudinal framing system    longitudinal hull girder bending strength   longitudinal joint seam longitudinal member    longitudinal metacenter 

longitudinal stability    longitudinal strake     longitudinal strength   longitudinal system     longitudinal vibration   longshoreman   장기효과long-term stress distribution curve

lookout loop loss       loop scavenging loose blade    loose bolt      loose coupling loose fit       

Page 424: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

치수조정관들판조립식날개

로란해도로란수신기loran receiver 로란수신기로란수신기로란국로란방식로란표loss factor 손실계수

부력소실법통풍능력상실 부력소실법소멸에코소멸에코헛돌기소멸에코

lounge 라운지louver 루버low level alarm 저액면경보저합금강저탄소강Low Cost Automation (LCA) 간이자동화low cycle fatigue 저사이클피로low cycle load 저사이클하중low duty gas compressor 저압가스압축기저수소계

저압식탄산가스소화장치저압급수가열기

low pressure heater 저압가열기저압증기발생기저압증기발생기보조급수펌프저압증기발생기복수기저압증기발생기드레인냉각기저압증기발생기급수펌프저압증기관

low pressure turbine 저압터빈하부해수흡입밸브하부흡입저온냉각청수냉각기저온냉각청수펌프저온취성저온응력제거

loose pipe     loose plate     loose propeller blade   loran A  로란에이(A)loran C  로란시(C)loran chart     loran indicator 

loran receiver indicator loran station   loran system   loran table     

loss of buoyancy method       loss of ventilation capacitylost buoyancy method  lost constant   lost echo      lost motion     lost target     

low alloy steel low carbon steel       

low hydrogen type     low pressure carbon dioxide fire extinguishing system low pressure feed water heater

low pressure steam generatorlow pressure steam generator auxiliary feed water pump   low pressure steam generator condenser       low pressure steam generator drain cooler     low pressure steam generator feed water pump   low pressure steam pipe       

low sea suction valve  low suction    low temperature cooling fresh water cooler    low temperature cooling fresh water pump     low temperature embrittlement low temperature stress relieving

Page 425: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

저온용접간조저압전지방식

low water 저수위저수위경보lower attached plate 하부 부착판하층선교저위발열량lower control limit 관리하한선하층갑판삼각주하단부표lower explosion limit 폭발하한계폭발하한계lower frequency 하한주파수하부용골하부마스트저차진동하부당김줄하부슈라우드하부스테이lower strake 하부판하부톱갤런트돛하부톱갤런트가로막대lower topsail 하부톱세일하부톱세일가로막대하부텀블러만곡부하부하부중갑판하부가로막대low-location lighting 유도등액화석유가스운반선액화석유가스운반선

윤활제윤활장치lubricating oil 윤활유윤활유냉각기

윤활유더티탱크윤활유드레인탱크윤활유여과기윤활유중력탱크윤활유관윤활유프라이밍펌프윤활유펌프윤활유청정기윤활유예비탱크윤활유잔류탱크윤활유침전탱크

low temperature welding       low tide low voltage battery system    

low water alarm       

lower bridge   lower calorific value   

lower deck     lower end buoy 

Lower Flammable Limit (LFL)

lower keel     lower mast     lower mode vibration   lower rigging  lower shroud   lower stay     

lower topgallant sail   lower topgallant yard  

lower topsail yard     lower tumbler  lower turn of bilge     lower 'tween decks   lower yard     

LPG carrier LPG tanker L-type filter    엘(L)형여과기L-type strainer  엘(L)형여과기lubricant       lubricating device      

lubricating oil cooler   lubricating oil dirty tank       lubricating oil drain tank       lubricating oil filter    lubricating oil gravity tank     lubricating oil pipe     lubricating oil priming pump    lubricating oil pump    lubricating oil purifier  lubricating oil reserve tank     lubricating oil residue tank     lubricating oil settling tank     

Page 426: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

윤활유슬러지탱크윤활유저장탱크윤활유여과기윤활유섬프탱크윤활유탱크윤활유이송펌프윤활펌프윤활고리

lubricatorluff 러프러프태클luffing crane 러핑크레인luffing cylinder 러핑 실린더러핑대빗lug 러그세일러그고착

소화물러거러그세일lumber 목재목재운반선목재건현목재적재항lump-sum contract 총액계약불규칙최대횡경사각마하수machinability 절삭성machine down time 기계중단기간

기계상태감시장치machine oil 기계유machine scheduling plan 기계일정계획machine shop 기계공장공작기계machine utilization table 기계이용표기관실배치도기관기본설계기관실위벽machinery control position 기관제어장소 기관상세설계machinery fitting 기관의장기관의장설계기관의장품

기관기능설계기관초기설계

machinery installation 기계설치machinery lay-up

기관생산설계machinery space 기관구역

기관실구멍

lubricating oil sludge tank      lubricating oil storage tank lubricating oil strainer  lubricating oil sump tank   lubricating oil tank     lubricating oil transfer pump   lubricating pump    lubricating ring      주유기luff tackle      

luffing davit    

lug connection lug piece        단 엘(L)형재luggage room  lugger lugsail 

lumber carrier lumber freeboard       lumber port    

lurch   Mach number  

machine health monitoring system

machine tool   

machinery arrangement (M/A)machinery basic design machinery casing      

machinery detail design 

machinery fitting design machinery fittings      machinery function design      machinery initial design 

기계장기휴지machinery product design      

machinery space of category A A류 기관구역machinery space opening       

Page 427: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

기관구역무인운전기관구역무인운전시험

machining allowance

마킨타이어식이중저육안시험

magazine 화약고자기탐상검사탄산마그네슘단열재

magnet crane 전자석기중기자기쏠림magnetic clutch 전자석식클러치magnetic compass 자기나침반자기컴퍼스자동조타장치자침로자기댐퍼magnetic field 자기장자석기름거르개

자분탐상시험 magnetic particle test 자분탐상시험 magnetic signature 자기신호자기변형률자기변동자석발전기

자기탐사선자기센서자기변형식마그네트론처녀항해마이어선형우편선우편기우편실우편기선주공기압축기주공기이젝터주공기탱크주앵커주밸러스트탱크주베어링빌지주관주보일러주격벽

main busbar 주모선주체인주순환펌프주복수펌프주복수기main control console 주갑판디젤주기관main dimensions 주요치수

machinery space unmanned operationmachinery space unmanned operation test       기계가공여유MacIntyre system double bottommacroscopic test       

magnaflux inspection   magnesium carbonate heat insulating material  

magnetic blow 

magnetic compass pilot magnetic course       magnetic damper       

magnetic oil strainer   Magnetic Particle Inspection (MPI)

magnetic strain magnetic variation      magneto   magnetometric sensing vessel  magnetometric sensor  magneto-striction type magnetron     maiden voyage Maier form     mail boat      mail flag       mail room      mail steamer   main air compressor   main air ejector main air reservoir      main anchor    main ballast tank       main bearing   main bilge pipe main boiler     main bulkhead 

main chain     main circulating pump  main condenser pump  main condenser  주제어반main deck     main diesel engine     

Page 428: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

주드레인관주조명장치주전원

main engine 주기관주기보조송풍기주기연료유가열기주기실주급수체크밸브주급수펌프주급전선주력함대정늑골재주가스터빈주대톱니바퀴

main generating station 주발전장소main generator 주발전기

주발전기용디젤기관주권장치주선체주분사밸브

main machinery seating 주기관베드주마스트주관main plate 주전원main propulsion machinery 주추진기관

주무선전신설비주감속장치

main sail 주돛main shaft 주축main sheet 주조정줄main sheet traveler 주조종줄 트래블러주전원 주시동밸브메인스테이main steam 주증기주증기관주증기터빈주조타장치주막음밸브주개폐기주배전반메인톱마스트주터빈주수직구역주대톱니바퀴mainsail 메인슬메인슬핼리어드maintainability 정비용이성

main drain pipe main electric lighting system   main electric power source    

main engine auxiliary blower   main engine fuel oil heater     main engine room      main feed check valve main feed water pump     main feeder    main fleet      main frame    main gas turbine       main gear wheel       

main generator diesel engine   main hoisting gear     main hull       main injection valve    

main mast     main pipe       주판main power supply     

main radiotelegraph installation main reduction gear    

main source of electric powermain starting valve     main stay      

main steam pipe       main steam turbine     main steering gear     main stop valve main switch    main switchboard      main top mast main turbine   main vertical zone     main wheel    

mainsail halyard 

Page 429: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

정비수리팀maintenance and supply 정비 및 보급maintenance hatch 정비용해치maintenance of class 선급유지maintenance preventionmaintenance scheme 근해구역major conversion 주요개조maker drawing 제조자도면제조자발행증명서make-up feed 보충급수보충급수관현장맞춤관 부급수밸브make-up waterMalaccamax 말라카맥스malfunction 고장malleability 가단성가단주철mallet 맬릿man power 인력

경영정보시스템물막이맨드렐조종신호등조종성

maneuvering 조종maneuvering air 조종용공기조종용공기압축기

조종용공기탱크maneuvering arrangement 조종장치maneuvering condition 조선상태조종장치maneuvering light 조종신호등maneuvering performance 조종성능조종석maneuvering test 조종성시험조종밸브망간청동manhole 맨홀manhole cover 맨홀 덮개누적시수계획적하목록manifold 매니폴드매니폴드밸브마닐라로프머니퓰레이터manrope 울타리줄

maintenance and repair team

보전예방정비계획major coasting area    

maker's certificate    

make-up feed water pipe      make-up pipe  make-up valve  보충수

malleable cast iron     

Management By Objectives (MBO) 목표관리Management Information System (MIS)manager board mandrel 

maneuver light 

maneuverability 

maneuvering air compressor   maneuvering air reservoir      

maneuvering gear      

maneuvering platform  

maneuvering valve     manganese bronze     

man-hour cumulative manifest       

manifold valve Manila rope    manipulator    manometer      유(U)자관압력계

Page 430: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

울타리줄수동경보장치수동제어

manual cranking 수동크랭킹manual cutting 수동절단

수동식화재경보장치manual intervention 수동조작 manual operation 수동운전manual starting 수동시동수동용접수동화재경보장치manufacture drawing 공장시험manufacturing lead time 제작소요기간마르코니형범장마르코니형캣마르코니형케치마르코니형슬룹마르코니형욜한계선목갑판끝판margin plate 마진판marine accident 해난사고선박용보일러선박용탄Marine Diesel Oil (MDO) 해상용디젤연료유marine engineer 선박기관사marine environment 해양환경marine evacuation system 해상탈출설비선박용풀

해양생성물부착방지장치marine pollutants 해양오염물질marine pollution 해양오염항해용레이더인양선대해양관측부이

선박오물처리장치해저지층탐사장치선박분뇨처리장치선박용터빈

mariner 선원미국해사청관해관청해난심판소해양환경보호위원회

manrope rove  manual alarm system manual control 

manual fire alarm system      

manual welding manually operated call 제작도면manufacturer's test   

Marconi rig    Marconi rigged cat     Marconi rigged ketch  Marconi rigged sloop   Marconi rigged yawl   margin line     margin plank   

marine boiler  marine coal    

marine glue    marine growth preventing equipment

marine radar   marine railway marine research buoy  marine sanitation device       marine seismic profiling system marine sewage treatment systemmarine turbine 

Maritime Adiministration (MARAD)Maritime Authority     Maritime Disaster Inquiry AgencyMaritime Environment Protection Committee (MEPC)

Page 431: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

해사이동통신식별번호해사이동통신위성 해사안전위원회해사안전정보 해사위성통신

MARK III 마크라인Marker-Density Method 밀도표함수법말린스파이크맞당김식하역법쐐기블록마르텐사이트martingale 마팅게일마팅게일스테이masking tape 도장보호테이프mass 질량질량밀도mast 마스트마스트구멍테마스트덮개

마스트색페인트mast head rig 전범장

마스트뿌리마스트구멍테마스트고리마스트하운드마스트밑방마스트등마스트구멍마스트경사마스트밑판마스트테이블마스트쐐기

master 선장주나침반비상부서배치표마스터로그

master schedule 주 일정계획주전파국주밸브주대톱니바퀴masthead light 장등masthead riser 마스트헤드라이저항해사material class 재료사용구분material deficiency report 자재결함보고서material factor 재료계수material grade 재료등급

Maritime Mobile Service Identification Number (MMSI)maritime mobile-satellite serviceMaritime Safety Committee (MSC)maritime safety informationmaritime satellite communication 마크3형 멤브레인mark line      

marlinespike   married fall method    marrying wedge martensite     

martingale stay 

mass density   

mast (hole) collar    mast coat      mast color paint       

mast heel      

mast hole collar    mast hoop     mast hounds   mast housing   mast light      mast opening  mast rake      mast step      mast table     mast wedge    

master compass 

master list     master log     

master station master valve   master wheel  

mate   

Page 432: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

material handling 자재취급운반material inspection 재료검사material interface 매질경계면material list 자재목록

설치자재목록material preparationmaterial procurement 자재구매

자재소요계획material specification

자재저장불출계획Material Take-Off (MTO) 자재소요량정보mathematical model 수학모형mating 결합

메이팅장치mating surface 결합면매트릭스통로용매트MAU type blade section 대형해머maxi class 맥시급최대전진항해속력maximum astern speed 최대후진속력

최대날개폭비최대폭최대연속정격출력

maximum load capacity 최대적재용량maximum permissible mass 최대허용질량

도체최고허용온도최고기준주위온도최대단면적최대단면폭최대횡단면적계수최대단면계수최대속력

maximum thickness 최대두께최대두께선정지시최대가로이동거리최대횡단면적시운전최대속력최고전압최대수선면최고사용압력

Mayday 메이데이mean blade width 평균날개폭평균날개폭비

Material List of Fitting (MLF) 자재준비Material Requirement Planning (MRP) 자재시방서material stowage and issuing plan

mating device  

matrix matting runner 

MAU형 날개단면maul hammer  

maximum ahead service speed

maximum blade width ratio     maximum breadth      Maximum Continuous Rating (MCR)

maximum rated conductor temperaturemaximum reference ambient temperature       maximum section area maximum section beam  maximum section coefficientmaximum sectional area coefficientmaximum speed 

maximum thickness line maximum transfer in stopping  maximum transverse section   maximum trial speed   maximum voltage      maximum water plane   maximum working pressure    

mean blade width ratio 

Page 433: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

평균코드길이mean draft 평균흘수평균유효압력

파중평균동력증가파중평균회전수증가파중평균저항증가파중평균추력증가파중평균토크증가평균유효지시압력평균선평균피치평균압력평균속력평균고장간격시간

mean time to failure 평균고장발생시간Mean Time To Repair (MTTR) 평균수리시간평균수선면평균의평균흘수means of access 접근설비means of escape 탈출설비measured mile 표주간거리속력시험침로표주간속력시험재화용적용적화물

무어손식측도법육류운반선

mechanical efficiency 기계효율열의일당량

mechanical hazard 기계적위해요소mechanical pilot hoist 도선사용기계식승강기mechanical properties 기계적성질기계식통풍장치제작기준선medical treatment room 의무실메가와트데이megger test 절연저항시험melting point 융점용융속도membrane stress 막응력membrane type 맴브레인 형메르카토르항법개장순양함상선대merchant ship 상선상선대

mean chord length     

mean effective pressure mean increase in power in waves mean increase in rate of revolutions in waves mean increase in resistance in waves  mean increase in thrust in wavesmean increase in torque in wavesMean Indicating Pressure (MIP)mean line      mean pitch     mean pressure mean speed    Mean Time Between Failure (MTBF)

mean water plane      mean-of-means draft  

measured mile course  measured mile trial    measurement capacity  measurement cargo    measurement of Moorson's systemmeat carrier   

mechanical equivalence of heat 

mechanical ventilation systemmedian line    

Mega watt day 

melting rate    

Mercator sailing merchant cruiser       merchant fleet 

merchantile marine     

Page 434: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

상선법수은보일러수은트림조정장치수은터빈

meridian 자오선자오선위도법mesh 요소분할mesh 그물망 mesh boundary 요소분할경계선원식당작동체인metacenter 메타센터메타센터곡선메타센터높이메타센터반지름메타센터안정성외장metal cement 금속보수제

미그용접metal sheath 금속피복

해양기상관측선기상레이더

meteorological room 기상정보실meteorological service 기상업무methane hydrate 메탄하이드레이트 MF Radio installationMF/HF Radio installation 미첼식추력 베어링마이크로제트micro tang 마이크로 탱마이크로미터

현미경시험현미경조직미진동계마이크로파중앙부선체중분위도항법중심선내저판중간마스트중앙부폭선체중앙단면적

midship 선체중앙중앙기관중앙부늑골중앙부갑판실선체중앙부midship section 선체중앙횡단면도선체중앙횡단면적

선체중앙횡단면계수

merchantile shipping act       mercury boiler mercury trim system   mercury turbine 

meridian altitude       

mess room     messenger chain       

metacentric diagram    metacentric height     metacentric radius     metacentric stability    metal braid armor     

Metal Inert Gas (MIG) Arc Welding

meteorological observatory ship meteorological radar   

MF 무선설비MF/HF 무선설비

Michell thrust bearing  micro jets       

micrometer     microscopic examination       microstructure microvibrograph microwave     middle body    middle latitude sailing  middle line strake      middle mast    midlength beam midlength section area  

midship engine midship frame  midship house  midship part   

midship section area   midship section coefficient     

Page 435: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

연강표주미국국방성표준규격압연번호

mill scale 압연흑피밀링커터mill-sheet 재료시험성적서Mine Layer (ML) 기뢰부설함소해정Minehunter, Coastal (MHC) 기뢰탐색함무기물절연케이블광유광질면mineralizer 무기물투여기Miner's rule 마이너 법칙mine-sweeping operation 소해작업minimize reworks 재작업최소화minimum clear opening 최소통과개구크기최소크리프율최소건현최소탐지거리minimum required mass 최소요구질량최저회전수시험minimum wave resistance 최소조파저항minor assembly 소조립마이너스랩마이너스나사거울등가스배기관마이터톱니바퀴혼합화물복합사이클mixed firing 혼합연소mixed firing boiler 혼합연소보일러혼합연소mixing behavior 혼합특성혼합실혼합탱크미즌마스트미즌톱마스트

이동식해저자원시추선mobile scaffold 이동식작업대이동국mock-up 실물모형모드해석modal density 모드밀도모형시험모형선예인력modeling criteria 모델링기준

mild steel      milepost       Military Specifications and Standard (MIL Specification)mill number    

milling cutter  

mine sweeper  

mineral insulated cable mineral oil     mineral wool   

minimum creep rate    minimum freeboard     minimum range  

minimum revolution test 

minus lap      minus thread   mirror light    mist pipe      miter wheel    mixed cargo   mixed cycle    

mixed fuel burning     

mixing chamber mixing tank    mizen mast mizen topmast    Mobile Offshore Drilling Unit (MODU)

mobile station  

modal analysis 

model test     model towing force    

model-ship correlation allowance 모형선-실선상관수정량

Page 436: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

moderate-size shipyard 중형 조선소감속률감속재modular construction 모듈방식건조modular model 모듈형수학모형모듈

탄성계수습증기내습성절연재료당밀운반선

mold 주형mold cut 몰드컷mold line 몰드라인현도장mold shape 몰드형상molded (MLD.) 형molded baseline 형기선molded breadth 형나비형깊이형치수molded displacement 형배수량형흘수

성형보온재주형공

molding 주조품주형기계몰리에르선도용융금속용융지면적모멘트힘의모멘트관성모멘트

운동량의모멘트센티미터 트림 모멘트운동량모넬합금방사각제한장치

monitoring device 감시장치감시장소단선수루

model-ship correlation factor for propeller rate of revolution   

모형선-실선프로펠러회전수상관비

model-ship correlation factor for propulsive or quasi-propulsive efficiency     

모형선-실선추진효율상관비model-ship correlation factor    모형선-실선상관계수moderating ratio       moderator      

module modulus of elasticity   moist steam    moisture resistant insulating material   molasses tanker 

mold loft       

molded depth  molded dimension      

molded draft   molded heat insulating material molder 

molding machine       Mollier diagram molten metal   molten pool    moment of area     moment of force       moment of inertia      moment of inertia of section area 단면2차모멘트moment of momentum  moment to change one centimeter trim (MTC)momentum     Monel metal   monitor angle limit device      

monitoring station      monkey forecastle     

Page 437: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

몽키스패너몽키스패너단일체구조선moon pool 문풀mooring 계선mooring arrangement 계선장치계선부이계선장치계선파이프계선줄계선시운전mooring winch 계선윈치모스부호모스신호장부홈모르티스활차모자이크타일모자이크공사방충망문MOSS type 모스형mother ship 모선운동보상기motion of electrodemotion response 운동응답원동력motor 전동기전동송풍기전동발전기발동기정발동기붙이구명정motor power 전동기동력motor sailor 기범선내연기관선전동사이렌전동기기동장치내연기관선모터보트motorman 조기수마우싱송화구

이동식소화기movable means of access 이동식접근설비movable ramp 이동식램프움직날개움직깃mud box 머드박스머드혼합장치머드펌프머드탱크머드웰슬리브연결소음기

다소자식음향측심기

monkey spanner       monkey wrench monolithic ship 

mooring buoy  mooring equipment     mooring pipe   mooring rope  mooring trial   

Morse code    Morse signal   mortis mortised block mosaic tile     mosaic work   mosquito net door     

motion compensator     운봉법motive power  

motor fan      motor generator motor launch   motor lifeboat  

motor ship     motor siren    motor starter  motor vessel   motorboat      

mousing mouth piece    movable fire extinguisher      

moving blade  moving vane   

mud mixing unit mud pump     mud tank      mud well       muff coupling  muffler multi-channel echo sounder    

Page 438: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

multi-circular cylinder 다원주multi-core cable 다심케이블multi-core tube 다심튜브복식디젤추진multidisciplinary design 다중협동설계복류식가열기multi-phases 다상물질다단원심송풍기

다단원심펌프multiple closed cell 다중폐단면다기통다중디젤기관

다단식증발기다단식냉각기다극점용접기다기배기복식용접기혼압증기터빈복식펀칭기계다점저항용접다축선다단원심송풍기다단원심펌프다단압축기다층안전유리다점최적설계다점선정형온도계

multi-pole switch 다극스위치multi-port loading 다항적하

다목적화물선multi-span 다중스팬multi-spreader 다중스프레더다관식보일러multi-tubular reactor 다관식반응기복식날개디퓨저먼츠합금버섯꼴닻버섯꼴밸브버섯형통풍통muster list 비상배치표muster station 소집장소

multi-diesel propulsion 

multi-flow heater      

multiple centrifugal fan multiple centrifugal pump       

multiple cylinder       multiple diesel engine  multiple effect evaporator      multiple effect refrigerator     multiple electrode spot welding machinemultiple exhaust       multiple operator welding machinemultiple pressure steam turbinemultiple punching machine     multiple resistance welding     multiple screw ship    multiple-stage centrifugal fan  multiple-stage centrifugal pump     multiple-stage compressor     multiplex safety glass  multi-point design optimizationmulti-point selector type thermometer

Multi-purpose Cargo ship (MPC)

multi-tubular boiler      

multi-vane diffuser     Muntz metal   mushroom anchor      mushroom valve       mushroom ventilator   

Page 439: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

마일러naked displacement 알몸배수량알몸선체name plate 명판naming ceremony 좁은수로

협대역직접인쇄전신장치national administration 주관청

미국항공우주 규격national authority 주관청 natural circulation 자연순환natural convection 자연대류자연대류방열기자연곡재자연통풍natural exhaust 고유진동수natural period 고유주기자연방사능자연횡동요natural ventilation 자연통풍

자연통풍장치고유진동모드항해력항해천문학

nautical chart 해도항해계기nautical mile 해리nautical publication 항해도서 항해표항해연습선조선기사조선공학네이벌황동해군조함관해군공창해군기사

미해군연구소Navier-Stokes equations 가항상태가항수역항행구역navigation bridge 항해선교항해선교갑판항해선교시야navigation equipment 항해기기navigation light 항해등navigation light indicator 항해등표시반navigation position 조선장소 항해선교내다지항로표지

Mylar 

naked hull     

명명식narrow waters Narrow-Band Direct Printing telegraph(NBDP) National Aerospace Standard (NAS)

natural convector      natural crook timber   natural draft    자연배출natural frequency      

natural radioactivity    natural rolling  

natural ventilation system      natural vibration mode nautical almanac       nautical astronomy     

nautical instrument     

nautical table  nautical training ship   naval architect naval architecture      naval brass    naval constructor      naval dockyard naval engineer Naval Ship Warfare Center (NSWC) 나비어-스톡스 방정식navigable condition     navigable waters       navigation area 

navigation bridge deck navigation bridge visibility

navigation wing navigational aids       

Page 440: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

navigational equipment 항해설비협대역직접인쇄전신

navigational warning 항해경보 navigational watch 항해당직NAVSEA 미해군조함단나브텍스수신장치

해군항행위성시스템NC machine 수치제어기계수치제어마킹조금넥부시넥엘보necking effect 네킹효과바늘밸브음 부력탱크negative pressure 음 압력음 슬립음 복원력네스팅순적량

순유효등가두께양망기순마력방잠망부설선유효흡입양정양망롤러

net scantling 순치수net section modulus 순단면계수하역망순강재중량net thickness 순두께net thickness offered 제공순두께net thickness required 요구순두께순톤수신경회로망중립각중립축중립평형중성불꽃중립선중립면중립면중성화수

중성자밀도중성자속밀도중성자원신선니켈강

NAVigational information TEleX (NAVTEX)

Navtex receiver Navy Navigation Satellite System (NNSS)

NC marking      neap tide      neck bush      necked elbow  

needle valve   negative buoyancy tank 

negative slip   negative stability       nesting net capacity    net effective equivalent thicknessnet hauler      net horsepower net layer       Net Positive Suction Head (NPSH)net roller      

net sling       net steel weight       

net tonnage    neural net      neutral angle   neutral axis    neutral equilibrium     neutral flame   neutral line    neutral plane   neutral surface neutralization number  

neutron density 

neutron flux density    neutron source      new ship       nickel steel    nickel-chrome steel     니켈-크롬강

Page 441: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Ni-electrode 니켈계 용접봉NiFe-electrode 야간오차야간쌍안경night shift 야간근무night vision 야시경니플이음Nippon Kaiji Kyokai (NK)nitrogen generator 질소발생장치nitrogen oxide 질소산화물nitrogen vaporizer 질소기화기no fuse breaker 배선용 차단기nodal displacement 절점변위nodal force 절점력절점Noise Criteria (NC) 실내소음기준noise level 소음레벨Noise Rating Number (NRN) 소음평가지수Noise Reduction (NR) 소음저감량no-load running 무부하운전no-load test 무부하 시험무부하전압호칭지름공칭총웨브두께nominal hoisting speed 공칭권양속력nominal horse power 호칭마력nominal lateral load 공칭면외하중공칭피치공칭압력nominal strain 공칭변형률 nominal stress 공칭응력nominal stress approach 공칭응력방법nominal value 공칭치 nominal voltage 공칭전압nominal wake 공칭반류공칭반류비nomogram 노모그램비흡습성재료무브래킷식noncombustible material 불연성재료비복수기관nonconducting mat 비전도체 매트nonconducting materialnon-continuous deck 불연속갑판non-continuous flange 불연속플랜지조립식라이너

비도전금속부nondestructive evaluation 비파괴평가nondestructive examination 비파괴시험nondestructive technique 비파괴 기술

nickel-chrome-molybdenum steel 니켈-크롬-몰리브덴강

니켈-철계 용접봉night error     night glasses   

nipple joint      일본선급

nodal point     

no-load voltage nominal diameter       nominal gross web thickness

nominal pitch  nominal pressure       nominal size    호칭치수

nominal wake fraction  

non-absorbent material non-bracket system    

non-condensing engine 

부도체

non-continuous liner   non-current carrying metallic part

Page 442: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

비파괴검사비분리식나사non-dimensional 무차원의 촉탁검사원비팽창기관비철금속내화도료부동혼합액

비선형유한요소해석nonlinear wave 비선형파non-magnetic material 비자성강

비금속수밀피복non-metallic material 비금속물질

고정원형창비여객선무동력선체크밸브비자기역전식디젤기관

non-rotating rope 비회전 로프nonslip 미끄럼방지방폭 팬non-sparking tool 비정지캐비티non-statutory spare parts 법정외 예비품non-tight bulkhead 비수밀격벽

변동피치프로펠러non-watertight (N.W.T.) 비수밀

비수밀격벽비수밀문

Norm Francaise (NF) 프랑스표준규격normal ballast 통상 밸러스트정상상태

상용연속출력normal distribution 정상분포normal duration 정상소요시간normal operating condition 통상운전상태상용출력

법선피치

normal power supply 통상전력공급 유효통달거리상용속력

normal strength steel 연강normal stress 수직응력

NonDestructive Test (NDT)non-detachable screw cap     

non-exclusive surveyor non-expansive engine  nonferrous metal      nonflammable paint     nonfreezing mixture   nonlinear finite element analysis

비자성체non-magnetic steel     non-metallic impervious sheath 

non-opening side scuttle       non-passenger ship    non-powered vessel   non-return valve       non-reversible diesel engine   

non-sparking fan        방폭공구non-stationary cavities 

non-uniform pitch propeller    

non-watertight bulkhead       non-watertight door    

normal condition       Normal Continuous Rating (NCR)

normal output  

normal pitch   

normal range   normal speed  

Page 443: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

온도정격normal working hours 정상근로시간노멀라이징Northern Sea Route (NSR) 북극항로북쪽상방표시뿌리면

운전부자유등notch 노치 노치봉시험노치굽힘시험노치취성

노치계수노치효과노치뿌리노치감도

notch stress 노치응력notch toughness 노치인성지시판notices to mariners 항행통보not-under command light 무전압경보noxious liquid substance 유해액체물질noxious substancenozzle 노즐노즐각노즐단면계수노즐날개노즐블록노즐상자노즐졸임유량노즐차단조절노즐효율nozzle injection system 노즐분사장치노즐손실nozzle propeller 노즐프로펠러nozzle ring 노즐링nozzle rudder 노즐타노즐목

노즐제어조속핵단면적핵분열핵력핵연료핵반응원자력선원자력잠수함원자력항공모함

normal temperature ration      

normalizing    

north-up       nose   nose-tail line   코-꼬리코드선not under command light       

notch bar test notch bend test notch brittleness       

notch coefficient       

notch effect    notch root     notch sensitivity       

notice plate    

운전부자유등no-volt alarm   

유해물질nozzle angle   nozzle area coefficient nozzle blade   nozzle block   nozzle box     nozzle chocking flow   nozzle cutout governing nozzle efficiency       

nozzle loss     

nozzle throat   nozzle-control governing       nuclear cross section  nuclear fission       nuclear forcer  nuclear fuel    nuclear reaction nuclear ship    nuclear submarine      nuclear-powered aircraft carrier (CVN)

Page 444: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

핵형성너깃number of coats 도장 횟수number of cycles 반복횟수목표탐지횟수

최대연속회전수회전수행정수

numerical calculation 수치계산Numerical Control (NC) 수치현도법숫자기numerical simulation 수치모사numerical wave tank 수치파수조마름모꼴부표나이키스트주파수오컴oar 노노구명정

객체지향모델링객체지향프로그래밍기법의무선

oblique sea 선수사파oblique sectionobservation 관측observation error 검유탱크장애부표장애물등occasional inspection 임시검사명멸등occupancy requirement 최소장비 가동율해류Ocean Engineering Basin 해양공학수조원양구역ocean going fishing 원양어업원양선ocean sailing 원양항해정점관측선

해양관측부이해양 조사선해양조사선

octane number 옥탄가octave 옥타브옥타브밴드off centerline 중심선에서 이격거리편심표시

미해군연구청

nucleation      nugget 

number of hits  number of maximum continuous revolutionsnumber of revolution   number of stroke      

수치제어numerical mould method       numerical pennant      

nun buoy      Nyquist frequency      oakum 

oar lifeboat    object-oriented modeling       Object-Oriented Programming Style(OOPS)obliged vessel 

경사단면관측오차

observation tank       obstruction buoy       obstruction light  임시검사Occasional Survey (OS)     occulting light  

ocean current  

ocean going area      

ocean going vessel     

ocean weather ship    oceanographic observation buoy oceanographic research shipoceanographic research vessel 

octave band    

off-center PPI Office of Naval Research (ONR)

Page 445: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

officer on watch 당직사관항해사선박번호official registration mark 공식등록표지official sea trial 공식시운전offset table 형상치수표잔류편차해상부두근해경비함offshore race 외해경기원호꼴단면기름흡착매트기름흡착재

기름윤활식선미관베어링선미관유밀장치유압브레이크연료저장고오일버너

oil coaming 오일 코밍석유회사국제해사평의회

oil content 유분농도유분농도계기름검지기기름배출감시장치유처리제살포장치급유축

oil fence 오일펜스오일펜스확장장치주유연결구주유관기름여과기기름분리장치중력식기름탱크유면검지기

oil mist detector 유증기 탐지기유성페인트오일팬

oil quenching 기름담금질oil record book 기름기록부기름회수기oil recovery ship 기름회수선oil recovery system 기름회수장치기름회수선oil residue 유성잔류물oil seal 유밀장치유수분리장치

officer  official number 

공식해상시운전official trial    

offset  offshore lading station Offshore Patrol Vessel (OPV)

ogival  oil absorption mat      oil absorption material oil bath type stern tube bearing oil bath type stern tube sealing deviceoil brake       oil bunker      oil burner      

Oil Companies' International Maritime Forum (OCIMF)

oil content meter      oil content sensor      Oil Discharge Monitoring Equipment (ODME)oil dispersant sprinkling device oil distribution shaft    

oil fence expanding device     oil filling connection   oil filling pipe  oil filter oil filtering equipment  oil head tank   oil level sensor 

oil paint        oil pan Oil Pollution Act (OPA) '90    오피에이 90

oil recovery equipment 

oil recovery vessel    

oil separating system  

Page 446: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

oil settling tank 유침전탱크oil skimmer 기름회수선oil spill 기름유출사고 기름저장부선기름여과기오일섬프오일스위치

기름탱크비상차단밸브유조선

oil tight (O.T.) 유밀oil tray 기름받이

기름형운전부자유등유수경계면검출기벌크겸유조선조기수유밀격벽유밀이음유밀피치유밀시험유밀공사유성오수탱크

oily mixture 유성혼합물폐유연소보조보일러

oily water 유혼합수유수분리탱크

oily water separator 유수분리기유수분리기서비스펌프유수흡입기유수흡입펌프오메가항법장치버스바

on-block outfittingon-board

선상통신장치on-board maintenance 선상정비on-board outfittingon-board services 선상공무지원on-board test 선내시험on-board test procedure 선내시험절차서on-ceiling outfitting 상부의장갑판상거더one design class

one side welding 편면용접on-floor outfitting

oil storage barge       oil strainer     oil sump       oil switch      oil tank emergency shut-off valveoil tanker      

oil type not-under-command lightoil water interface detector    oil-bulk carrier oiler   oil-tight bulkhead       oil-tight joint    oil-tight pitch   oil-tight test    oil-tight work   oily dirty water tank   

oily sludge burning auxiliary boiler

oily water separating tank     

oily water separator service pumpoily water suction device      oily water suction pump omega navigator       omnibus bar    블록의장선상on-board communication equipment

선내 의장

on-deck girder  동일설계급 one dimensional spectral density 1차원스펙트럼

지상의장

Page 447: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

on-scene communication 현장통신 on-the-job training 직장내교육훈련on-unit outfitting 유니트의장

준설토처리장치대기복수기벌림베벨무갑판선열린촉개회로전압개방사이클

open deck 개방갑판open end link 개방단말링크개방급수식

조립늑판개방형계측장치

open grating 격자모양 발판오픈호저평로강개방이음개항open rail 오픈레일개방정박지open sea 개방해역무개형컨테이너개방형베어링개방형연료밸브

개방형추력베어링프로펠러단독효율

operating instruction 작동지침작동유펌프작동유섬프탱크작동유보급탱크작동유탱크기관구역무인화설비작동수관

operation manual 작동설명서operation process chart 작업공정도표operation room 수술실operational load 운항하중operational precaution 작동시주의사항operator instruction book 운용자지침서대향피스톤형optical fiber cable 광섬유케이블optical laser 광레이저옵티컬로그optical sensor 광센서optimist class 옵티미스트 급

ooze processing equipment     open air condenser    open bevel     open boat      open chock    open circuit voltage    open cycle     

open feed system      

open floor     

open gauging  

open hawser   open hearth steel      open joint      open port      

open roadstead 

open top container     open type bearing      open type fuel valve   open type thrust bearing       open water propeller efficiency 

operating oil pump     operating oil sump tank operating oil supply tank       operating oil tank      operating system for unattended machinery space operating water pipe   

opposed piston type    

optical log     

Page 448: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

optimization 최적화optimum designoptimum water line shape 최적흘수형상optimum welding sequence 최적용접순서

오렌지필형그래브버킷파반류차수지령타각스톡앵커

ordinary frame 보통꼬임중실원형기둥ordinary stiffener 일반보강재ordinary temperature 종선광석운반선Ore-Bulk-Oil (OBO) ship 광물원유산적화물겸용선미송

유기재감속원자로경제협력개발기구

orifice 오리피스주문자상표부착

orthogonal function 직교함수orthotropic element 직교이방성요소orthotropic plate 직교이방성판oscillating hydrofoil 진동 날개oscillating water column 진동수주형 공기챔버동요oscilloscope 오실로스코프오터보드오터트롤러오토사이클out door shop 외업공장out haulout sourcing 외부하청outboardoutboard engine 선외기선체측면도바깥쪽회전선외축출거outdoor piping 겉바닥아우터클램프외항바깥선각

최적 설계

orange peel type grab bucket  orbital wake   order   ordered rudder angle  

ordinary anchor 

일반늑골ordinary lay    ordinary pillar  

상온ordinate ore carrier     

Oregon pine   organic moderated reactor     Organization for Economic Cooperation and Development (OECD)

Original Equipment Manufacturer (OEM)

oscillation      

otter board    otter trawler   Otto cycle      

돛당김줄 선외측

outboard profile outboard rotation       outboard shaft out-docking     옥외배관outer bottom   outer clamp    outer harbor   outer hull      

Page 449: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

아우터지브외측판원형창바깥덮개선외축외측판outfit planning 의장작업계획outfitting 의장의장안벽의장안벽의장일정계획체계의장공장outfitting zone 아웃홀공기출구각날개출구각출구속도output 출력출력밀도outreach 아웃리치아웃리거outside assembly site 옥외조립장외측맞댐덧판외측선실바깥지름파스선저복수기outside diameter 바깥지름외판외판바깥발판outstanding item 미해결사항가는항해

과전류방지장치over current relay 과전류계전기over flow 넘침초과속력한계over speed protection 과속력방지과속력방지장치 over voltage relay 과전압계전기종합특성전체치수종합효율overall evaluation

총합열전달overall inspection 현상검사종합추진효율종합온도상승과평형overboard 선외로

선외불어내기밸브overboard discharge

선외배출관

outer jib       outer plating   outer plug     outer shaft     outer strake   

outfitting basin outfitting quay outfitting scheduling systemoutfitting shop  의장구획out-haul outlet air angle outlet blade angle      outlet velocity 

output density  

outrigger       

outside butt strap      outside cabin   outside calipers       outside condenser      

outside planking outside plating outside staging 

outward voyage over current protection device

over speed limit       

over speed protection device

overall characteristic   overall dimension      overall efficiency        종합평가overall heat transmission       

overall propulsive efficiencyoverall temperature rise over-balance   

overboard blow-off valve       선외배출overboard discharge pipe      

Page 450: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선외배출밸브overboard fitting 선외부착품과충전overcritical running 공진회피운전과팽창overflow control system 넘침제어장치넘침관넘침관장치수선위돌출부overhaul 분해개방검사overhead cost 천장크레인overhead factors 간접비 요소overhead obstruction 상부장애물overhead traveling crane 천장주행 크레인overhead welding 위보기용접과열overlap 겹침overlapped end connection 겹침 단부 연결overload 과부하overload alarm 과부하경보 과부하율overload operation 과부하운전과부하출력overload protection device 과부하방지장치과부하시험overload trip 과부하정지overloading 과적오버라이드overshoot 과도작동oversize 과대치수overturn 전복overweightowner 선주

선주공급장비owner's extra margin 선주여분여유 선주기owner's inspector 선주검사원owner's manual 선주매뉴얼oxidation 산화금속페인트산화염옥스터판산소아세틸렌용접산소아크절단산소농도계산소농도계산소가우징산소랜스oxygen plasma cutting 산소플라즈마절단oxygen purity 산소방출장치

overboard discharge valve     

overcharge     

over-expansion 

overflow pipe  overflow system       overhang       

overhaul inspection     간접비overhead crane 

overheat       

overload fraction 

overload output 

overload test   

override       

중량초과Owner Furnished Equipment (OFE)

owner's flag  

산화oxide paint     oxidizing flame oxter plate     oxyacetylene welding     oxy-arc cutting oxygen analyzer       oxygen content meter  oxygen gouging oxygen lance  

산소순도oxygen supply system 

Page 451: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

산수소용접산소프로판절단ozone depleting substance 오존파괴물질packaged boiler 패키지보일러packing 패킹패킹누르개패킹뽑개패킹피스패킹링패킹나사패킹경화살돋움paddle 패들외륜함외륜선외륜아이플레이트paint dippingpaint film defect 도막결함페인트긁개페인트분무기페인트분무기페인트공pallet 팰릿Pallet Material List (PML) 팰릿 자재목록표palm 팜야자밧줄팜스테이냄비머리리벳

파나마운하신호등Panama Canal Tonnage 파나마운하톤수

파나마운하톤수증서파나마촉

Panamax bulk carrier 파나막스급 산적화물선Panamax tanker 파나막스급 유조선panel 패널분전상자패널브레이커panel line 평블록라인패널진동패널공사panting 팬팅팬팅작용팬팅구조팬팅보팬팅늑골팬팅스트링거팬터그래프pantry 조리기구실낙하산붙이신호평행부

oxyhydrogen welding   oxypropane cutting     

packing gland  packing hook   packing piece  packing ring   packing screw packing stick   padding 

paddle box     paddle steamer paddle wheel   pad-eye        침적도장paint scraper   paint spray gun     paint sprayer  painter 

palm rope      palm stay      pan head rivet Panama canal signaling light   

Panama Canal Tonnage CertificatePanama chock 

panel board    panel breaker  

panel vibration panel work     

panting action  panting arrangement   panting beam  panting frame  panting stringer pantograph     

parachute signal       parallel body   

Page 452: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

평행류열교환기평행류열교환기축류터빈선체중앙평행부

parallel operation 병렬운전 parallel processing 병렬처리평행자parallel running 병렬운전거등권항법병렬식parallelization 병렬화파라베인원형모재Paris' law 패리스법칙

파커라이징part assembly 소조립부분부하part number

부분차양갑판선부분격벽부분캐비티부분이중저

partial girder 부분거더partial load line 부분만재흘수선부분용입용접partial safety factor 부분안전계수부분안전계수법부분선루부분수밀격벽

영상 입자 속도 계측단독해손칸막이벽

parts fabricationParts Per Billion (PPB)Parts Per Million (PPM)pass 패스패스순서터빈유로passageway 통로passenger 여객여객실여객선passenger ferry 여객 도선정기여객선passenger public space 여객공용구역passenger ship 여객선

여객선안전증서passenger space 여객구역

parallel flow heat exchanger   parallel flow regenerator       parallel flow turbine    parallel middle body   

parallel ruler   

parallel sailing parallel system 

paravane       parent form    parent metal   

parkerizing     

part load        부품번호partial awning deck vessel     partial bulkhead partial cavities partial double bottom  

partial penetration weldingpartial safety factor methodpartial superstructure  partial watertight bulkhead Particle Image Velocimeter (PIV)particular average      partition wall    부재가공십억분의 일백만분의 일pass sequence passage of turbine     

passenger accommodation      passenger boat 

passenger liner 

passenger ship safety certificate 

Page 453: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

passenger-cargo ship 화객선패치페이턴트로그patrol boat 순시선pattern 목형원형목형공payload 적재중량peak 피크피크보드피크늑골피크부하피크펜던트peak stress 피크 응력피크탱크peak value 피크값 진주채취선펄라이트pedestal 페데스털페데스털롤러피닝해머피닝눈구멍덤카드pendant 펜던트작업등

진자식충격시험기Penetrant Test (PT) 침투탐상시험penetration hole 관통개구penetration piece 관통피스용입pentamaran 오동선perch 퍼치충격시험충격용접충격용접이상유체이상기체perforated deck 다공갑판다공판다공링performance guarantee 성능보증performance standard 성능기준

보호도장성능기준성능시험

period 주기조우주기종동요주기횡동요주기period of validity 피리어드시스템periodic maintenance

patch  patent log      

pattern patterner       

peak board     peak frame    peak load      peak pendant  

peak tank      

pearl boat      pearlite 

pedestal roller peening hammer       peening peep hole      pelorus 

pendant light   pendulum impact testing machine

penetration     

percussion test percussion welding     percussive welding     perfect fluid   perfect gas    

perforated plate perforated ring 

Performance Standards for Protective Coatings (PSPC)performance test       

period of encounter    period of pitching      period of rolling        유효기간period system   정기적정비

B8600
JHKIM: 횡동요주기
Page 454: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

periodic testing 정기적시험periodical survey

정기적무인화기관구역peripheral devices 주변장치주변속도perlite 펄라이트permanent ballast 고정밸러스트permanent bunker 상설연료고permanent deformation 영구변형permanent inclined ladder 상설경사사다리

상설접근설비영구변형상비품영구변형률 침수율투자율

permissible delay 허용인도지연방사선노출허용용량허용길이permissible limit 허용한계값permissible tolerance 허용공차permissible value 허용값perpendicular 수선personal allowancepersonal lift 엘리베이터personal monitor 개인감시장치personnel safety 인명안전투시도pertinent factors 관련요소꼬마콕꼬마밸브하사관Pferd Starke (PS)pH 수소이온농도페하미터페하미터phase 위상

진상기위상각

phase averaging 위상평균phase change 상변화phase control 위상제어상수변환기위상차위상지연

위상응답함수검상기

phase sequence 상순

정기적검사periodically unattended machinery space

peripheral velocity     

Permanent Means of Access (PMA)permanent set permanent stores      permanent strain permeability    permeability    

permissible exposer    permissible length      

생리여유

perspective drawing    

pet cock       pet valve      petty officer    마력단위 (PS)pH meter      pH testing apparatus   

phase advancer 

phase angle    

phase converter phase difference       phase lag      phase response operator       phase rotation indicator 

Page 455: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

검상기이상

Phase switch 위상변화인청동광학마킹photo sensor 광전센서photo-effect 광효과광탄성현미경사진photo-potential 광전위piano wire 피아노선pickling 산세척산세척탱크pick-up sensor 픽업 센서pier 부두pier mooring 안벽계류압전선철안료붙임기둥파일캡파일드라이버파일가이드파일링선pillar 필러

필러/거더구조도원주부표

pilot 도선사도선사선도선선교도선의자수로도도선기도선사승강기도선기도선사사다리표시등도선사실도선사대기실파일럿밸브도선료조립식받침목핀연결장치pin jig setting 핀지그 설치pinching 조이기핑거바늘구멍pinion 피니언피니언축pink noise 도색잡음함재정pintle 핀틀pintle cover 핀틀덮개

phase sequence indicator       phase shift     

phosphor bronze       photo marking 

photo-elasticity photo-micrography      

pickling tank   

piezo-electricity pig iron pigment pilaster pile cap pile driver     pile guide      piling barge    

pillar and girder construction profile   pillar buoy      

pilot boat      pilot bridge    pilot chair      pilot chart     pilot flag       pilot hoist      pilot jack      pilot ladder    pilot lamp      pilot room     pilot station    pilot valve     pilotage pin block       pin connection device  

pinger pinhole 

pinion shaft    

pinnace 

Page 456: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

pipe 관배관파이프밴드관굽히개pipe cleat 파이프 밧줄걸이관로파이프대빗관플랜지관걸이관집개파이프아이들러롤러파이프부설선파이프부설부선파이프정렬장치파이프통로배관부속파이프인발장치

케이싱파이프압입장치파이프릴

pipe schedule 파이프 스케줄관용나사깍개파이프공장파이프지지장치파이프텐셔너pipe thread 관용나사pipe threading machine 관용나사깍개pipe trunk 관 통로pipe tunnel 관 터널

파이프렌치piping 배관

배관계장계통도배관계통도

piping plan 관장치도배관공사

piston 피스톤piston area 피스톤면적piston clearance 피스톤간극piston cooling 피스톤냉각

피스톤냉각용청수냉각기피스톤냉각용청수펌프피스톤냉각유펌프피스톤냉각수펌프피스톤크라운피스톤행정체적피스톤헤드피스톤혼피스톤핀

pipe arrangement      pipe band      pipe bender    

pipe conduit   pipe davit      pipe flange     pipe hanger    pipe holder    pipe idler roller pipe layer      pipe laying barge      pipe line-up station    pipe passage   pipe piece     pipe pulling-out device pipe pushing-down device      pipe reel       

pipe screw cutting machine  pipe shop      pipe supporting gear   pipe tensioner 

pipe wrench   

Piping and Instrumentation Diagram (P & ID)piping diagram 

piping work    

piston cooling fresh water coolerpiston cooling fresh water pumppiston cooling oil pump piston cooling water pump     piston crown   piston displacement    piston head    piston horn    piston pin      

Page 457: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

piston pump 피스톤펌프piston ring 피스톤링piston ring groove 피스톤링 홈

피스톤링착탈공구피스톤로드피스톤용착피스톤스커트

piston speed 피스톤도피스톤스프링피스톤밸브pitch 피치pitch 종동요피치각피치코드비피치원피치게이지피치비피치형판피치계피토관

곰보꼴pitting corrosion 점부식pivot 피벗pivot bearing 선회축피벗베어링피벗중심평면브래킷평면항법평테르밋평트롤리plan 평면도plan approval 평면운동장치plane 주 좌표면plane bulkhead 평면격벽회전면대칭면

평면위치지시기평면스카프

plane strain 평면변형률plane stress 평면응력 면적계planing 활주평삭기계현연재플랑크톤네트

계획정비제도평삭밀러플랜트 부선

plasma arc cutting 플라스마아크절단plasma welding 플라스마 용접

piston ring tensioning tool     piston rod      piston seizing  piston skirt    

piston spring   piston valve    

pitch angle     pitch chord ratio       pitch circle    pitch gauge    pitch ratio     pitch template  pitchometer    Pitot tube  pitted surface appearance      

pivot bearing   pivot point     plain bracket   plain sailing    plain thermit   plain trolley    

도면승인Planar Motion Mechanism (PMM)

plane of rotation       plane of symmetry     Plane Position Indicator(PPI) plane scarf     

planimeter     

planing machine plank sheer    plankton net   Planned Maintenance Scheme (PMS)planomiller     plant barge    

Page 458: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

plastic buckling 소성좌굴 소성변형plastic flow theory 소성류 이론plastic hinge 소성관절 소성단면계수plastic shear area 소성전단면적유리섬유강화플라스틱선소성상태plastic strain 소성변형률 plastic zone 소성역 소성plate 판판굽힘롤러plate diaphragms 판상다이어프램plate edge clamped 판고정변plate floors 판상늑판plate free edge 판자유변판이음평판용골판펴기기계판선수재판펴기기계

판펴기롤러플레이트형그래브버킷판형열재생기

plated stringer 판상스트링거platen 정반플랫폼갑판platform landing 디딤플랫폼plating 판재도금판붙임유람선유람요트plenum chamber 플리넘체임버프림솔표지플로터플로팅장치plow-in 프라우인머리박기plug 플러그플러그구멍plug welding 플러그 용접연직추추선plumbing fixture 배관부착품중간축베어링plunger 플런저플런저펌프플러스나사항행구역제한합판공기제동기공기감쇠력계수

plastic deformation     

plastic section modulus 

plastic ship    plastic state    

plasticity       

plate bending roller    

plate joining plate keel      plate mangle   plate stem     plate straightener      plate straightening roller       plate type grab bucket plate type regenerator 

platform deck  

plating plating pleasure boat  pleasure yacht 

Plimsoll mark       plotter plotting device 

plowing 

plug hole      

plumb bob     plumb line     

plummer block 

plunger pump  plus thread    plying limit     plywood       pneumatic brake       pneumatic damping coefficient

Page 459: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

pneumatic motor 공기압 모터공기압설비공기압리베터pneumatic tube 공기압관

공기압관식화재경보장치공기압변환식 압력계

pod propulsion system 포드추진기point 곶point 방위각 점출발점재휘점프아송비손누름점용접polar class 극지등급polar diagram 극도표polar moment of inertia

극궤도위성업무polarity 극성검지장치polarization curve 분극곡선편광pole change 극수변환pole lift 봉 활대줄경비정광택판pollution category 오염분류polyester 폴리에스터다상폴리트로픽효율polyurethane 폴리우레탄pontoon 상자형부선부교폰툰해치커버상자형뗏목

폰툰형창구덮개poop 선미루선미루갑판선미루전단격벽poppet 포핏포핏압력포핏밸브porosity 포포이징port 좌현port 항구port 현문좌현큰닻배수구덮개좌현부표배수구덮개

pneumatic plant pneumatic riveter      

pneumatic tube fire alarm systempneumatic type pressure gauge 

point of departure      point of recalescence  Poisson's ratio poke welding  

극단면2차모멘트polar orbiting satellite service 극성polarity indicator       

polarization    

police boat     polished plate  

polyphase      polytropic efficiency   

pontoon bridge pontoon hatch cover   pontoon raft   pontoon type hatch cover      

poop deck     poop front bulkhead    

poppet pressure poppet valve    기공porpoising     

port bower     port flap       port hand buoy port lid 

Page 460: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

원형창행선항양륙항피난항입항항적하항선적항항만규칙

port side 좌현항구하역속력port state 항만국Port State Control (PSC) 항만국통제port tack 좌현 택조립식준설선

휴대용가스탐지기휴대식소화기휴대식폼노즐이동식화로휴대등휴대등

portable instrument 휴대식계기이동식사다리portable lamp 휴대용전등 portable means of access 이동식접근설비이동식기둥이동식펌프portable radio apparatus 휴대용무선장치portable tank 독립탱크portable type

휴대식자기나침반portable water pump 음료수펌프portable water tank 음료수탱크portal crane 문형 크레인원형창포틀랜드시멘트

선위측정장치용접자세자리잡이

position-updating 위치최신화positive pressure 양 압력 정복원정곡선

후열처리후열

Post-Panamax 포스트파나막스급post-weld stress relieving 용접응력제거potential crack 잠재적균열퍼텐셜유동퍼텐셜함수potential hazard 잠재적위해요소

port light       port of destination     port of discharge      port of distress port of entry   port of loading port of registry port regulations 

port speed     

portable dredger       portable explosion meter       portable fire extinguisher      portable foam nozzle   portable forge  portable hand lamp portable hand light 

portable ladder 

portable pillar  portable pump 

휴대식portable type magnetic compass 

porthole Portland cement position measuring device      position of weld positioner      

positive righting lever curvePost Weld Heat Treatment (PWHT)post-heating   

potential flow  potential function       

Page 461: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

퍼텐셜반류potentiometer 파운딩유동점powder charge cartridge 화약카트리지분말절단powder metallurgypower 지시동력power actuating system 동력작동계통동력계수출력곡선도power distribution panel 동력배전반출력추정역률동력실

동력부하계수전력관리시스템

power network 동력계통동력출력부power panel 동력장치동력추정계수동력펌프출력영역방식power rating 정격출력출력비동력원자로출력행정Power Take-Off (PTO) 동력인출장치출력터빈power unit 동력장치출력추정입항허가서

정밀선위측정장치정밀음향측심기정밀계측기기불갈퀴예연실

pre-contract negotiation 계약전협의예냉기predominant load case 지배적하중상태pre-erectionpre-erection outfitting

prefabricated section 선행제작부재prefabricated unit 선행제작유니트지상조립우선차단preheating 예열preheating temperature 예열온도preignition 조기점화preliminary design 초기설계

potential wake  전위차계pounding       pour point     

powder cutting  분말야금

power coefficient     power curve   

power estimation       power factor   power house   power loading coefficient       Power Management System (PMS)

power output section    동력반power plant    power prediction factor power pump   power range system   

power ratio    power reactor  power stroke  

power turbine  

powering       pratique precise ship position measuring deviceprecision echo sounder precision measuring equipmentprecker bar    pre-combustion chamber 

precooler      

선행탑재선행탑재의장

prefabrication  preference trip 

Page 462: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

preliminary planning 예행시운전조기점화premature wear 선행의장prerequisites

여객정원preservation designpre-sighting 선행축심투시탄성역변형프레스투토크방식압력각압력경계조건압력계수pressure combination 압력조합

균압형기름전동기압력보상기압력복식터빈압력용기압력조절기압력곡선압력저하압력여과기압력계압력수두내압선각압력지시제어기

pressure indicator 압력지시기압력로그압력손실계수강제윤활기압력펌프압력비감압밸브pressure regulator 압력조절기압력도출장치pressure relief valve 압력도출밸브압력저항압력면pressure switch 압력스위치pressure tank 압력탱크

압력탱크급수방식압력단자압력시험가압테르밋용접

pressure transmitter 압력발신기압력식액면계압력진공차단밸브

초기계획preliminary trial premature ignition       조기 마모pre-outfitting     선행조건prescribed number of passenger 방식설계pre-springing  press-to-talk system   pressure angle pressure boundary conditionpressure coefficient      

pressure compensated oil-filled motor pressure compensator  pressure compound turbine     pressure container     pressure controller     pressure curve pressure drop  pressure filter pressure gauge pressure head  pressure hull   pressure indicating controller

pressure log   pressure loss coefficient pressure lubricator     pressure pump pressure ratio  pressure reducing valve 

pressure relief arrangement

pressure resistance    pressure side  

pressure tank water service systempressure terminal      pressure test  pressure thermit welding       

pressure type level gauge      pressure vacuum valve 

Page 463: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

압력용기압력용적선도가압수 분무 소화장치균압형기름축전지

Pressure-Vacuum (PV) Valve

압력속도복식터빈압력용적선도가압연료유공급시스템가압방폭기기가압수형원자로가압기

pre-swirl stator 전류고정프로펠러날개pre-trial conference 시운전관련회의우세풍prevent reoccurrence 프리벤터가이preventive maintenance 예방보전

예방정비절차primary barrier

primary member

primary stress componentprimary support member

원동기동서권priming 시동준비

시동펌프Prince Ocean Model (POM) 해양순환모델주축주좌표면주요치수principal factors 주요치수주응력principle of superposition 중첩원리인쇄회로기판

pressure vessel Pressure -Volume (PV) diagram    pressure water-spraying fire-extinguishing systempressure-compensated oil-filled battery 압력·진공밸브pressure-velocity compounded turbinepressure-volume diagram      pressurized fuel oil supply systempressurized protected apparatus pressurized water reactor      pressurizer     

prevailing wind  재발방지preventer guy  

Preventive Maintenance Schedule (PMS)

1차방벽primary boiler feed water pump  1차보일러급수펌프primary coolant  1차냉각재primary distribution     1차배전primary feedback       1차되먹임

1차지지부재primary pinion  1단피니언primary source  1차전원장치

1차응력성분1차지지부재

primary wheel  1단큰기어primary zone    1차연소권prime mover   prime vertical  

priming pump  

principal axis  principal co-ordinate   principal dimension      주요요소principal particulars    principal stress 

Printed Circuit Board (PCB)

Page 464: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

주형비척계수프리스매틱곡선도prize 나포선

확률밀도함수probability level 확률수준probability of exceedance 초과확률process analysisprocess chartprocess controlprocess flow 공정흐름process planningprocessor 처리기procurement informationprocurement lead timeproducibility 석유제품운반선Product Liability (PL)product mixing 혼류 생산방식제품모델링product tanker 석유제품운반선

제품중심작업구분체계production controlproduction drawing 생산도면production engineering 생산기술production flow analysis 생산흐름분석준설토량계Production Need Date (PND) 생산소요일production oriented design 생산중심설계production planningproduction program 선표생성규칙생성시스템production technologyproductive maintenanceproductive time 생산시간productivity control group 생산성관리단위productivity improvement 생산성향상productivity parameter 생산성지표profile 측면도profile 형강재profile 선체종단면도 형상계수profile cutting 형강재절단

프로파일모니터프로그램제어공정관리기법프로그램가능 논리제어기전진블록용접법

prismatic coefficient    prismatic curve 

Probability Density Function (PDF)

공정분석공정도표공정관리공정계획구매정보조달기간생산용이성

product carrier  제조물책임product modeling       

Product Work Breakdown Structure (PWBS) 생산관리

production meter       

생산계획production rule production system       생산기술생산보전

profile coefficient      

profile monitor program control Program Evaluation and Review Technique (PERT)Programmable Logic Controller (PLC)progressive block welding method

Page 465: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

progressive flooding 점진적침수점증속력시험연속점용접투영횡경사각

projected area 투영면적투영면적비날개투영넓이투영도평면도구명줄발사기 발사체

projection 투영돌기용접프로젝터나침반산책갑판프로메타센터즉발중성자보증하중검인내력내력시험

propeller 프로펠러프로펠러애퍼처프로펠러뒷면프로펠러날개뿌리프로펠러날개단면프로펠러날개두께프로펠러날개끝프로펠러날개폭프로펠러날개프로펠러축캡

propeller boss 프로펠러허브프로펠러형상붙이 캡프로펠러허브지름프로펠러허브비프로펠러축덮개프로펠러틈새프로펠러축덮개프로펠러지름프로펠러원판넓이propeller efficiency 프로펠러효율

프로펠러선후효율프로펠러선후효율프로펠러침식프로펠러기진진동수프로펠러선후시험

progressive speed trial progressive spot welding       projected angle of heel or roll 

projected area ratio    projected blade area   projected plan  projected planform     projectile for line-throwing appliances

projection weld projector compass     promenade deck       pro-metacenter 

prompt neutron 

proof load     proof mark     proof stress    proof test      

propeller aperture      propeller back propeller blade root    propeller blade section propeller blade thickness       propeller blade tip     propeller blade width  propeller blade propeller bonnet       

Propeller Boss Cap Fin propeller boss diameter propeller boss ratio    propeller cap  propeller clearance     propeller cone propeller diameter     propeller disc area     

propeller efficiency behind hull propeller efficiency behind ship propeller erosion       propeller exciting frequency    propeller experiment behind model

Page 466: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

프로펠러단독시험프로펠러앞면프로펠러식송풍기프로펠러충전재프로펠러압입력프로펠러후연프로펠러마력프로펠러허브프로펠러심도프로펠러기진력

propeller jet 프로펠러 후류propeller law 프로펠러법칙프로펠러전연프로펠러너트

단독프로펠러효율propeller pitch 프로펠러피치프로펠러피치비프로펠러평면프로펠러포스트프로펠러앞면프로펠러투영넓이프로펠러압입량프로펠러압입력propeller push up distance 프로펠러압입거리propeller push up load 프로펠러압입력프로펠러후류프로펠러기준선

프로펠러발출장치propeller shaft 프로펠러축프로펠러축베어링propeller shaft bossing 프로펠러축보싱

프로펠러축발출장치프로펠러명음

propeller speed indicator 프로펠러회전수표시기프로펠러뒷면프로펠러추력프로펠러팁클리어런스프로펠러후연프로펠러형식프로펠러주의등프로펠러워시백

프롭제트비례한도프러포셔너propulsion 추진

propeller experiment in open waterpropeller face  propeller fan   propeller filler propeller fitting force  propeller following edge       propeller horsepower  propeller hub  propeller immersion    propeller induced exciting force 

propeller leading edge propeller nut   propeller open water efficiency 

propeller pitch ratio    propeller plane propeller post  propeller pressure side propeller projected area propeller pull-up length propeller pull-up load  

propeller race  propeller reference line propeller removing device      

propeller shaft bearing 

propeller shaft withdrawal device

propeller singing       

propeller suction side  propeller thrust propeller tip clearance propeller trailing edge propeller types propeller warning signal light  propeller wash back   propeller-hull vortex cavitation 

프로펠러-선체소용돌이캐비테이션

prop-jet       proportional limit       proportioner   

Page 467: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

추진보기추진계통제어콘술

propulsion machinery 주기관주기관제어장소

propulsion system 추진 장치추진계수추진효율propulsive performance 추진 성능

보호틀붙이온도계선주책임상호보험조합 보호분무장치

protection zinc 보호아연protective coating 보호도장보호덮개protective covering 보호피복

방식층방어갑판

protective device 보호장치protocol 프로토콜프로톤자력계prototypeprototype test 원형시험프로비전 기중기

식량창고냉각펌프식량창고임시증서가선급증서

proximity switch 근접스위치pseudo - amplitude 의사 진폭가성캐비테이션Public Address (PA) system 선내방송장치공용실public space 공용실puff 퍼프puff port 퍼프포트pug welding 막음용접도르래맥동공동맥동용접동압과급방식

맥동반복수펄스반복주파수동압과급방식미분탄미분쇄기

propulsion auxiliary machinery Propulsion Control Console (PCC)

propulsion machinery control room

propulsive coefficient  propulsive efficiency   

protecting case type thermometerProtection and Indemnity (P & I) Clubprotection spraying apparatus  

protective cover  

protective covering outer sheathprotective deck 

의정서protocol proton magnetometer    원형provision crane provision refrigerator cooling water pump      provision store provisional certificate  provisional classification certificate

pseudo-cavitation      

public room    

pulley  pulsating cavity pulsation welding       pulse operation Pulse Recurrence Rate(PRR) Pulse Repetition on Frequency(PRF) pulse turbo-charging system pulverized coal pulverizer      

Page 468: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

다공링pump 펌프펌프몸통펌프버킷pump cut-in pressure 펌프작동압력펌프준설선펌프레버pump room 펌프실펌프실출입구pump tower 펌프타워

주배수장치도주배수장치도펌프제트

punch 펀치펀치테이블punched mark 각인

펀칭시어링기계펀칭기계펀칭틀

punkah louver 펑커루버펑커루버환기장치Purchase Order (PO) 자재주문서자재주문요구서purchased products 자동차운반선자동차트럭운반선청정연료관청정연료유탱크

청정윤활유관청정윤활유탱크

purifier 청정기연료유가열기청정기온수탱크청정기윤활유가열기청정기작동수탱크청정기실기름청정기용청소대사무장건착망어선

purse-seiner 건착망어선push button 누름단추밀대밀배푸싱니push-up pressure 압입압력퍼티펌프pyrometer 고온온도계Q-flex 카타르 플렉스Q-Max 카타르 맥스quadrant 쿼드런트쿼드런트대빗쿼드런트틸러

pulverizing ring 

pump barrel    pump bucket   

pump dredger  pump lever    

pump room entrance   

pumping and drainage plan     pumping plan   pump-jet       

punch table    

punching and shearing machine punching machine      punching template      

punkah louver system  

Purchase Order Request (POR) 구매품Pure Car Carrier (PCC)Pure Car Truck Carrier (PCTC)purified fuel oil pipe   purified fuel oil tank   purified lubricating oil pipe     purified lubricating oil tank      청정기purifier fuel oil heater purifier hot water tank purifier lubricating oil heater   purifier operating water tank   purifier room purifier workbench     purser purse-seine netter     

push rod       pusher boat    pushing knee   

putty pump    

quadrant davit quadrant tiller  

Page 469: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스펙트럼허수부qualification testqualified products list 인정 품목표품질보증인증서quality circle 품질관리분임조quality controlquality deficiency report 품질결함보고서quality evaluation 전파소실역quality standardquarantine 검역검역정박지검역선검역기검역등검역항quarantine vessel 검역선네바퀴도르래선미갑판사분판재측필러quartering sea 선미사파조타수

준추진계수준추진효율

quay contact region 접안접촉구역 안벽크레인quenching 퀜칭quenching and tempering 조질quick acting cleats 순간작동 클리트quick closing valve 신속차단 밸브quick-release arrangement 순간이탈장치

유연성축quite room 격리병실quotation 래빗레이스나이프공전랙선반racking 래킹래킹력racon 레이콘radar 레이더레이더안테나장치주사안테나radar beacon 레이더비콘레이더부이레이더용해도Radar Cross Section (RCS) 레이다단면적레이더일지레이더마스트radar reflector 레이더 반사기radar transponder 레이더트랜스폰더 레이디얼형보트대빗

quadrature spectrum   quadruple riveting       4열리벳이음자격시험quality assurance certificate

품질관리품질평가

quality minima  품질기준quarantine anchorage   quarantine boat quarantine flag quarantine light quarantine port 

quardruple block       quarter deck   quarter grain   quarter pillar   

quartermaster  quasi-propulsive coefficient    quasi-propulsive efficiency     

quay crane     

quill shaft      

견적rabbet race knife      racing  rack   rack   

racking force  

radar antenna unit     radar antenna  

radar buoy     radar chart     

radar log    radar mast     

radial boat davit       

Page 470: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

회전대빗레이디얼드릴링머신radial dummy 레이디얼더미레이디얼더미링반지름방향평형

반지름방향지느러미식패킹반지름류터빈레이디얼임펠러반지름방향유기속도반지름방향응력반지름방향속도복사열복사손실방열기무선방위신호소무선표식무선표식국라디오부이무선방향탐지기무선방향탐지기무선방위탐지국

radio frequency cable 무선주파수 케이블전자식별무선간섭

radio installation 무선설비무선구명설비무선일지전파항법통신사통신사radio personnel 무선통신담당자radio records 무선일지radio regulation 무선통신규칙무선중계부이radio room 무선전신기무선전신방사선동위원소방사선사진방사선검사Radiographic Test (RT) 방사선투과시험기상관측기구

무선전신비상자동수신기무선전신조난주파수무선전화비상자동수신기무선전화조난주파수무선전화조난주파수청취수신기

radial davit    radial drilling machine  

radial dummy ring      radial equilibrium       

radial fin type packing 

radial flow turbine     radial impeller       radial induced velocity radial stress   radial velocity  radiant heat    radiation loss  radiator radio beacon and direction finding station    radio beacon signal    radio beacon station   radio buoy     radio compass Radio Direction Finder (RDF)  radio direction finding station

Radio Frequency IDentification (RFID)radio frequency interference   

radio life saving applianceradio log       radio navigation radio officer   radio operator 

radio relay buoy        무선실radio telegraph radio telegraphy       radioactive isotope     radiograph     radiographic inspection 

radiosonde balloon      radiotelegraph auto alarm      radiotelegraph distress frequencyradiotelephone auto alarm      radiotelephone distress frequencyradiotelephone distress frequency watch receiver     

Page 471: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

무선전화장치radius end 반지름 끝단행동반지름radius of curvature 곡률반지름관성반지름라도제트에어펌프레이돔raft 뗏목목재적재항rail gate 레일중간문불워크사다리철도연락선눈비클러터rain flow method 레인플로우법 우량계레인아웃

안팎붙임융기갑판

raised quarter-deck 저선미루갑판저선미루선

rake 레이크레이크각경사선수ram 램램선수램벌브램 비율ram type steering gear 램형조타장치램제트ramp 램프램프게이트윈치램스보텀링임의접근기억장치랜덤진동range 레인지거리정도거리분해능거리오차측거기마스트등거리눈금유도표복원성범위조석차거리분해능거리범위거리범위스위치거리범위스위치랭킨사이클래스터주사방식쥐막이쥐막이구조수동드릴수동드릴래칫휠장치

radiotelephone equipment      

radius of action 

radius of gyration      Radojet air pump       radome 

raft port       

railing ladder  railway ferry   rain and snow clutter  

rain gauge     rainout raised and sunken system      raised deck    

raised quarter-deck vessel     

rake angle     raked stem    

ram bow       ram bulb       ram ratio      

ram-jet 

ramp gate winch       Ramsbottom ring       Random Access Memory(RAM)random vibration       

range accuracy range discrimination    range error    range finder   range light     range marker  range marks   range of stability       range of tide   range resolution range scale    range selection switch     range selector Rankine cycle  raster-scan system    rat guard      rat proof construction  ratchet brace  ratchet drill    ratchet gearing 

Page 472: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

래칫휠ratchet wrench 래칫렌치용착속도rate of turn indicator 선회율 지시기 무게손실률rated current 정격출력rated pressure 정격값회두각지시기rating 선박부원rating 정격비율제어래틀린등나무방현재raw material 원자재Rayleigh number 레일리 수Rayleigh-Plesset equationreachingreach-rod 리치로드

반력영향계수 반동타반작용응력반동터빈

reactor 원자로원자로격납용기원자로장치원자로정지읽기전용기억장치

readout point 계산출력점ready for use condition 사용준비상태real gas 실제기체real sea waves 실해역파참미끄럼비실시간처리실시간경사계측reamer 리머리머볼트reaming 리밍리밍머신재휘점복탄재receiver 수신기receiving 수신

수신공중선공용장치수신실린더

receiving inspection 수신기receptaclereception facility 수용시설recess 리세스리세스격벽rechargeable battery 재충전식축전지recharging 재충전reciprocal theorem 상반정리

ratchet wheel       

rate of deposition      

rate of weight loss      정격전류rated output    정격압력rated value    rate-of-turn indicator  

ratio control   ratlines rattan fender   

레일리-플레셋 방정식순행 (측풍범주)

Reaction Influence Number (RIN)reaction rudder reaction stress reaction turbine 

reactor containment vessel     reactor installation     reactor shutdown      Read Only Memory(ROM)

real slip ratio  real-time processing   real-time slope measurement

reamer bolt    

reaming machine       recalescent point       recarburizer    

receiving antenna multi coupler   receiving cylinder       입고검사receiving set    리셉터클recess bulkhead 

Page 473: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

왕복동기관리클레이머 부선재입급re-coating interval 재도장간격공인기관

의사결정을 위한 권고추천항로

recompression chamber 재가압체임버records of equipment 설비기록부

회수유저장컨테이너회수유저장탱크회수유이송펌프

recovery load 회수하중rectangular mode 직교좌표모드각창정류확산

전열식열교환기전열식열교환기붉은불꽃신호

red lead 광명단광명단도료좌현등홍등적열취성red tide 적조red water 적조re-docking 재입거리듀서환원염감압밸브reduction factor 경감계수reduction gear 감속기

감속기윤활유감속기윤활유냉각기감속기윤활유중력탱크감속기윤활유펌프감속기윤활유침전탱크감속기윤활유저장탱크감속기윤활유섬프탱크단면수축감속비

redundancy 여분Redwood viscosimeter 레드우드점도계reef 암초리프밴드리프크링글

reciprocating engine    reclaimer barge reclassification 

Recognized Organization (RO)recommendation for decision makingrecommendation route  

recovered oil storage container recovered oil storage tank     recovered oil transfer pump    

rectangular window    rectified diffusion      recuperative heat exchanger     recuperator    red flare       

red lead paint  red light      red light       red shortness 

reducer reducing flame reducing valve 

reduction gear lubricating oilreduction gear lubricating oil cooler    reduction gear lubricating oil gravity tank      reduction gear lubricating oil pumpreduction gear lubricating oil settling tank      reduction gear lubricating oil storage tank     reduction gear lubricating oil sump tank reduction of area      reduction ratio 

reef band      reef cringle    

Page 474: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

리프포인트리프태클패치reefer container 냉동컨테이너

냉동컨테이너감시장치reefer vessel 냉동운반선릴릴드리베팅재돌입제트기준주위조건기준좌표계reference drawing 날개단면기준선reference planereference point 날개단면기준점참조선reference stress 참조응력refined mesh 상세요소분할미세화부reflagging 선적국변경반사플로터반사부표

반영식자기컴퍼스내화재

refrigerant 냉매냉매관냉장 화물창refrigerated cargo vessel 냉장화물선냉장화물선

식량냉장고식량냉장고냉동능력냉동실냉동용압축기

refrigerating container 냉동컨테이너냉동컨테이너선

refrigerating oil 냉동장치냉동톤냉동사이클냉동기refrigerator 냉장고냉동기브라인펌프냉장고로비연료교환refuse furnace 쓰레기소각로

재생식터보프롭기관재생사이클재생식열교환기열교환기

register book 선명록

reef point      reef tackle patch       

reefer container monitoring system

reel    reeled riveting re-entrant jets reference ambient conditionreference coordinate system 참고도면reference line   기준면기준점reference point reference ship 

refined zone   

reflection plotter       reflector buoy  reflector type magnetic compassrefractory material     

refrigerant pipe refrigerated cargo hold 

refrigerated carrier    refrigerated provision chamber refrigerated provision storerefrigerating capacity  refrigerating chamber  refrigerating compressor       

refrigerating container ship      냉동유refrigerating plant      refrigerating ton       refrigeration cycle     refrigeration machine   

refrigerator brine pump refrigerator lobby      refueling       

regenerated turbo prop engine regenerative cycle     regenerative heat exchanger     regenerator    

Page 475: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

등록폭등록깊이등록총톤수등록마력등록길이등록순톤수등록선

registered tonnage 등록총톤수등록regression analysis 회귀분석보통꼬임regular wave 규칙파조정봉조정기재열계수재열사이클재열로강화절연보강구조보강덧살보강링보강환보강환reinitialization procedure 재초기화 과정불합격재료상대방위relative deflection 상대변위상대건현relative humidityrelative motion 상대운동상대운동표시상대운동레이더상대횡동요

상대회전효율상대속력

relative strain 상대변형률상대흘수상대풍향상대풍속완화relay 계전기간접조속기release existing seam weld 기존용접부절개해방장치reliability 신뢰성

신뢰성설계relief valve 도출밸브예비등릴리빙태클

재액화장치냉각청수펌프재액화장치냉각해수펌프

registered breadth     registered depth       registered gross tonnage       registered horsepower registered length       registered net tonnage registered ship 

registration    Registro Italiano Navale (RINA) 이탈리아선급regular lay     

regulating rod  regulator       reheat factor   reheating cycle reheating furnace      reinforced insulation   reinforced structure    reinforcement  reinforcing ring reinforcing steel band  reinforcing steel hoop  

rejected material       relative bearing 

relative emergence      상대습도relative motion display relative motion radar   relative rolling relative rotative efficiency     relative speed  

relative submergence  relative wind direction    relative wind velocity  relaxation      

relay governor 

releasing device       

Reliability Based Design Optimization (RBDO)

relieving light  relieving tackle reliquefaction plant cooling fresh water pump  reliquefaction plant cooling sea water pump    

Page 476: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

렘remanence 잔류자기remedial actionremnant control 잉여재관리remote control 원격조종원격조종장치

원격조종장치작동시험remote indicationremote operated valve 원격조작밸브remote operating 원격조작remote release 원격해제remote sounding system 원격측심장치remote steering system 원격조타장치

무인잠수정removable link 해체가능연결부 붕괴열제거rendering load 렌더링하중신환허용기준renewal of pipingrenewal survey 정기검사repair 수리repair of defect 결함수리repair ship 수리선repair welding 보수용접수리책임수리 독반복응력repeated yield 반복항복응력repeater 리피터replacement partsreplenishment air 신선공기repose angle 안식각재처리required subdivision index 요구구획지수rescue boat 구조정구조용사다리rescue ship 구조선연구 반응로research ship 해양조사선예비연료유탱크

보조무선전신설비reserve source 예비전원 reserve strength 예비강도reserve thickness 예비두께예비선원예비선원reserved seafarers 예비선원저장소reset 복귀residual righting lever 잔존복원정residual strength 잔존강도잔류응력잉여저항resilient mountingresilient washer 탄성와셔

rem    

수정조치remote control device  remote control system operation test    원격지시

Remotely Operated Vehicle (ROV)

removal of decay heat 

renewal acceptance criteria 배관신환

repairing chief repairing dock repeated stress 

대체부품reprocessing   

rescue ladder  

research reactor       

reserve oil tank      reserve radiotelegraph installation

reserved crew reserved mariner       

reservoir       

residual stress residuary resistance     탄성지지설치

Page 477: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

resin chock installation 수지 촉 설치 수지라이너resistance 저항부가물저항

저항증가율저항납땜측온저항온도계맞댐저항용접

resistance capacity 저항능력저항계수저항불꽃맞댐용접거칠기저항증가저항추정도표저항조정기저항시험저항용접저항횡동요분해능

resonance 공진공명흡수공명통과확률

resonant loads 공진하중resource allocationresponse 응답

응답진폭함수response surface method 반응표면법resting platform 휴식용플렛폼restoration treatment 복원처리restore propulsion 추진력 회복 restoring curve 복원력곡선복원력restoring moment 복원모멘트제한링restraint intensity 구속도제한형계측장치

조종성능제한선등제한수역제한수로합력

resultant pressure 합성압력파생전류retaining arrangement 잠금장치회수retro-reflective material 역반사재

리턴밴드추종장치Return On Invest (ROI) 투자회수율되돌림관복귀행정

resin liner     

resistance appendage  resistance augment fraction    resistance brazing      resistance bulb thermometer   

resistance butt welding 

resistance coefficient   resistance flash butt weldingresistance increase due to roughness    resistance prediction chart     resistance regulator    resistance test resistance welding     resisted rolling resolution discrimination 

resonance absorption   resonance escape probability   

자원분배Response Amplitude Operator (RAO)

restoring force 

restrained packing ring 

restricted gauging      restricted maneuver light       restricted water restricted waters       resultant force 

resulting current       

retrieval       

return band    return gear    

return pipe     return stroke  

Page 478: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

불꽃되돌림식보일러불꽃되돌림식보일러세관감시선잔향실잔향실reverberation sound field 잔향음장잔향시간reverse 역전

역전감속장치예비부력예비석탄고예비급수탱크예비급수부늑골

reverse power relay 역전력계전기역나선형조종시험역유동역극성예비선원리버서가역성자기역전기관역전클러치역전장치역전손잡이역전표시판역전레버역전시험후진터빈전도식채수기회전계수적산회전계회전계회전수텔레그래프회전방향지시기분당회전수회전자계레이놀즈수레이놀즈 스트레스 난류 모델가감저항기

rhumb line 항정선리브안내목침수상태라이더부용골라이더판천막대들보천막줄천막대들보받침줄매기공rigging 삭구장치줄매기비품공장줄매기장치도

return-flame boiler     return-tube boiler      revenue cutter reverberation chamber reverberation room     

reverberation time     

reverse and reduction gear    reverse buoyancy      reverse coal bunker    reverse feed water tank       reverse feed   reverse frame  

reverse spiral maneuvering test reversed flow  reversed polarity       reversed seafarers     reverser       reversibility    reversible engine      reversing clutch reversing gear reversing hand wheel  reversing index reversing lever reversing test  reversing turbine       reversing water bottle revolution coefficient   revolution counter      revolution indicator    revolution telegraph    revolution telltale      Revolutions Per Minute(RPM) revolving field Reynolds number       Reynolds stress turbulence modelrheostat 

rib     ribband riddled condition       rider keelson  rider plate     ridge pole      ridge rope     ridge support  rigger  

rigging loft     rigging plan    

Page 479: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

줄당김나사줄매기비품공장오른편꼬임우회전프로펠러복원팔복원우력righting lever 복원정righting lever curve 복원정곡선복원모멘트rigid body motion 강체운동 리지드연결장치고체식구명부기rigid type life jacket 고체식구명동의rigid type liferaft 고체식구명뗏목rigid type rescue boat 고체식구조정rigid/inflated rescue boat 복합식구조정rigidly link 강체연결림리머림드강링볼트환상격벽링윤활기링윤활베어링링윤활기선저구배riser 라이저라이저텐셔너수직소화주관밀물라이징우드risk 위험성risk acceptance criteria 위험성허용기준risk analysis 위험성평가risk assessment 위험성평가risk contribution tree 위험성기여수목risk control measure 위험성제어수단risk control option 위험성제어방안하천운항선하천포함rivet 리벳리벳재리벳머리리벳가열로리벳구멍리벳이음리벳제조기리벳끝리벳이음새리벳몸통리벳구조리벳집개리베팅기계riveting 리베팅리베팅해머리베팅기계정박지로밴드

rigging screw  rigging shop   right hand lay  right handed propeller righting arm   righting couple 

righting moment   

rigid connection device rigid type buoyant apparatus

rim    rimer  rimmed steel   ring bolt       ring bulkhead  ring lubricator ring oiled bearing      ring oiler      rise of floor   

riser tensioner rising fire main rising tide      rising wood    

river boat      river gunboat  

rivet bar       rivet head     rivet heater    rivet hole      rivet joint      rivet making machine      rivet point     rivet seam     rivet shank    rivet structure rivet tongs     riveter 

riveting hammer        riveting machine roadstead      roband 

Page 480: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

쇄암기가이드프레임쇄암용중추

rock cutter 쇄암선rock cutter dredger 쇄암 준설선착암부선

착암기리더rock wool 암면

암면보온재rocker arm 로커암

로커암윤활유펌프rocket 로켓풀크럼축rocket parachute signal 로켓낙하산신호

로켓추진로켓신호풀크럼축Rockwell hardness 로크웰 경도rod 막대rod element 봉요소roll 압연압연번호roll period 횡동요주기roll radius of gyration 횡동요회전반지름연속점용접roll vane 롤 베인단접rolled bar 압연봉강rolled product 압연재압연강rolled surface 압연면roller 롤러롤러베어링롤러체인롤러촉롤러클리어런스롤러페어리더롤러진수롤러길롤러붙이튜브확장기rolling 횡동요횡동요각 횡동요 촉 rolling door 회전문횡동요 히치 횡동요지시기 횡동요기록기 횡동요버팀 횡동요시험

로팩스로로선롤온/롤오프방식

rock breaker guide frame      rock breaking weight   

rock drilling barge     rock drilling machine leader    

rock wool heat insulating material

rocker arm lubricating oil pump 

rocket fulcrum shaft   

rocket propulsion      rocket signal   rocking lever shaft     

roll number    

roll spot welding       

roll welding    

rolled steel    

roller bearing  roller chain    roller chock    roller clearance roller fair-leader       roller launching roller path     roller tube expander   

rolling angle   rolling chock   

rolling hitch    rolling indicator rolling recorder rolling stay    rolling test     Roll-on / Roll-off Passenger (Ro-Pax)roll-on/roll-off (RO/RO) ship   roll-on/roll-off (RO/RO) system 

Page 481: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

실상수난방기root 뿌리뒷면굽힘시험뿌리캐비테이션이뿌리원뿌리끝root face 루트면root gap 루트간격Root Mean Square (RMS) 제곱평균실효값root pass 뿌리용입뿌리반지름이면용접root valve 루트밸브루츠송풍기

루츠압축기rope 로프로프벨트로프연결장치로프커터로프방현재로프가드줄매기로프해치줄사다리로프패킹로프스토퍼ro-ro cargo space 로로화물구역ro-ro passenger ship 로로여객선로즈박스로터미터회전식공기펌프벨트컨베이어회전식기관회전식펌프회전소기밸브회전테이블회전본회전식밸브rotary vane compressor 로터리베인압축기

회전베인형 조타기rotary vane vacuum pump 회전베인진공펌프

회전드럼열교환기회전식무선표지회전식경계신호등로테이터

rotor 로터로터드럼로터축로터이동공구로터선로터축개략배치도

room constant  room heater   

root bend test  root cavitation root circle     root edge      

초층용접root penetration root radius     root running   

Roots blower   Roots displacement compressor  

rope belt       rope connection device rope cutter    rope fender    rope guard     rope handling  rope hatch     rope ladder    rope packing   rope stopper   

rose box       rotameter      rotary air pump rotary conveyor rotary engine  rotary pump   rotary scavenging valve rotary table    rotary template rotary valve   

rotary vane type steering gear

rotary-drum regenerator       rotating radio beacon  rotating type warning signal lightrotator 

rotor drum     rotor shaft     rotor shifter   rotor ship      rotor spindle   rough arrangement     

Page 482: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

거친바다거친면roughness 거칠기거칠기허용값거칠기계수거칠기저항초벌검사round bar 원형격자원형선미라운드턴캠버원형거널원형거널항로routine inspectionroutine maintenance 일상보전와셔rowing 조정 노젓는배노걸이로열백스테이로열리프트로열마스트로열스테이로열야드rubber coating 고무코팅rubber hose 고무호스rubber lining shaft 고무라이닝축슬래브용골러빙스트립러빙스트립rubbish shoot 쓰레기 배출구rudder 타타각조정rudder angle 타각타각지시기타면적타 암rudder carrier 러더캐리어타커플링타방향rudder force 타력타골재타 거전타두재타 힌지러더혼로킹핀틀타심재rudder open water test 타 단독 실험rudder peller propulsion 선회식추진장치응급타체인타핀틀타피트타판rudder post 타주쿼드런트

rough sea      rough surface  

roughness allowance   roughness coefficient   roughness resistance   rough-turn inspection   환봉round bar grating round stern    round turn     round up of beam      rounded gunnel rounded gunwale       route   일상점검rove   

rowing boat    rowlock royal backstay royal lift       royal mast     royal stay      royal yard     

rubbing keel   rubbing strake rubbing strip   

rudder adjustment      

rudder angle indicator  rudder area    rudder arm     

rudder coupling  rudder directions       

rudder frame   rudder gudgeon rudder head    rudder hinge   rudder horn    rudder locking pintle   rudder main piece      

rudder pendant chain   rudder pintle   rudder pit      rudder plate   

rudder quadrant 

Page 483: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

타두재타 스토퍼러더트렁크타형규칙기반시스템rule calculation 규칙 계산rule length 선급규칙길이rule scantling 규칙 치수rules of thumb 경험에 의한 상식run 패스폭주런어바우트rung 수직사다리발판러너runningrunning back stay 항해용 뒷당김줄움직도르래running coordinate 이동 좌표계운항비헐거운맞춤움직맞춤running indicator 운전표시기running light 항해등항해등제어반해상수리동삭running stock 소모품움직줄길들이기조정운전run-out 떨림run-out time 재고소진기간회전변류기rupture disk 파열판파단시험rust 녹

녹부풀음녹연결

rust-proof oil 방청유sacrifice pipe 희생관sacrificial anode 희생 양극새들블록안장판safe distance 안전거리

자기컴퍼스안전거리safe loadsafe navigation 안전항해safe water level 안전수위safety cage 안전케이지안전캡안전칼라safety communication 안전통신safety cut-out device 안전차단 장치

rudder stock   rudder stopper rudder trunk   rudder types   rule based system     

run away      run-about      

runner  주행 (순풍범주)

running block  

running cost  running fit     running fix     

running light indicator  running repair  running rigging  운용재고running stores running wire   running-in trial 

run-rotary converter    

rupture test    Russian Maritime Register of Shipping (RS) 러시아 선급

rust blister     

rust joint       

saddle block   saddle strap   

safe distance of magnetic compass 안전하중

safety cap     safety collar   

Page 484: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

안전장치안전설비증서

safety equivalence 안전등가성safety evaluation 안전평가안전계수안전유리safety gogglessafety guard 안전덮개

안전절연변압기안전등안전링크

safety of navigation 항해안전안전무선전신증서안전봉안전스테이

safety stocksafety system 안전장치 safety valve 안전밸브

안전밸브올림기어안전밸브올림기어안전밸브봉쇄안전전압

Safety Working Load (SWL) 안전사용하중sagging 새깅sagging and running 도장흘림sail 돛돛창고돛장치도sailing 범선항법sailing condition 항해상태sailing directions 항행지침출항허가sailing ship 범선

기범선sailing vessel 범선sailor 선원살로그salinity 염분salinometer 검염계염분계통검염밸브

연어송어공장선연어송어잡이모선살롱염장선

salvage 해난구조salvage pump 샐비지펌프구난배수장치salvage ship 해난구조선

safety device  safety equipment certificate    

safety factor   safety glass     보호안경safety isolating transformer    safety lamp    safety link     

Safety Radiotelegraphy (SR) certificate    safety rod     safety stay      안전재고safety valve easing gear       safety valve lifting gear safety valve setting    safety voltage  

sail locker     sail plan       

sailing permit  

sailing ship with auxiliary engine  

sal log 

salinity temperature depth recorder 염분-온도-수심기록기salinometer pot salinometer valve      salmon and trout factory ship  salmon and trout mother ship  saloon salting carrier  

salvage pump unit      

Page 485: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

통선등시료채취연기탐지장치 시료채취용배관

sampling point 표본채취위치샘슨포스트모래밸러스트모래톱샌드빈sand blast 샌드블라스트모래반목모래상자모래운반선샌드콤팩션 부선모래분배장치샌드드레인선모래시계모래누름장치샌드호퍼샌드드레인선모래펌프준설선모래뿌림선모래면게이지sandwich structure 샌드위치구조sanitary 위생수sanitary discharge 위생배수구

위생청수탱크위생의장품위생파이프위생펌프위생해수탱크위생탱크위생배관공사

sapwood 백목질sash 새시새시도어

위성통신장치위성비상조난위치발신기

saturated steam 포화증기포화증기관saturation temperature 세이볼트퓨롤

세이볼트유니버설scaffold 발판scaffolding erection 발판설치scaffolding removal 발판철거scale 스케일scale 척도척도효과

눈금밝기조정눈금판축척비

sampan signaling light sample extraction smoke detection systemsampling line   

Samson post   sand ballast    sand bank      sand bin       

sand block     sand box       sand carrier    sand compaction barge  sand distributing device sand drain barge       sand glass     sand hold down device sand hopper   sand piling barge      sand pump dredger    sand spreader  sand top level gauge   

sanitary fresh water tank      sanitary outfit  sanitary pipe   sanitary pump  sanitary sea water tank sanitary tank   sanitary worker 

sash door      SATellite COMmunication (SATCOM) 위성통신satellite communication system satellite EPIRB 

saturated steam pipe    포화온도saybolt furol(SSF) saybolt universal(SSU)

scale effect    scale illumination control       scale plate     scale ratio     

Page 486: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

녹털기봉녹털이망치관석생성률스캘럽scantling 치수scantling criteria 치수기준강도계산용흘수치수계수scarf 스카프이음스카프용접scarfing 스카핑scarfing bracket 스카핑브래킷스카프이음스카프커플링스카프절삭기소기통로소기통로scavenging 소기

소기실화재경보소기모음

scavenging blow 소기용송풍기소기효율소기공소기펌프소기행정소기밸브schedule 스케줄schedule impactschedulingscheduling and control 일정계획및 관리schema 스키마schematic piping diagram 배관계통도schooner 스쿠너스팬가이schooner rig 스쿠너범장scientific management 과학적 관리법섬광계수기scoop 스쿠프스코치보일러정찰함비상정지스크랩scratch 스크래치screen 스크린선등가리개칸막이격벽걸름효과screw compressor 스크루형압축기나사식컨베이어나사깍기기계

나사조임식 체크밸브screw gauge 나사게이지나사식잭

scaling bar     scaling hammer scaling rate    scallop 

scantling draft       scantling number       

scarf weld     

scarp scarped coupling      scarping machine     scavenge air belt      scavenge air passage  

scavenging air box fire alarm     scavenging air receiver 

scavenging efficiency  scavenging port scavenging pump       scavenging stroke      scavenging valve       

공정영향일정계획

schooner guy  

scintillation counter    

Scotch boiler   scout  scram  scrap  

screen board   screen bulkhead        screening effect 

screw conveyor screw cutting machine Screw Down Non-Return (SDNR) valve

screw jack     

Page 487: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스크루플러그screw propeller 나선프로펠러나선추진기선screw pump 스크루펌프프로펠러축몽키스패너나사버팀나사식조타장치스터드볼트

나사식닻줄멈추개몽키스패너나사식플랜지나사식유니언나가깍기기계스크라이브보드자국칼

scrubber 스크러버scrubber unit 자급기잠수호흡기순주스컬scullery 식기세척대수면불어내기콕물때접시물때접시수면불어내기밸브scupper 갑판배수구현창sea area A1sea area A2sea area A3sea area A4sea chest 해수흡입구

해수흡입구청소밸브해수흡입격자해수흡입격자해면반사해수콕

sea color class 씨컬러급해상상태해수연결입사파방향sea discharge 해수배출sea hopper class 씨호퍼급sea inlet 해수흡입친항성시마진해리sea pressure 해수압해난보고서sea scale 파랑등급sea scatter diagram 파랑빈도분포물튀김막항해속력해상상태

screw plug     

screw propeller ship     

screw shaft    screw spanner screw stay     screw steering gear    screw stud     screw type chain stopper      screw wrench  screwed flange screwed union screwing machine      scribe board   scribe knife    

가스세정기scuba  scudding       scull   

scum cock     scum dish      scum pan      scum valve    

scuttle sea anchor      시-앵커

A1해역A2해역A3해역A4해역

sea chest cleaning valve       sea chest grating      sea chest grid sea clutter     sea cock       

sea condition   sea connection sea direction   

sea kindness   sea margin     sea mile       

sea protest    

sea screen     sea speed      sea state       

Page 488: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

해수흡입밸브sea trial 해상시운전해상시운전속력해수밸브해수여과기

물소화장치해수압력탱크해수윤활식선미관베어링해수관해수압력탱크해수서비스펌프해수여과기해저자원탐사선해저광물채취선선원

seagoing 대양운항seagoing condition 항해상태항해성능원양선내항성seal weld 누설방지용접물개잡이배sealing 밀봉sealing air 밀봉용 공기밀봉용 물seam 이음매seam 심심 용접선원운용술Seamen Act 선원법

해기면장seamless pipe 이음매없는관seamless sail 일체형 돛이음매없는관수상기모함search & rescue 수색및 구조searchlight 탐조등시효균열동기계절대시효처리seating 거치대자리파기 링감항성좌현큰닻second independent means

second moment of inertiasecond source of energysecond systemsecondary

sea suction valve      

sea trial speed sea valve sea water filter sea water fire extinguishing system sea water hydrophore unit   sea water lubricated stern tube bearing sea water pipe sea water pressure tank       sea water service pump sea water strainer     seabed exploring ship  seabed mining ship     seafarers      

seagoing qualities     seagoing vessel       seakeeping     

sealer  

sealing water  

seam welding  seaman seamanship    

seamen's competency certificate

seamless tube  seaplane carrier 

season crack   seasonal winter zone   seasoning      

seating ring    seaworthiness  second bower  second deck    제2갑판제2 독립수단 second moment of area  단면2차모멘트관성2차모멘트

2차에너지원제2의 계통 2차측

secondary barrier        2차방벽secondary battery       2차전지

Page 489: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

section 단면구전반section modulus 단면계수형강section view 단면보기

단면적계수단면적곡선조합보일러섹셔널헤더분호손잡이

securing arrangement 고박설비securing device 고박장치securing plate 고정판sediment 침전물침전물받이침전물받이침전물받이sediment davit 오물인양용 대빗제거콘분리밸러스트탱크segregation 편석시징로프선택차단self ignition 자연발화자기발연신호

자동조절식드래그헤드self-cleaning 자정작용self-closing 자동폐쇄형자동폐쇄밸브self-contained 자기기전식

자장식공기흡입구갑판승강형굴착선자기점화등

self-ignition temperature 자연발화온도자력제어자기마모형도료자기마모형도료

self-priming pump 자흡식펌프self-propelled condition 자항상태

그래브붙이자항운반선

secondary cell  2차전지secondary cooling air   2차냉각공기secondary distribution   2차배전secondary electro motive force (2nd EMF) 2차기전력secondary flow        2차유동secondary loss  2차손실secondary member      2차부재secondary pinion        2단피니언secondary source       2차전원section board  

section steel   

sectional area coefficient      sectional area curve   sectional boiler sectional header       sector secure hand    

sediment box  sediment chamber      sediment collector     

Seger cone    Segregated Ballast Tank (SBT)

seizing rope   selective trip   

self-activating smoke signalself-adjustable type drag head 

self-closing valve      

self-contained air-breathing apparatusself-elevating drilling unit      self-igniting light      

self-operated control   Self-Polishing Copolymer (SPC)Self-Polishing Copolymer (SPC)

self-propelling grab hopper barge

Page 490: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

자항계수자항시험자기조절오뚝이형구명정

self-unloading cargo gear 자체하역설비세마포르신호세미킬드강준선미기관선반자동용접반평형타

semi-block 중조립단계 블록반상자형보반조립크랭크축

semicircular deviation 반원차반밀폐사이클semi-container ship 세미컨테이너선소구기관semi-membrane tank 세미멤브레인탱크반문형기중기저온압력식 가스운반선semi-spade rudder 세미 스패이드 타semi-splitting FEM 반분리 유한요소법습식선대반잠수식시추선

반잠수식플랫폼semi-submersible ship 반 잠수선semi-tandem 세미탠덤방식세미윙블레이드송신장치센하우스슬립센스안테나감도현열sensitivity 감도감도조정

감도시간조정박리유동분리기

sequence of welding

순차근사최적화순차제어

sequential operation 순차동작 순차이차계획법

sequential start

직렬흐름터빈직렬용접직권직류발전기세레이션서비스볼트항해상태

self-propulsion factor  self-propulsion test    self-regulation self-righting type life boat     

semaphore     semi killed steel       semi-after engined vessel      semi-automatic welding semi-balanced rudder  

semibox beam semi-built-up crankshaft       

semi-closed cycle      

semi-diesel engine     

semi-portal crane      semi-pressurized gas carrier

semi-submerged slipway       semi-submersible drilling rigsemi-submersible platform     

semi-wing blade       sending set    senhouse slip  sense antenna  sensibility      sensible heat   

sensitivity control      Sensitivity Time Control (STC)separated flow separator  용접순서sequential approximate optimizationsequential control      

sequential quadratic programming 순차기동series construction of ship 시리즈선 건조series flow turbine     series welding series wound dynamo  serration       service bolt    service condition       

Page 491: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

service feature 특기사항service life 유효기간서비스록service spaces 업무구역service speed 운항속력서비스탱크serviceability limit state 사용한계상태servicing 사용줄밀기망치servo vane 서보날개서보식제어서보기구서보모터날개날올림설정값정정시간침전탱크set-up time 준비시간sewage 오수오수집합탱크

오수배출장치sewage disposal 오수펌프

오수흡입장치오수탱크

sewage treatment plant 분뇨처리장치육분의shackle 섀클섀클볼트차양갑판섀도핀불감구역shaft 축축계정렬축각축베어링선미관통함shaft bracket 축브래킷축브레이크축심투시축콘파트축커플링감축운전시험축계접지장치shaft eccentricity 축기진력축계접지장치shaft guard 샤프트가드샤프트행어Shaft HorsePower (SHP) 축마력축마력계shaft immersion 축심깊이축심깊이비축선축라이너축자유회전방지장치

service lock    

service tank   

serving mallet  

servo-actuated control servo-mechanism      servo-motor   set-back       setpoint setting time    settling tank   

sewage collecting tank sewage discharge apparatus     오수처리sewage pump  sewage suction apparatus      sewage tank       

sextant 

shackle bolt    shade deck    shadow pin    shadow section 

shaft alignment shaft angle     shaft bearing   shaft box      

shaft brake    shaft center sighting  shaft cone part shaft coupling  shaft cut-off test      shaft earthing device    축편심shaft force     shaft grounding device 

shaft hanger   

shaft horsepower meter 

shaft immersion ratio  shaft line      shaft liner     shaft locking device    

Page 492: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

축출력계축동력축경사shaft seal 축밀봉장치축슬리브축받이대축로축관축로shaft withdrawal plan 축발출계획서shafting 축계축계장치도축전달효율셰이크다운기진기shallow water 천수얕은수로shallow water effect 천수효과천수파 shape 형상물shape 형강 shape function 형상함수 유형단면셰이핑머신저온동결법shear 전단shear capacity 전단능력shear force 전단력shear force correction 전단력수정전단력곡선전단파괴전단지연전단탄성계수shear strength 전단강도전단응력전단진동전단기피복갑판피복선피복시브shedder plate 쉐더판sheer 현호선미현호선수현호현호선측면선도sheer strake 현측후판sheering burrs 전단절단자국sheet 조정줄예비앵커시트밴드판굽히개얇은층캐비테이션sheet metal 박판sheet metal forming 박강판sheet stopper 조정줄 고정구

shaft output meter     shaft power    shaft rake      

shaft sleeve    shaft stool     shaft trunk     shaft tube      shaft tunnel    

shafting arrangement   shafting efficiency      shake-down    shaker 

shallow water channel 

shallow water wave 

shaped section shaping machine       sharp freezing 

shear force curve   shear fracture  shear lag      shear modulus 

shear stress   shear vibration shearing machine      sheathed deck sheathed vessel sheathing      sheave 

sheer aft       sheer forward  sheer line      sheer plan     

sheet anchor   sheet band     sheet bender   sheet cavitation 

판금성형sheet steel     

Page 493: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

시트트래블러shelf 갑판보받침대shelf plate 스툴정판shell 외판쉘엔튜브형열교환기shell door 현측문shell envelop 외각shell expansion plan 외판전개도shell fitting 외판부착물shell frame 외판늑골외판러그외판차랑갑판차랑갑판선sheltered water 보호된수역아연피복법막이판

피복 아크용접피복아크용접봉피복아크용접

shielding gas 피복가스shift 회항횡이음띄우기

조선윈치해치빔이송펌프

shifting-board 시프팅보드시프팅보드버팀기둥shim plate 높이조절판중성자제어봉자갈밸러스트선박해체업자선체중심선선구상ship construction contract 선박건조계약Ship Control Console (SCC) 조타실제어콘솔ship conversion

선박지구국선박방식연결등함운용지침서선박검사증서선박검사

ship motion 선체운동선번ship repair yard 수리조선소ship reporting system 선박보고제도선박안전법

선박보안경보시스템잡용공기압축기잡용공기탱크선체횡단면

sheet traveler  

shell & tube heat exchanger

shell lug       shell plate    shelter deck   shelter decker 

sheradizing     shield plate    Shielded Metal Arc Welding (SMAW)shielded-arc electrode shielded-arc welding   

shift of butts   shifting and mooring winch     shifting beam  shifting pump  

shifting-board stanchion 

shim rod       shingle ballast ship breaker   ship center line ship chandler  

선박개조Ship Earth Station(SES) ship illumination lamp  Ship Information Book (SIB)ship inspection certificate      ship inspection 

ship number   

Ship Safety Law       Ship Security Alert System (SSAS)ship service air compressor    ship service air reservoir      ship shape     

Page 494: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

ship steel 조선용강재조선용강판선체강도선체구조ship to ship 선박 대 선박 선박톤수ship type

선내소화장치shipboard incineration 선내소각

선박산업안전보건 프로그램선박기름오염비상계획

shipborne barge 선박적재부선선내항해기구선박용 비자기적 수단조선소적하선주하송인shipping of water 해수침입 선적지시서

선박통행신호소일반용보기호종선저액체화학품산적운반선액화가스산적 운반선선구선등선용항해일지

ship's manning 선박 인원배치 선박직원전파식선박속력측정장치

shipside valve 선체부착밸브조난선shipwright 조선목공shipwright shop 조선목공장shipyard 조선소모래톱완충기shock pulse monitoring 충격펄스감시shock wave 충격파무충격입사슈피스쓰레기구멍shop 공장shop loading information 공장부하정보shop primer 숍프라이머육상시험공장시운전shore 지주

ship steel plate ship strength   ship structure  

ship tonnage    선종shipboard fire-extinguishing system

Shipboard Occupational Health and Safety Program (SOHSP)Shipboard Oil Pollution Emergency Plan (SOPEP)

shipborne navigational aidsshipborne non-magnetic meansshipbuilder     shipment       shipowner      shipper 

Shipping Order(SO) shipping traffic control signal station   ship's auxiliary machinery    ship's bell    ship's bottom ships carrying liquefied chemicals in bulkships carrying liquefied gases in bulkship's fitting  ship's light   ship's logbook 

ship's personnel      ship's speed radio measuring equipment

shipwreck    

shoal  shock absorber 

shock-free entry       shoe piece     shoot  

shop test      shop trial    

Page 495: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

shore based radio system 육상무선장치shore connection 육상연결구선외급전상자shore facility 육상시설Shore hardness 쇼어경도shore power receiving 선외급전shore to ship 육상대선박 shore-based facilities 육상 기지국shore-based maintenance 육상정비shoring 쇼어링short bead 쇼트비드단성연료소진short circuit 단락단락전류short circuit protection 단락보호장치short circuit test 단락스위치short duration voyage 단기간항해단늑판

단거리국제항해쇼트링크쇼트스테이단구간푸리에변환

short voyage 단거리항해저수위단파정해양파shotshot blasting 숏블라스팅shot peening 숏피닝어깨탱크수축여유수축균열shrinkage fitting 수축박음shrinkage margin 수축여유주물자주물자수축응력shroud 슈라우드shroud chain plate 슈라우드 사슬고정판shroud lines 슈라우드 밧줄선보호된날개

슈라우드프로펠러정체장치누름쇠분권발전기분권조정기분권직류발전기

shutdown 정지차단밸브shuttle tanker 셔틀탱커병실현측팔현측장갑

shore connection box  

short blast     short bunker   

short circuit current    

단락시험short circuiting switch 

short floor frame      short international voyage      short link      short stay      Short Time Fourier Transform (STFT)

short water    short-crested seas      체인 1연shoulder tank  shrinkage allowance    shrinkage crack 

shrinkage rule shrinkage scale shrinkage stress       

shrouded blade 

shrouded propeller     

shrouding device       shrouding ring shunt generator shunt regulator shunt wound dynamo 

shutoff valve   

sick bay       side arm       side armor     

Page 496: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

측판용골옆굽힘시험빌지블록side bottom 선저선측현측연료고선측내장창구측면연재선저복수기측면도측면필릿용접선측늑골side girder 측거더현측개폐호퍼선측갑판실측내용골옆진수선측종늑골side opening 현측차양측판재화문side ramp 현측램프side scuttle 현창현창안덮개현창바깥덮개side shell 선측외판side shell base 외판베이스side shell door 선측외판문선측외판선측지주선측내장사이드스토퍼선측스트링거사이드스러스터선측트랜스버스세류각선측빌지홈선측외륜선sidelight 현등현등격판사이드라인윈치표류옆진수폭sight glass 관찰유리구멍눈구멍방위날개sighting ports 관찰용개구시그마용접signal 신호호종푸른불꽃신호신호서신호기신호등호출부호신호표시등붉은불꽃신호

side bar keel  side bend test  side block     

side bunker    side ceiling    side coaming   side condenser side elevation  side fillet welding      side frame     

side hopper barge     side house     side keelson   side launching  side longitudinal  현측개구side owning    side plate      side port       

side scuttle blind       side scuttle plug       

side shell plate side shore     side sparring   side stopper   side stringer   side thruster   side transverse side wash angle side water course  side wheel steamer    

sidelight screen       sideline winch sideslip sideway launching      siding  

sight hole      sight vane     

SIGMA welding 

signal bell     signal blue light signal code book       signal flag     signal lamp    signal letter    signal light indicator   signal red light 

Page 497: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

신호야드기적신호등탐조신호등유의파고유의파주기 침묵시간소음기실리콘제어정류기실크룸문턱

silt protector 오탁방지막은납땜silver brazing coupling 은납땜카플링은납땜상사모형상사성상사성simple beam theory 단순보이론

단순가스터빈사이클단식여과기단식노즐분무기단식타단식여과기

simplified calculation 간이계산간략화된 피로해석simply supported 단순지지심프슨공식simulation 시뮬레이션 기반 설계울림단동기관단동펌프단묘박독방싱글베벨홈단식도르래single bottom 단저

단저구조single bottom girder 단저거더

단선접지식single control device 단일제어장치단기통기관single groove 편면개선편면홈용접single loading pattern 단일적하상태

단식용접기단상단판타

Single Point Mooring (SPM) 일점계류

signal yard     signaling light for air horn     signaling searchlight   significant wave height significant wave period  silence periods silencer Silicon Controlled Rectifier (SCR)silk room      sill     

silver alloy brazing     

silver soldering similar model  similarity       similitude      

simple gas-turbine cycle       simplex filter  simplex nozzle atomizer simplex rudder simplex strainer 

simplified fatigue analysis

Simpson's rule  모사Simulation Based Design (SBD)singing single acting engine    single acting pump     single anchor mooring  single berth cabin      single bevel groove    single block    

single bottom construction     

single bunk     1단침대single conductor earthed system

single cylinder engine  

single groove welding  single handrail  1단난간single operator welding machinesingle phase   single plate rudder     

Page 498: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

일점계류부이단극스위치단공미끄럼밸브단기통펌프

single roll amplitude 단일횡동요진폭single screw ship

단면전단Single Side Band (SSB) 단측파대통신방식한쪽흡입임펠러

단일저장에너지 단일스팬일반보강재단단

single strake single summation 단일중첩단연크랭크축단선식배선방식

sink 싱크싱커사이렌시로코존방식시스터훅자매선site welding 현장용접치수효과필릿크기skeg 스케그skeg rudder 스케그타골조도알몸배수량조립늑판얇은스패너스켈프스케치판skew 스큐스큐각스큐베벨기어스큐범위스큐비skew-back 스큐백

스큐유기축방향변위스키드보스키드갑판

skid plateskiff 스키프skimming 스키밍skin 외판

Single Point Mooring (SPM) buoysingle pole switch      single ported slide valve       single pump    single reduction gear    1단감속장치single riveted joint      1열리벳이음single riveting  1열리베팅

1축선single screw vessel     1축선single shear    

single sided impeller   single source of stored energysingle span ordinary stiffenersingle stage    

1조의 강판single throw crankshaft single wire system     single-J groove  편면제이(J)형홈single-U groove        편면유(U)형홈single-V groove        편면브이(V)형홈sinker  siren   sirrocozone system    sister hook    sister ship     

size effect       size of fillet weld      

skeleton diagram       skeleton displacement    skeleton floor  skeleton spanner       skelp  sketch plate    

skew angle    skew bevel gear       skew extent   skew ratio     

skew-induced axial displacementskid beam      skid deck       활판

Page 499: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

skin friction 표면마찰표면마찰저항마찰유효마력표면마찰저항띔용접스킵잭어선소형선선장skirt 스커트skirt plate 스커트판걸레받이상공파skylight 천창천창개폐장치천창개폐장치slab 슬래브코르크판슬래브용골분탄slack load 슬랙적하게조slag 슬래그슬래그망치슬래그혼입슬래그울슬래밍슬래핑종국대형해머마루판받침sleeve 슬리브sleeve joint 슬리브이음

슬리브식신축관이음슬리브밸브세장비선회식크레인선회식파일드라이버불갈퀴봉슬라이드블록

slider 슬라이더이동캠축식이동실린더왕복동기관미닫이문미끄럼틀슬라이딩 다중격자기법

sliding watertight door 미닫이수밀문진수미끄럼대저농축연료보트걸이훅슬링걸이장치

slip 슬립슬립각역류슬립볼트슬립율슬립훅

skin friction resistance skin horse power      skin resistance skip welding   skipjack pole and line  skipper 

skirting board  sky wave      

skylight operating gear skylight quadrant       

slab cork      slab keel       slack coal      

slack water    

slag hammer   slag inclusion  slag wool      slamming       slapping slave station   sledge hammer sleeper 

sleeve type expansion pipe joint  sleeve valve   slenderness ratio       slewing crane  slewing type pile driver slice bar       slide block     

sliding cam shaft type sliding cylinder double acting engine   sliding door    sliding frame   sliding multiblock technique

sliding way    slight enriched fuel    sling hook     sling wire handling device      

slip angle      slip back       slip bolt slip factor     slip hook       

Page 500: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

슬립비슬립링프로펠러후류미끄럼방지발판삽입경납땜플랜지삽입용접플랜지slipper 슬라이드블록slipway 선대선대진수sloop 슬루프sloop rig 슬루푸범장슬롭탱크slope 기울기슬로프얼라인먼트슬로프보링sloping plate 경사판sloping ramp 적하램프sloshing 슬로싱sloshing mode effect 슬로싱모드효과slot 슬롯slot hole 작은 구멍슬롯용접홈파인거더홈파인웨브슬로팅기계slow drift motion 장주기표류운동slowdown 감속 sludge 슬러지슬러지관슬러지펌프sludge tank 슬러지탱크슬러깅미닫이밸브small arms locker 소병기고좌현큰닻나사버팀소형관식 보일러

최소수선면적쌍동선smear 흠집스미스수정스미스효과연기실연색도smoke damper 연기댐퍼smoke detection system 연기탐지장치연기탐지기방연헬멧smoke indicator 매연지시기

연관식화재경보장치연막

smoke tube 연관연관식보일러흡연실매끈한면smooth water area 평수구역평수구역 항해

slip ratio       slip ring       slip stream     slip-free surfaces underfootslip-on brazing flange  slip-on welding flange 

slipway launching      

slop tank      

slope alignment slope boring   

slot welding    slotted girder  slotted web    slotting machine 

sludge pipe    sludge pump   

slugging sluice valve    

small bower    small stay      small tube type boiler  Small Water plane Area Twin Hull (SWATH)

Smith correction       Smith effect    smoke box     smoke chart   

smoke detector smoke helmet  

smoke pipe fire alarm system  smoke screen  

smoke tube boiler      smoking room  smooth surface 

smooth water area navigation

Page 501: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소화증기관S-N curve 둥근머리리벳snap shackle 자동걸쇠개폐식도르래누설밸브snip 스닙스닙끝snipe class 스나이프급

미국조선학회대한조선학회

socket 소켓박스스패너소다콕sodium vapor light 소프트패킹소프트패치

심층혼합처리선연납

soft toe 소프트 토연수연질목재소프트웨어공학진흙함률계오수관

solar batterysolar heat gain 태양열 이득땜납soldering 땜질납땜인두압력단자solenoid valve 전자밸브solepiece 솔피스Sol-Gel Method 고체밸러스트일체주물일체크랭크인발관실체늑판단재늑골고체연료무공기분사solid part protrusion 일체형부품의 돌출부중실기둥단판늑골일체프로펠러중실축

반도체식압력계반도체식온도계중실원형기둥경화제이송펌프

smothering steam pipe  에스-엔 선도snap head rivet 

snatch block   sniffing valve  

snip end       

Society of Naval Architects & Marine Engineers (SNAME)Society of Naval Architects of Korea (SNAK)

socket spanner soda cock       나트륨등soft packing    soft patch      soft seabed solidifying barge   soft solder     

soft water     soft wood      software engineering   soil concentration meter       soil pipe        태양전지solder  

soldering iron  solderless terminal     

졸-겔법solid ballast    solid casting   solid crank     solid drawn tube       solid floor     solid frame    solid fuel      solid injection  

solid pillar     solid plate frame       solid propeller solid shaft     solid state type pressure gauge solid state type thermometer   solid tubular pillar     solidifying material transfer pump

Page 502: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

솔리디티고립파용해도sonar 음향탐지기sonar equipment room 음탐장비실초음파발광soot 수트soot blower 수트블로어sorbite 소르바이트에스오에스흡음sound insulation 차음

방음구조방음문음향인텐시티소음계음향파워레벨음력식전화기음압레벨방음문방음재

sound reception system 음향수신장치

sound signal 음향신호sound signal appliances 음향신호장치

음향차폐지수sound transmission loss 음향전달손실sounding 측심측심판측심도표측심연축심기측심관측심봉측심자측심표source 소스source distribution method 소스분포법space heater 스페이스 히터spacer 스페이서spacing 간격spade rudder 스페이드타span 스팬스팬가이스팬포인트spanker 스팽커스패너멈추개원주부표선창내장재스파바니시예비앵커spare charge 예비소화제

solidity solitary wave  solubility       

sono-luminescence     

SOS    sound absorption    

sound insulation construction   sound insulation door  sound intensity sound level meter      sound power level     sound powered telephone      sound pressure level   sound proof door      sound proof material   

Sound Transmission Class (STC)

sounding board sounding diagram      sounding lead  sounding machine      sounding pipe  sounding rod   sounding scale sounding table 

span guy       span point     

spanner guard spar buoy      spar ceiling    spar varnish   spare anchor   

Page 503: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

예비석탄고예비품예비실불꽃막이스파크분배기스파크간격스파크점화기점화플러그선창내장재spatial accuracy 공간정확도spatial analysisspatial Fourier transform 공간 푸리에 변환spatter 튕김튕김손실전성관특별해역special category space 특수분류구역

특수유연와이어로프특수용도선특수강정기검사연료소비율비중

specific heat

정압비열정적비열절대습도비출력비속력비체적비중

specification 시방서안경형 보스spectacle flange 스펙터클 플랜지안경형선미골재

안경형축브래킷spectacle-blank flange 스펙터클맹플랜지spectral analysis 스펙트럼해석spectral method 스펙트럴 방법spectrum 스펙트럼스펙트럼레벨speed 속력

속력 및 거리측정장치 속력계수속력표주속력오차수정기속력오차

speed governor 조속기속장비선속계선속저하speed of advance 전진속력

spare coal bunker      spare parts    spare room    spark arrester spark distributor       spark gap      spark igniter   spark plug     sparring 

공간해석spatter loss    speaking tube  special area    

special flexible wire rope      special purpose ship    special steel   special survey Specific Fuel Consumption (SFC)specific gravity  비열specific heat at constant pressurespecific heat at constant volumespecific humidity       specific power specific speed specific volume specific weight 

spectacle bossing      

spectacle stern frame  spectacle type shaft bracket   

spectrum level 

speed and distance measuring devicespeed coefficient       speed cone    speed error corrector  speed error    

speed length ratio   speed log      speed loss     

Page 504: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

프로펠러전진속력대지속력감속속력텔레그래프속력시험속력시운전속력계아연

spherical tank 구형탱크범킨슈피겔철spigot 스피것스피것이음누설손실누설멈추개스필탱크가감밸브

부유유수인입장치spindle 스핀들스핀들축스핀들토크spinnaker 스피니커spinnaker pole 스피니커 봉스파이럴베벨기어spiral column 나선형컬럼spiral duct 나선형덕트나선형조종시험스파이럴프로펠러와선형스프링수준기내부요판물튀김막이스플라이스spline 스플라인스플라인축방풍격벽분할난방분할핀

스플릿프라이머리형감속장치스플릿세컨더리형감속장치양력감소장치바퀴살스펀지꼴

sponson 내다지내다지보내다지갑판자연연소자연발화spool piece 스풀피스점가열spot inspection 점용접spray coating 분무도장

speed of advance of a propellerspeed over the ground speed reduction speed telegraph speed test     speed trial     speedometer    spelter 

spider  Spiegeleisen   

spigot joint    spill loss       spill strip      spill tank      spill valve     spilled oil collecting device    

spindle axis    spindle torque 

spiral bevel gear       

spiral maneuvering test spiral propeller spiral spring   spirit level     spirketting     splash proof   splice  

spline shaft    splinter bulkhead       split heating   split pin split primary type reduction gearsplit secondary type reduction gearspoiler spoke  spongy surface appearance     

sponson beam  sponson deck  spontaneous combustion spontaneous ignition   

spot heating    현장검사spot welding   

Page 505: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

분무노즐물보라막이살수펌프물보라저항spray type 사수식물보라막이띠spread 동체기준면간거리활주대가로지주spreader 버팀재spreader chip cup 버팀재 칩컵spreader through bar 버팀재 관통 막대스프링완충기스프링라인스프링안전밸브스프링강대사리스프링와셔스프링잉살수전살수장치체인홈바퀴spud 스퍼드스퍼드캐리지스퍼드갠트리스퍼드승강장치스퍼드홀더스퍼드키퍼스퍼드웰스퍼드윈치스퍼드와이어로프꼬임올패킹평톱니바퀴평톱니큰바퀴물막이판자square 직각자square bar 각강격자평행부각형홈부망어선가로돛배가로돛분할스테이션각형선미각나사squareness 직각도밀어굽히개바구니형

세인트로렌스시웨이신호등stability 복원성stability 안정성

조종성미분계수복원력곡선도북쪽상방표시북쪽상방표시

spray nozzle   spray proof    spray pump    spray resistance       

spray-strip     

spread shore   

spring buffer   spring line     spring safety valve     spring steel    spring tide     spring washer  springing       sprinkler head sprinkler system       sprocket wheel spud carriage  spud gantry    spud hoisting equipment spud holder    spud keeper   spud well      spud winch    spud wire rope spun yarn packing      spur gear      spur wheel     spurn water    

4각봉square bar grating     square body square groove square netter  square rigged vessel   square sail     square station  square stern   square thread  

squeezer       squirrel cage type     St. Lawrence sea way signal lightSt.Venant's moment of inertia 산부난의 단면2차모멘트stability and control derivatives stability curve stabilized display       stabilized PPI  

Page 506: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

감요장치안정평형stage 단stage 발디딤판

도시단효율단효율단내부효율발판판자단압력단온도지그재그단속필릿용접지그재그리베팅엇갈림관배치

staggered welding 지그재그용접staging 정체점정체압력Stainless Steel (STS) 스테인레스강staircase 계단실stairwaystakeholder 이해당사자실속stalling load 스톨링하중형단조stanchion 지지대스탠드파이프스탠드파이프스탠드롤러스탠드식자기나침반standard check list 표준점검항목표표준나침반표준상태standard design 표준설계표준편차표준화재시험

선박소방설비기준선박구명설비기준선박방화구조기준선박설비기준표준담수표준호깅상태

standard magnetic compass 표준자기나침반스탠드파이프기준압력계

standard quarter deck 표준저선미루갑판표준새깅상태표준해수표준단면형재

stabilizer       stable equilibrium      

stage diagram efficiency       stage efficiency stage internal efficiency stage plank    stage pressure stage temperature      staggered intermittent fillet weldstaggered riveting      staggered tube layout  

작업대stagnation point stagnation pressure    

계단stall   

stamp forging  

stand column   stand pipe     stand roller    stand type magnetic compass  

standard compass      standard condition      

standard deviation      standard fire test      standard for ship fire-fighting appliancesstandard for ship life-saving appliancesStandard for Ship's Construction for Fire Protectionstandard for ship's facilitiesstandard fresh water   standard hogging condition     

standard pillar standard pressure gauge       

standard sagging condition     standard salt water    standard section       

Page 507: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

표준현호표준선standard specification 표준시방서standard timestandard tolerancestandard voltage 표준전압

표준전압방식표준파

Standard Wire Gauge (SWG) 와이어게이지규격standardization 표준화표준시운전표준검정기예비발전기예비기예비전원stand-by unit 대기장치고정줄standing rigging 지지용 줄장치고정줄정상파고정줄꺽쇠성형결선starboard 우현우현큰닻우현부표starboard side 우현starboard tack 우현 택기동기starting air 시동공기시동용공기압축기starting air distributor 시동공기분배관시동용공기관starting air pressure 시동공기압력시동공기탱크시동공기밸브starting and runoff tabs 용접 착수완료탭starting arrangement 시동장치starting cam 시동캠starting current 기동전류시동장치starting operation 시동조작시동서보모터시동장치시동시험starting transformer 시동용 변압기시동밸브상태점static 정적static electricity 정전기 정적연료소비량정하중static pressure 정압static stability 정적복원력static tank pressure 정적탱크압력정적시험정지추력계수

standard sheer standard ship  

표준시표준공차standard voltage system       standard wave 

standardization trial    standardizing box      stand-by generator    stand-by machine     stand-by power 

standing line   

standing rigging standing wave standing wire  staple  star connection 

starboard bower anchor starboard hand buoy   

starter 

starting air compressor 

starting air pipe 

starting air reservoir   starting air valve       

starting gear   

starting servo-motor   starting system starting test    

starting valve  state point      

static fuel consumption static load     

static test      static thrust coefficient 

Page 508: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

정압과급방식정적평형정적복원력

station 무선국station 스테이션station bill 비상배치표정상파

정치용접기statistical analysis 통계해석

통계적에너지해석법통계적품질관리

statistical wave scatter 통계적파랑빈도분포stator 고정자고정자날개고정자날개고정자권선법정갑판선법정건현statutory spare parts 법정예비품스테이볼트스테이세일지주관steady 스테디정상캐비티스테디정상유동스탠드파이프steady state 정상상태최소크리프율정상영역정상선회안정선정상풍정상영역steady-turning diameter 정상선회지름stealth technology 스텔스기술steam 증기증기축적기증기분사추기통기기정증기보일러증기열량계증기실증기모임통증기소비량증기실린더증기돔증기드럼증기기관steam generating system 증기발생장치증기발생기증기글랜드증기해머

static turbo-charging pressure systemstatical balancing       statical stability 

stationary wave stationary welding machine     

Statistical Energy Analysis(SEA) statistical quality control

stator blade    stator vane    stator winding  statutory deck line     statutory freeboard     

stay bolt       stay sail       stay tube      

steady cavities steady course       steady flow    steady pipe    

steady state creep rate steady state zone  steady turning steady vessel  steady wind    steady zone    

steam accumulator     steam blast    steam bleeding steam blow    steam boat     steam boiler   steam calorimeter      steam chest    steam collector steam consumption     steam cylinder steam dome    steam drum    steam engine  

steam generator       steam gland    steam hammer 

Page 509: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

증기난방기증기가열코일증기가열관기적증기정증기미터증기관steam pressure 증기압력증기압력계증기방열기증기리시버steam reciprocating engine 증기왕복동기관수증기분리기드럼기선증기사이렌증기소화장치증기실증기여과기증기표증기트랩steam turbine 증기터빈증기터빈선기적증기윈치증기양묘기증기요트steaming 증기세척증기압상승시험steel 강강재적치장강제브래킷steel castingsteel core 강제 심steel cutting 강재절단steel deck 강갑판강제갑판실강제창구덮개강제호저강괴steel ordering 강재주문강관

고압배관용탄소강관저온배관용강관강판강선

steel stockyard 강재적치장steel tower scaffold 고정식작업대강관steel wire 강선강선외장강재적치장steepest descent method 최속강하법조타성능

조종식덕트프로펠러steerage 조타성능

steam heater   steam heating coil     steam heating pipe     steam horn    steam launch   steam meter   steam pipe     

steam pressure gauge  steam radiator steam receiver 

steam separator drum      steam ship     steam siren    steam smothering system      steam space   steam strainer steam table    steam trap     

steam turbine ship     steam whistle  steam winch   steam windlass steam yacht    

steaming test  

steel bay   steel bracket    주강

steel deck house       steel hatch cover      steel hawser   steel ingot     

steel pipe      Steel Pipes For High Pressure Service (STS)Steel Pipes for Low Temperature Service (SPLT)steel plate     steel ship      

steel tube      

steel wire armor      steel yard      

steerability     steerable ducted propeller     

Page 510: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

steerage passenger 보통여객보통여객실최저타효속력steering 조타조타장치조타장치조타체인조타나침반조타기관steering gear 조타기조타기경보steering gear compartment 조타기실steering gear room 조타기실조타시험steering lever 조타레버조타목표등키잡이노조타명령조타발판조타쿼드런트조타봉조타실수직타조타발판steering system 조타장치조타텔레그래프steering test 조타틸러조타륜조타줄stem 선수재선수보호쇠선수재이음쇠스텝각스텝가이드후진용접법step-down gear 감속기어강압변압기스티븐슨밸브장치유단격벽유단드럼step-up gear 증속기

증속기윤활유펌프승압변압기

sterilizer 살균소독기stern 선미중형닻선미관통함선미벌브선미관베어링부시스턴슈트stern construction 선미구조

선미구조도선미단벌브

stern frame 선미재stern gate 선미게이트

steerage passenger room      steerage way  

steering apparatus     steering arrangement   steering chain  steering compass      steering engine 

steering gear alarm    

steering gear test      

steering light  steering oar    steering order steering pedestal       steering quadrant      steering rod   steering room  steering rudder steering stand  

steering telegraph       조타시험steering tiller  steering wheel steering wire  

stem band     stem shoe     step angle     step guide     step-back welding     

step-down transformer Stephenson's valve gear      stepped bulkhead      stepped drum  

step-up gear lubricating oil pumpstep-up transformer    

stern anchor   stern box      stern bulb      stern bush      stern chute    

stern construction profile      stern end bulb 

Page 511: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

stern gland 선미관글랜드선미등stern line 스턴라인스턴라인윈치선미보호쇠stern ramp 선미램프선미케이블바퀴stern thruster 선미스러스터stern tube 선미관stern tube bearing 선미관베어링선미관베어링케이스선미관베어링부시선미관부시stern tube compartment 선미관구획실선미관냉각용청수탱크stern tube gland 선미관글랜드stern tube gland packing 선미관글랜드패킹선미관글랜드

선미관윤활유냉각기선미관윤활유중력탱크선미관윤활유펌프선미관윤활유섬프탱크선미관너트선미관수밀장치선미관수밀장치선미관시트선미관축선미점성경계층선미복도선미파선미외륜선타주주방원

stiffened plate 보강판stiffener 보강재stiffening arrangement 보강구조 배치stiffness 강성stiffness matrix 강성행렬 무풍공기저항still water 정수

정수중굽힘모멘트still water load 정수중하중still water shear force 정수중전단력stinger 스팅어스팅어히치보강봉stock allowance 스톡앵커stockless anchor 스톡리스 앵커stocktaking 화부실불때기장치

stern light     

stern line winch stern molding  

stern sheave   

stern tube bearing case stern tube bearing shell stern tube bush     

stern tube cooling water tank

stern tube gland    stern tube lubricating oil cooler stern tube lubricating oil gravity tank     stern tube lubricating oil pump stern tube lubricating oil sump tankstern tube nut stern tube sealing device      stern tube sealing      stern tube seat stern tube shaft stern viscous boundary layerstern walk     stern wave     stern wheel steamer   sternpost      steward 

still air resistance      

Still Water Bending Moment (SWBM)

stinger hitch   stirrup  가공여유stock anchor   

재고조사stokehold      stoker 

Page 512: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스토크스파불때는시보기돌운반선석취관stool 스툴stool bottom 스툴저부stool top plate 스툴정판stop 멈추개정지콕stop hole 스톱홀정지밸브물막음멈추개정지거리stopping time 정지시간축전지storage of cut parts 절단부재보관적하장소저장탱크store room 저장품실stored energy 저장에너지stores 선용품storm cover 풍우밀 커버storm rail 스톰레일스톰레일브래킷스톰세일스톰밸브stowage 적하재화용적재화계수적하율화물적재도적하검사stowaway 밀항자일직선정렬직형직선형선정극성직선선수straight through 일축형

직류연소실직재바로잡기직선안정성

strain 변형률변형에너지여과기변형경화스트레인게이지strain rate 변형률속도 strainer 여과기strainer plate 여과판strake 스트레이크

부현측후판strand 스트랜드stranding

Stokes' wave stoking indicator       stone carrier   stone catcher  

stop cock      

stop valve     stop water     stopper stopping distance      

storage battery 

storage space  storage tank   

storm rail bracket      storm sail      storm valve    

stowage capacity       stowage factor stowage factor stowage plan   stowage survey 

straight alignment      straight compound     straight lined vessel   straight polarity straight stem   

straight through combustion chamber   straight timber straightening   straight-line stability   

strain energy  strain gauge   strain hardening strain meter   

strake below sheer strake     

좌초

Page 513: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

스트랩연결짚매트streak 종통재줄꼴캐비테이션중형닻흐름속핵streamline 유선streamline 중묘줄유선흐름유선타

유선형퍼텐셜반류

strength 강도strength criteria 강도기준강력갑판강도흘수강도건현strengthening 보강보강링stress 응력stress amplitude 응력진폭 stress analysisstress combination 응력조합stress concentration 응력집중

응력집중계수stress corrosion 응력부식 stress corrosion crack 응력부식균열 진동응력응력피로stress intensity factor 응력확대계수stress range 응력범위 stress ratio 응력비 stress redistribution 응력재분배 stress reduction 응력감소stress relaxation 응력완화

응력제거열처리응력제거

stretcher 구급용 들것조정나사striking plate 타격판스티링비드stringer 스트링거스트링거비드스트링거판stripe coat 선행도장잔유관stripping pump 스트리핑펌프stroke 행정행정체적행정안지름비뒷댐특설보

strapped joint  straw mattress 

streak cavitation       stream anchor stream nuclei  

streamline flow streamline rudder      

streamline shape       

streamline wake      

strength deck  strength draft  strength freeboard     

strengthening ring      

응력해석Stress Concentration Factor (SCF)

stress due to vibration stress fatigue  

stress relief heat treatment    stress relieving stress-strain diagram   응력-변형률선도stretching screw       

string bead    

stringer bead  stringer plate  

stripping pipe 

stroke volume  stroke-bore ratio      strong back    strong beam   

Page 514: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

양고리줄Strouhal number 스토롤수structural bulkhead 구조격벽structural capacity 구조적용량structural detail 구조상세structural deterioration 구조열화structural redundancy 구조잉여성structural test 구조시험

상부구조structure borne noisestructured chimera grid 정렬중첩격자여과기strut 스트럿스트럿베어링스트럿설치각스트럿단면뒤틀림각스트럿사이각stud 스터드스터드볼트스터드링크체인stud welding 스터드용접stud welding machine 스터드용접기스터드리스체인stuffing box 스터핑박스패킹누르개중조립분기회로subcontracting costsubcontracting managementsubdivision 구획subdivision arrangement 격벽배치subdivision deck 구획갑판subdivision index 구획지수subdivision length 구획길이구획만재흘수선subdivision requirement 구획요건subdivision rule 구획요건동결 온도submarine 잠수함잠수함모선잠수함구난함수중신호submarine tender (AS) 잠수함모함서브머지드아크용접선저복수기수중준설펌프서브머지드아크용접submerged ship 잠수선캐비테이션제어잠수준설선착저형굴착선

잠수조사선submersibles 수중운동체substandard vessel 기준미달선substantial corrosion 과도 부식substation

strop   

structure above upper deck     고체전달소음strum box      

strut bearing   strut-arm angle strut-arm section angle strut-vee angle 

stud bolt   stud link chain 

studless link chain     

stuffing box gland      sub-assembly  sub-circuit      외주비용외주관리

subdivision load line   

sub-freezing air temperature

submarine depot ship  submarine rescue ship (ASR)submarine signal       

submerged arc welding (SAW) submerged condenser  submerged dredge pump       submerged melt welding       

submergence control   submersible dredger   submersible drilling unit submersible research vehicle   

변전소

Page 515: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수면아래파형successive shipsuction 흡입

흡배기밸브랩핑공구석취관펌프준설선

suction filter 흡입여과기흡입가스기관흡입가스발생기suction head 흡입래더흡입관흡입펌프흡입측흡입행정흡입밸브suction well 흡입웰Suez Canal 수에즈운하수에즈운하타

수에즈운하탐조등수에즈운하신호등

Suez Canal tonnage 수에즈운하톤수수에즈운하톤수증서

Suezmax tanker 스웨즈막스급 탱커황밴드황 배출 통제지역

Sulfur Oxides (SOx) 황산화물황프린트하기건현표시하기만재흘수선하기탱크하기목재만재흘수선하계구역

sump tank 섬프탱크일광갑판햇빛막이천막저선수루갑판저선수루선저선수루

sunken poop vessel 저선미루선저선미루암초저선루super block 선행탑재블록super cavitation 완전캐비테이션완전캐비테이션흐름완전캐비테이션프로펠러초대형드레드노트급함과열기화물감독

substitution of the materials 자재대체subsurface wave        후속선suction and exhaust valve lapping tool suction cleanout suction dredger 

suction gas engine     suction gas producer    흡입수두suction ladder  suction pipe    suction pump   suction side   suction stroke  suction valve   

Suez Canal rudder     Suez Canal SearchLight (SCSL) Suez Canal signaling light     

Suez Canal tonnage certificate 

sulfur band    Sulfur Emission Control Areas (SECA)

sulfur print    summer freeboard mark Summer Load Water Line (SLWL)summer tank   summer timber load line       summer zone  

sun deck       sun screen     sunken forecastle deck sunken forecastle vessel       sunken forecastle      

sunken poop   sunken rock   sunken superstructure  

super cavitation flow   super cavitation propeller super dread naught      super heater    supercargo     

Page 516: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

supercharged engine 과급기관과급기supercharging 과급과급송풍기과급펌프

초전도 전자추진초다듬질과열증기

superimposition method 중첩법superintendent 감독선주감독기사과포화증기초음파탐상기supersonic turbulent flow 초음속 난류모델

초음파식유량계초음파액면계

superstructure 선루선루갑판supertanker 초대형유조선완전공기공급흐름완전공기공급supervisory training 감독자훈련

예비비상조명장치 supplementary feed 보충급수

부급수밸브추가절연공급관보급함급기통풍기

supply vessel 보급선support cap 지주용 캡support ship 보조선supporting block 지지용 블록수면불어내기콕수면불어내기밸브수상선표면복수기surface crack 표면균열표면결함surface effect 표면효과 Surface Effect Ship (SES) 표면효과 선표면기진력표면마찰표면계표면연마기

표면열전달표면점화표면검사표면모니터수면관통형 터널 프로펠러

supercharger   

supercharging blower  supercharging pump    super-conducting electric propulsionsuper-finishing  superheated steam     

superintendent engineer supersaturated steam   supersonic flaw detector   

supersonic type flow meter    supersonic type level gauge    

superstructure deck    

super-ventilated flow    super-ventilation 

supplementary emergency lighting

supplementary feed valve      supplementary insulation       supply pipe    supply ship    supply ventilating fan  

surface blow off cock   surface blow off valve  surface boat   surface condenser     

surface defect 

surface force  surface friction surface gauge  surface grinder surface heat transmission      surface ignition surface inspection      surface monitor surface piercing propeller in tunnel

Page 517: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

정반전처리 및 도장면적비표면거칠기

surface spline 표면보간법정반표면장력표면온도계surface treatment grade 전처리등급함대공유도탄

함대함유도탄surge 전후동요서지선서지탱크선의surrounding mesh 주위요소survey 검사

제조중검사탐사계검사보고서측량선

surveyor 검사원survival craft 생존정

생존정용레이더트랜스폰더survival suit 구명복

현수식파일타워suspended solid 서스펜션암서스펜션로드서스펜션와이어벌집정반swage bulkhead 스웨지격벽베이어닛꼭지swash bulkhead 제수격벽swash plate 제수격벽sway 좌우동요sway brace 가로진동받이sway brace 관 방진기스웨트파이프swell 너울스웰컴펜세이터파랑계너울등급swelling 팽윤감도시간조정스윙앵커스윙블록선회붐하역법선회붐시스템swing check valve 스윙체크밸브준설폭설정장치스윙윈치스윙와이어로프

surface plate   surface preparation and paintingsurface ratio   surface roughness      

surface table   surface tension surface thermometer   

Surface-to-Air Missile (SAM)Surface-to-Surface Missile (SSM)

surge line      surge tank     surgeon 

survey during construction     survey meter  survey report  surveying ship 

survival craft radar transponder 

suspended pile driving tower    부유물질suspension arm   suspension rod suspension wire swage block   

swan base     

sweat pipe     

swell compensator     swell meter    swell scale     

swept gain control     swing anchor  swing block    swing boom method    swing boom system    

swing range indicator  swing winch   swing wire rope       

Page 518: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

선회붐하역법swirl error 수반각 와류분무기선회날개스위치함전환콕

표시모드스위치스위치장치

switchboard 배전반swivel 스위블스위블도르래스위블훅swivel joint 스위블이음대칭식날개배열synchro 싱크로동기발전기동기검정기동기동기동기발전기동기전동기동기속력synergy effect 협동상승효과synthetic fiber 합성섬유시스템분석시스템설계제어편차시스템 식별법system oil 작동유system oriented design 시스템 기반 설계보조제어판

테이블식자기나침반tabular freeboard 표정건현회전계tack 택택크링글택구멍가용접태킹태클선회지름선회시운전taffrail 선미난간꼬리도르래테일로드tail shaft 프로펠러축누기밸브talk back system 쌍방향통신확성장치수지검수원하역사무소

탠덤아티큘레이티드형감속장치탠덤건조법탠덤컴파운드터빈탠덤진수

swinging method       

swirl type atomizer    swirl vane     switch box     switch cock    switch for mode of presentation switch gear    

swivel block   swivel hook    

symmetrical blading    

synchro generator      synchro scope  synchronism   synchronization synchronous generator synchronous motor     synchronous speed     

system analysis system design system deviation       system identification method

tab     table type magnetic compass   

tachometer     

tack cringle    tack hole      tack welding   tacking tackle  tactical diameter       tactical trial    

tail block      tail rod 

tail valve      

tallow  tally man      tally office     tandem articulated type reduction gear tandem building system tandem compound turbine      tandem launching       

Page 519: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

탠덤프로펠러회전방향유기속도접선응력

tank 탱크tank cleaning facility 탱크세정시설탱크클리닝가열기탱크청소구tank cleaning opening 탱크세정용개구탱크클리닝펌프탱크청소장치수조시험

탱크가열코일탱크가열관

tank overpressure 탱크 과압tank side bracket 이중저측면브래킷tank top 내저판 탱크정판탱커tank washing 탱크세정탱크내적재tanker 탱커

탱커구조협의회탭볼트

tape measure 줄자taper 테이퍼테이퍼볼트테이퍼게이지테이퍼핀taper ratio 경사비테이퍼날개테이퍼드럼테이퍼라이너tapered wing 경사날개tapering bracket 테이퍼링브래킷태핏로드태핑기tar 타르타르시멘트target 표적물목표탐지회수표적선Target Strength (TS) 표적강도target useful life 목표내구연한타폴린타르로프

토트와이어장치Taylor chart 테일러도표

선수벌브테일러횡단면적계수테일러의지름계수

tandem propeller       tangential induced velocity     tangential stress       

tank cleaning heater   tank cleaning hole 

tank cleaning pump    tank cleaning system   tank experiment 

tank heating coil       

tank heating pipe      

tank top plate  tank vessel    

tankage 

Tanker Structure Cooperative Forum (TSCF)tap bolt 

taper bolt      taper gauge    taper pin       

tapered blade  tapered drum  tapered liner  

tappet rod     tapping machine 

tar cement     

target data rate target ship     

tarpaulin       tarred rope    taut wire measuring gear      

Taylor sectional area coefficient for bulbous bow      Taylor's advance coefficient  

Page 520: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

테일러의동력계수체비셰프공식

tea clipper 티 크립퍼tear test 인열시험tee 티

해양무선중계부이telegraph 텔레그래프텔레그래프로거텔레모터신축마스트신축관television surveillance 텔레비젼 감시장치 telltale 표시계매달린나침반telltale system 집합경보및 신호표시장치가열굽힘시험템퍼색temperature chalk 온도감지쵸크온도등급온도조절기온도수정

편차온도경보기temperature monitor 온도감시장치temperature rise 온도상승

온도상승계수온도상승비온도엔트로피선도

tempering 템퍼링templatetemplate for bending

임시변경증임시사다리고정장치임시항행검사증

temporary repair

임시비상전원인성

tender 보급선중두선tenon 장부tensile load 인장하중인장강도인장응력tension 인장인장부재인장시험자동계선윈치tentative rule 좀조개terminal 단자

Taylor's power coefficient    Tchebycheff's rule    

telecommunication relay buoy  

telegraph logger       telemotor      telescopic mast telescopic pipe 

telltale compass 

temper bend test       temper color   

temperature class      temperature controller temperature correction temperature deviation alarm    

temperature rise coefficient    temperature rise ratio  temperature-entropy diagram   

형판곡작업용 형판temporary alteration certificatetemporary ladder suspension equipment temporary navigation certificate 임시수리temporary source of emergency power tenacity 

tender vessel  

tensile strength tensile stress  

tension member tension test    tension winch   잠정규칙teredo 

Page 521: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

단자반단자함termination 단말

지상파무선항해시스템tertiary stresstest cock 시험콕test for flame retardance 내염시험test hammer 테스트 해머test head 시험수두test hole 검사구멍test load 시험하중test machine 시험기test panel 시험용배전반test piece 시험편test pressure 시험압력test specimentheodolite 세오돌라이트theoretical throat 이론적목두께theory spray ratiothermal capacity 열용량thermal conductivity 열전도율thermal cycling 열사이클링thermal de-stratification 온도성층파괴thermal detector 열탐지기thermal efficiency 열효율thermal expansion 열팽창thermal insulation

방열구조thermal insulation door 방열문thermal neutron 열중성자thermal oil 열매체유

열매체유순환펌프열매체유배기가스이코노마이저열매체유가열기

thermal oil installation 열매체유설비thermal oil pipe 열매체유관열출력thermal protective aids 보온구thermal ratio 온도비thermal reactor 열중성자로thermal receiver 배기받이thermal shield 열차폐thermal shock 열충격thermal simulation 열해석thermal stratification 열성층thermal stress 열응력thermit 테르밋thermit welding 테르밋용접thermo paint 온도감지페인트thermocouple 열전대열전대온도계thermodynamics 열역학

열역학적효율

terminal block  terminal box   

terrestrial radio navigation system

3차응력

시험편

이론도포율

방열thermal insulation construction

thermal oil circulating pump    thermal oil exhaust gas economizer    thermal oil heater      

thermal power 

thermocouple thermometer     

thermodynamics efficiency     

Page 522: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

열가공제어강열연화성플라스틱절연케이블

thermosetting 열경화수지thermostat 온도자동조절장치온도감지팽창밸브thermo-tank 난방용공기가열기thick plate 후판

자발적추가두께thickness gauge 두께게이지thickness ratio 두께비thickness-chord ratiothimble 심블thin plate 박판thin wing 얇은 날개thinner 희석제

노받이핀토마수thread 나사산나사게이지나사밀러나사깍기기계

목두께목두께조리개조속조리개밸브조리개열량계관통보through bolts 관통볼트관통브래킷through thickness property 두께방향특성through-put 일정시간내의 처리작업량thrust 추력추력베어링thrust block 추력블록thrust block recess 추력블록리세스추력블록받침대추력상실추력계수

추력감소계수

Thermo-Mechanical Controlled Process (TMCP) steelthermoplastic insulated cable

thermostatic expansion valve

thickness for voluntary addition

두께-코드비

third deck      제3갑판thole-pin       Thoma number 

thread gauge   thread miller   threading machine      three deck vessel       3층갑판선three fold block  3겹도르래three islander   3도형선three phase     3상three stage air compressor      3단공기압축기three stranded rope     3가닥로프three way cock  3방향콕three way union        3방향유니언three way valve        3방향밸브three wire system      3선식배전three-ply riveting       3층판리베팅throat depth   throat thickness throttle governing      throttle valve  throttling calorimeter   through beam  

through bracket 

thrust bearing  

thrust block seat       thrust breakdown      thrust coefficient       

thrust deduction coefficient    

Page 523: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

추력감소율추력마력추력지수추력부하계수추력계추진출력

thrust pad 추력 패드thrust power 추진동력thrust recess 스러스트리세스thrust seat 추진기시트추력받이칼라thrust shoe 추력슈thruster 스러스터thumb line 항정선나비나사노좌석사이러트론사이리스터조류tidal range 조석차이tide 조석조류표시부표조류신호소조류신호조석표tie bolt 타이볼트띠판tie rod 타이로드 tier of beam 빔층tight weld 밀착용접tiller 틸러tilt sensor 경사계timber 목재목재운반선갑판적목재화물팀버헤드목재만재흘수선하기목재만재흘수선시보종time charter 정기용선시간정수시간제어기불때는시보장치불때는시보기타임래그

최단접근시간시각대

timing gear 타이밍 기어점화시기조정밸브주석함량계양철가위이산화타이타늄 피막날개끝캐비테이션

thrust deduction fraction       Thrust HorsePower (THP)  thrust index    thrust loading coefficient       thrust meter   thrust output   

thrust shaft collar  

thumb screw   thwart thyratron       thyrister       tidal current   

tide indicating buoy    tide signal station      tide signal     tide table      tie angle  타이엘(L)형강tie plate       

timber carrier  timber deck cargo     timber head    timber load line timber summer load water linetime bell       

time constant  time controller time firing device      time firing indicator    time lag Time to Closest Point of Approach(TCPA) time zone      

timing valve    tin content meter      tinman's shears       TiO2 Coatingtip cavitation   

Page 524: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

날개끝누출손실날개끝틈새날개끝노출날개끝누출날개끝속력

tip stall 끝단 실속tip vortex 날개끝보텍스날개끝보텍스캐비테이션tipping 선미침하티핑모멘트토빈청동toe 토

중립타각toe of stay webs 스테이웨브의 토토피스toggle 토글toggle bolt 토글볼트

토글스위치tolerance 공차tolerance limits 허용한도tolerance requirement 허용요건스카프용접tongued washer 혀붙이 와셔tonnage 톤수적량톤수증서측도갑판톤세적량측도법톤수표지적량측도감톤구멍

센티미터당배수톤수tool board 공구상자공구지기공구공장공구강공구tooth profile 치형top 톱top bracing 상부 브레이스상사점톱헤비두표정판톱팀버하향식방법톱갤런트리프트톱갤런트마스트톱갤런트세일톱갤런트스테이세일topmast 톱마스트톱마스트백스테이

tip clearance leakage loss      tip clearance   tip emergence tip leakage     tip speed      

tip vortex cavitation   

tipping moment Tobin bronze  

toe angle of an offset rudder  

toe piece      

toggle switch  

tongue weld    

tonnage capacity       tonnage certificate     tonnage deck  tonnage dues  tonnage law    tonnage mark  tonnage measurement  tonnage opening       Tons Per Centimeter immersion(TPC) 공구대tool box       tool keeper    tool shop      tool steel      tools   

Top Dead Center (TDC)top heavy      top mark top plating     top timber     top-down approach    topgallant lift  topgallant mast topgallant sail  topgallant staysail      

topmast backstay      

Page 525: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

톱마스트밴드톱마스트스테이세일topology 토핑브래킷토핑리프트토핑유닛토핑윈치

보충용공기압축기topsail 톱세일톱세일리프트톱세일스쿠너topside tank 상부현측탱크torch 토치토치헤드토치점화기토치램프토치튜브어뢰정방뢰망붐torque 토크토크상실토크계수토크지수토크계토크렌치

토레모리노스국제협약

torsion 비틀림비틀림우력torsion function 비틀림 함수비틀림진동기록계비틀림계비틀림강성비틀림시험기torsional buckling 비틀림 좌굴비틀림우력비틀림위험회전속력비틀림변형비틀림유연성torsional moment 비틀림 모멘트torsional vibration 비틀림진동비틀림진동시험파비틀림모멘트전레이크total flow velocity 전속도총기체함유량total head 전수두

전열전달계수total inspection 전손

topmast band  topmast staysail  위상topping bracket topping lift     topping unit    topping winch  topping-up air compressor     

topsail lift      topsail schooner       

torch head     torch igniter   torch lamp     torch tube     torpedo boat   torpedo net boom      

torque breakdown      torque coefficient      torque index   torque meter   torque wrench Torremolinos International Convention for the Safety of Fishing Vessels(1977) Torremolinos Protocol of 1993 relating to the International Convention for the Safety of Fishing Vessel 1977;

1977 어선의 안전에 관한 국제협약, 1993 토레몰리노스 의정서

torsion couple  

torsion graph  torsion meter  torsion rigidity torsion tester  

torsional couple torsional critical speed torsional deflection     torsional flexibility     

torsional vibration test torsional wave moment total axial displacement 

total gas content       

total heat transfer coefficient   전수검사total loss      

Page 526: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

전압력전사적설비관리전사적품질관리전레이크전저항

totally enclosed lifeboat 전폐형구명정특수형하역등

touch up 보수도장toughness 인성토라인예인점예인저항예인줄예인조타목표등타위크레인예항장치예인줄받이아치예인줄받이보예인비트예인훅towing light 예선등towing line 예인밧줄towing pendant 예인줄묶음관towing pennant 예인패넌트예항력예인로프예인수조예인윈치예항식로그toxic symptomtoxicity 송수신변환기트레이서track 항적항적도track control systems 항적제어장치추적무역풍드래그암뒷날

트레일링 흡입 호퍼 준설선트레일링형드래그헤드후류보텍스캐비테이션열차도선연습선연습전대

Training Tender (ATX) 훈련함타원컴퍼스부정기선송수신기transducer 신호변환기transfer 선회가로이동거리전달함수transfer of control 제어권의 이전

total pressure  Total Productive Maintenance (TPM)Total Quality Control (TQC)total rake      total resistance 

totally enclosed portable type cargo light      

tow line tow point      tow rope resistance    tow rope       tow steering light      tower crane    towing apparatus       towing arch    towing beam   towing bitt     towing hook   

towing power  towing rope    towing tank    towing winch   towing-log      중독증상독성TR switch     tracer  

track chart     

tracking trade wind     trailing arm    trailing edge   trailing suction hopper dredgertrailing type drag head  trailing vortex cavitation       train ferry     training ship   training squadron      

trammels       tramper transceiver     

transfer function       

Page 527: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이송펌프공장간의 작업자이동변압기순간캐비티과도편차과도전자탐사법과도상태트랜싯

transition area 천이 영역천이점천이온도transition zone 천이 구역천이유동

임시비상전원transmissibility (TR) 전달율

전달효율전동장치화염전파전동축신축이음쇠송신기

transmitting 송신발신식컴퍼스방위발신기붙이자기컴퍼스자기선수방위전송장치

transom 트랜섬선미보transom floor 트랜섬늑판순양함형선미투명도판transparent armor glass 방탄유리트랜스폰더횡격벽가로이송컨베이어횡늑골

횡늑골식구조횡부재횡메타센터제일수횡단면

transverse ring 트랜스버스링횡복원력횡강도횡늑골식구조트랜스버스웨브trap 트랩trapeze 그네사다리꼴공식잡힌기체

transfer pump  transfer workers between shopstransformer    transient cavities       transient deviation     Transient Electro Magnetic (TEM) methodtransient state transit 

transition point transition temperature  

transitional flow transitional source of emergency electric power

transmission efficiency 

transmission gear      transmission of flame  transmission shaft loose joint  transmitter     

transmitting compass   transmitting magnetic compass Transmitting Magnetic Heading Device (TMHD)

transom beam  

transom stern  transparency disc      

transponder    transverse bulkhead    transverse conveyor   transverse frame       transverse framing system     transverse member     transverse metacenter  transverse number     transverse plane       

transverse stability     transverse strength    transverse system transverse web 

trapezoidal rule trapped gas    

Page 528: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

이동크레인주행식작업대이동탑traverse feed 가로이송연침로항법트래버스표트롤망오토보드트롤어망끌줄트롤윈치저인망어선tread 디딤판treatment shop 전처리공장

나무못trend analysistrend line 도려내기시험코어링trestle 트레슬트레슬트리trial 시운전trial and error method 시행착오법시운전상태trial conference 시험조작trial speed 시운전속력트라이애틱스테이tributyl-tin (TBT) Based 유기주석계트라이싱로프트릭밸브삼색등trigger 트리거트리거구멍trim 트림트림힐지시기선수트림선수트림선수트림선미트림trim tab 조절탭트림웨이트trimaran 삼동선trimaran type hull form 삼동선형트리밍해치트리밍모멘트트리밍표트리밍탱크

자유외기회로차단기트립장치

trip line 트립시험트립와이어

traveling crane traveling stage traveling tower 

traverse sailing traverse table  trawl otter board       trawl warp     trawl winch    trawler 

treble block     3겹도르래treble riveting   3열리벳이음tree nail        추세분석추세선trepanning test trepanning     

trestle tree    

trial condition   시운전회의trial maneuvering      

triatic stay     

tricing wire    trick valve     tri-colored light 

trigger fit      

trim and heel indicator trim by bow   trim by head   trim by stem trim by stern  

trim weight    

trimming hatch trimming moment       trimming table trimming tank  trip free air circuit breaker    trip gear        개폐줄 trip test trip wire       triple screw vessel      3추진기선triplex pump    3실린더펌프

Page 529: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

삼중안전유리세다리마스트트리핑브래킷트로코이드파

trolley 트롤리병력수송선tropical cyclones 열대성폭풍우열대건현

열대담수만재흘수선열대만재흘수선열대폭풍우열대

trouble shooting 고장발견방법조타줄홈트로프

true bearing 진방위진방위수신장치참운동표시트루모션레이더참풍향참풍속trunk 트렁크공기배출구트렁크갑판트렁크창구트렁크피스톤기관트렁크통풍통트렁크선트렁크웨이트러니언truss 트러스트라이돛tube 관관배치관그을음불어내기관청소솔관청소기관뽑아내기공구관확장기

관용패킹삽입공구관용패킹제거공구관용패킹조임공구관판관플러그관때려빼기공구지주관연관보일러파이프발판수관식보일러예인선텀블홈

triplex safety glass    

tripod mast    tripping bracket trochoidal wave 

troopship      

tropical freeboard      tropical fresh water load line  tropical load line       tropical storm  tropical zone   

trough for steering chain       trough 

true bearing unit       true motion display    true motion radar      true wind direction     true wind velocity      

trunk air outlet trunk deck     trunk hatchway trunk piston engine    trunk ventilator trunk vessel   trunk way      trunnion 

trysail 

tube arrangement      tube blower    tube brush     tube cleaner   tube drawing tool      tube expander tube packing inserting tool     tube packing take-out tool     tube packing tightening tool    tube plate      tube plug      tube push-out tool     tube stay      tubular boiler  tubular scaffolding     tubulous boiler tug boat       tumble home   

Page 530: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

텀블러스참치어선다랑어주낙어선

tuna long liner 다랑어주낙어선다랑어잡이모선티그 용접텅스텐강

tuning 동조조정튜닝휠tunnel 터널터널탈출구터널갑판터널리세스천장터널리세스중간축베어링중간축터널웰turbine 터빈터빈케이싱터빈케이싱터빈바퀴터빈효율터빈펌프터빈로터터빈선터빈선터빈날개바퀴터빈송풍기

터빈발전 전기추진선터빈발전기복수기순환펌프터빈발전기복수기복수펌프터빈발전기복수기순환펌프터빈발전기복수기복수펌프터보제트

turbocharger 과급기과급기세척수탱크과급기차단시험과급기윤활유냉각기과급기윤활유중력탱크과급기윤활유펌프과급기윤활유저장탱크과급기윤활유섬프탱크

tumbler switch tuna clipper    tuna long line fishing boat     

tuna mothership Tungsten Inert Gas (TIG) arc weldingtungsten steel   조율(튜닝)tuning control  tuning wheel   

tunnel escape  tunnel flat      tunnel recess top      tunnel recess  tunnel shaft bearing    tunnel shaft    tunnel well     

turbine casing  turbine cylinder turbine disc    turbine efficiency      turbine pump   turbine rotor   turbine ship   turbine steamer turbine wheel  turbo blower   turbo electric motor ship       turbo generator condenser circulating pump    turbo generator condenser condensate pump   turbo generator turbine condenser circulating pump    turbo generator turbine condenser condensate pumpturbo jet       

turbocharger cleaning water tank       turbocharger cut off test       turbocharger lubricating oil coolerturbocharger lubricating oil gravity tank turbocharger lubricating oil pumpturbocharger lubricating oil storage tank       turbocharger lubricating oil sump tank  

Page 531: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

터보압축기터빈발전 전기추진선터보송풍기터빈발전기turbulence model 난류모델난류촉진장치

난류경계층난류

turbulent kinetic energy 난류운동에너지난류운동turbulent velocityturbulent wake flow 난류후류유동turn buckle 조임나사turn of the bilge 만곡부turn on sideturn over 반전턴버클turning 선회선회원회전기관회전력터닝기어turning moment 선수돌림 모멘트선회반지름회두선회시운전회전륜turnkey base 턴테이블turret 포탑터릿갑판터릿선반터릿노즐터릿선거북등갑판'tween deck 중간갑판갑판간탄고갑판간화물창갑판간내장판갑판간늑골갑판간사다리

쌍캠축형twin hull ship 쌍동선

쌍롤러형쌍타twin screw ship 쌍추진기선돛실비틀린날개비틀림모멘트비틀림시험쌍묘박

turbo-compressor      turbo-electric drive    turbo-fan      turbo-generator 

turbulence stimulator   turbulent boundary layer       turbulent flow  

turbulent motion        난류속도

반전turnbuckle    

turning circle  turning engine turning force   turning gear   

turning radius  turning round  turning test    turning wheel   턴키방식turntable       

turret deck    turret lathe    turret nozzle   turret vessel   turtle back deck       

'tween deck bulker   'tween deck cargo space     'tween deck ceiling   'tween deck frame    'tween deck ladder   Twenty-feet Equivalent Unit (TEU) 20피트컨테이너 등가적재량twin cam shaft type    twin core cable  2심전선twin longitudinal bulkhead       2열종격벽twin roller type twin rudder    

2축선twin screw vessel     twine  twisted blade  twisting moment       twisting test   two anchor mooring    

Page 532: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

two boat test 경합시험쌍두리트롤선two cycle engine 쌍실린더펌프

two point approximation

two stage pumptwo stage turbo-charger

쌍크랭크축two wire systemtwo-phase flow 쌍방향콕

쌍방무선전화장치two-way VHF radiotelephonetype 형식type approval 형식승인Type Approval Test (TAT) 형식승인시험 선종태풍typical detail 기준상세도U-boltullage 얼리지ullage hole 얼리지홀ullage plug 얼리지 플러그ullage port 유면측정공ullage table 얼리지표

최종종강도ultimate strength 최종강도ultimate tensile strength 최종인장강도ultra high frequency (UHF)

극대형원유운반선초음파탐상기

ultrasonic leak test 초음파누수탐상시험초음파탐상기Ultrasonic Test (UT) 초음파탐상시험초음파두께측정ultraviolet (UV) 자외선 ultraviolet dosimeter 자외선측정기ultraviolet sterilizer 자외선살균기umbilical cable 생명줄unaffected zone 원질부

기관구역무인화선unattended machinery space 무인화기관구역unbalanceunbalanced load 불평형하중불평형타비감쇠동요

two boat trawler       two circuit feeding      2중급전

2행정기관two cylinder pump     two dimensional flow     2차원유동two dimensional spectral density 2차원스펙트럼밀도two fold purchase       2중태클

2점근사화two stage air compressor       2단공기압축기

2단펌프2단과급기

two stroke cycle engine    2행정기관two throw crankshaft  

2선식2층류유동

two-way cock two-way radiotelephone apparatus 쌍방향 VHF무선전화

type of ship   typhoon 

유(U)볼트

ultimate longitudinal strength

극초단파Ultra Large Crude oil Carrier (ULCC)ultrasonic flaw detector    

ultrasonic reflectoscope 

ultrasonic thickness gauging

Unattended Machinery Automatic (UMA) ship

불평형unbalanced rudder     undamped oscillation   

Page 533: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

비감쇠진동비감쇠파under constructionunder deck area 갑판하부구역under deck stiffener 갑판하보강재under deck structure 갑판하부구조under deck tonnage 갑판하톤수under expansion 부족팽창상갑판하톤수

저전압방지underbead crack 비드밑균열undercut 언더컷수중카메라잠수함수중절단수면하부속품underwater inspection

수중진수대해중투시선수중투시실수중투광기수중방사소음수중착암기수중스테레오카메라수중통화기수중텔레비전수중용접항행중해상보험업자

unequal angle 부등변형강부정형유니플로소기기관유니플로소기정류복수기uniform distributed loads 균일분포하중

무정전전원장치union 유니언유니언연결유니언멜트식용접유니언너트맞당김식하역법unit assemblyunit bath 붙박이욕실unit cabin 유닛캐빈unit cooler 유닛쿨러unit feed system 개별급수식unit outfitting 유닛의장unit roller 유닛롤러unit switch 유닛스위치

undamped vibration    undamped wave  건조중

under upper deck tonnage     Under Voltage Protection (UVP)Under Voltage Release (UVR) 저전압해방underwater camera     underwater craft       underwater cutting     underwater fittings      수중검사underwater launching way      underwater observation boat   underwater observation space  underwater projector   Underwater Radiated Noise (URN)underwater rock drilling machineunderwater stereo camera      underwater telephone  underwater television  underwater welding    underway      underwriter    

unfairness      uniflow engine uniflow scavenging      uniflux condenser      

Uninterruptible Power Supply (UPS)

union joint     union melt welding     union nut      union purchase method  소조립

Page 534: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

미국연안경비대universal chock 유니버설촉유니버설이음유니버설페어리드유니버설이음만능공작기계몽키스패너

만능재료시험기양토부선

unloading 양하무인항공기unmanned control 무인조종un-pierced bulkhead 개구가 없는 격벽무저항횡동요비내항성unsheathed deck 비피복갑판unstable equilibrium 불안정평형unsteadiness 비정상성unsteady 비정상비정상캐비티unsteady flow 비정상유동unsteady heat flow 비정상열유동

비정렬 셀 중심방법unstructured grid 비정규격자unsymmetricalunsymmetrical flooding 비대칭침수

비대칭파랑유기하중상행행정상승관헤더

upper bridge 상층선루upper bridge deck 상부선교갑판upper control limit 관리상한선upper deck 상갑판upper end buoy 삼각주상단부표upper frequency 상한주파수upper stock 타두재upper strake 상부판상부텀블러외판만곡부상단상층갑판간공간

최상전통갑판직립직립선수업셋용접업세팅머신전복모멘트

upside downuptake 연도배기통풍기upward trendupwind 풍상향urinalusability test 유용성검사

United States Coast Guard (USCG)

universal coupling      universal fairlead       universal joint  universal machine      universal screw wrench universal testing machine      unloader barge 

Unmanned Aerial Vehicle (UAV)

un-resisted rolling      unseaworthiness       

unsteady cavities       

unstructured cell-centered method

비대칭unsymmetrical wave -induced loadsup stroke      upcast header  

upper tumbler  upper turn of bilge     upper 'tween decks   uppermost continuous deck     upright position upright stem   upset welding  upsetting machine      upsetting moment       반전uptake ventilator  상승추세

소변기

Page 535: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

U-Tube

진공증진기vacuum box 진공누설시험 지그진공차단기vacuum cleaner 진공청소기vacuum condenser 진공복수기vacuum distillation 진공계진공펌프vacuum test 진공시험진공트랩진공관진공밸브밸브상자밸브상자valve chest 밸브체스트

밸브조정구멍소기밸브선도밸브디스크밸브장치밸브가드밸브핸들스패너밸브레버밸브양정

valve list 밸브목록표밸브조작스탠드밸브루프밸브판

Valve Remote Control (VRC) 밸브원격제어밸브원격제어장치밸브원격비상차단장치밸브자리깎기

valve rod 밸브로드밸브로드가이드밸브소기밸브자리밸브조정밸브스핀들밸브스프링밸브고착상단밸브소기

vane 베인베인프로펠러임펠러베인붙이디퓨저복원력멸실점

vapor 증기증기캐비테이션수베이퍼로크증기포켓증기압력

유(U)자관U-tube pressure gauge  유(U)자관압력계vacuum augmentor     

vacuum breaker 

감압증류vacuum gauge  vacuum pump  

vacuum trap   vacuum tube   vacuum valve  valve box      valve casing   

valve controlled port scavengingvalve diagram  valve disc      valve gear     valve guard    valve handle spanner   valve lever    valve lift       

valve local control stand       valve loop     valve plate     

valve remote control system   valve remote emergency shut-off device       valve reseater 

valve rod guide valve scavenging       valve seat     valve setting   valve spindle   valve spring   valve sticking  valve-in-head scavenging      

vane propeller vane wheel    vaned diffuser vanishing point of stability     

vapor cavitation number vapor lock     vapor pocket   vapor pressure 

Page 536: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

vaporization 증발vaporizer 증발기vaporizing 증발vaporizing chamber 증발식연소실vaporous cavitation 증기성캐비테이션

가변분사시기조정variable load 변동하중 불균일피치프로펠러가변거리눈금가변거리눈금variable speed 가변속력variable speed governor 가변속력조속기가변행정펌프추치제어

가변전압용접기varnish 바니시varying cross section 변 단면변동피치프로펠러V-belt drivevector mean velocity 벡터평균속도vedette boat 함재초계정채소창고차량운반선velocity 속도velocity coefficient 속도계수속도선도velocity head 유속수두velocity potential 속도퍼텐셜velocity shift 속도변환Vendee Globe 반데글로브vendor drawing 제조자도면vendor guarantee 제조회사보증vendor lead time 제조업체소요기간vendor manual 제조자매뉴얼veneer 베니어베니어판베니션도어vent 통기통기구멍벤트관vent riser 벤트라이저공기공급식흐름공기공급식프로펠러통풍플랩ventilation 통풍통풍콕통풍덕트ventilation flap 통풍 플랩공기공급초생공기공급지수통풍관배치도통풍트렁크ventilator 통풍통vernier 버니어vernier caliper 버니어캘리퍼

증발실vaporizing combustion chamber

Variable Injection Timing (VIT)

variable pitch propeller variable range marker  variable range scale   

variable stroke pump   variable value control  variable voltage welding machine

varying pitch propeller  브이(V)벨트구동vegetable chamber     vehicle-carrying ship   

velocity diagram       

veneer board  venetian door  

vent hole   vent pipe      

ventilated flow ventilated propeller    ventilating flap 

ventilation cock ventilation duct 

ventilation inception    ventilation index       ventilation plan ventilation trunk       

Page 537: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

vertical 수직줄vertical axis 수직축연직축프로펠러직립형보일러vertical coupling 수직연결vertical down-hand welding 수직하향용접직립형기관버티칼킬수직사다리

수직이착륙기연직변위각수직면운동시험연직주형계수수직스카프연결

vertical sectionvertical shear force 수직전단력직립선수vertical stiffener 수직방요재vertical strake 수직판상하진동수직파랑굽힘모멘트vertical wave shear force 수직파랑전단력연직웨브직립식용접

초단파초대형산적화물선초대형원유운반선초대형부유식해양구조물초대형광석운반선

vessel 선박vessel 용기선박통항관제 흘수제한선박VHF radio installation

진동대vibration 진동흡진기Vibration Analysis 진동해석vibration characteristics 진동특성소진기vibration control 진동제어진동감쇠장치진동피더접수진동vibration isolating rubber 방진고무진동레벨

vertical axis propeller  vertical boiler  Vertical Center of Gravity (VCG) 수직중심

vertical engine vertical keel   vertical ladder Vertical or Short Take-Off/Landing (VSTOL)vertical path angle     Vertical Planar Motion Mechanism (VPMM) testvertical prismatic coefficient   vertical scarf   수직단면vertical stem   

vertical vibration       vertical wave bending moment 

vertical web   vertical welding very high frequency emergency position-indicating radio beacon(VHF EPIRB)

브이에이치에프 (VHF)비상위치지시용무선표지장치

Very High Frequency(VHF) Very Large Bulk Carrier (VLBC)Very Large Crude Oil Carrier (VLCC)Very Large Floating Structure (VLFS)Very Large Ore Carrier (VLOC)

Vessel Traffic Service (VTS)vessel with freeboard   브이에이치에프 (VHF)

무선설비vibrating table 

vibration absorber      

vibration compensator  

vibration damper       vibration feeder vibration in water      

vibration level 

Page 538: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

소진기vibrator 진동기진동해머진동계vice 바이스Vickers hardness 비커경도식량수송선view port 전망창 Viking ship 비닐타일virtual cargo density 겉보기화물밀도겉보기질량

겉보기관성모멘트Virtual Reality (VR)virtual work 가상일점탄성viscometer 점도계viscosity 점도점도조절기점도지수viscous damping force 점성감쇠력viscous flow 점성유동

점성압력저항점성저항

vise 바이스visibility 발연기적visible alarm 가시경보visible arc 명호광visible distance 빛도달거리visual 육안visual alarm 시각경보Visual Display Unit (VDU) 영상지시장치visual inspection 육안 검사visual signal 시각신호전성관void space 보이드 구역Voith-Schneider Propeller 보이스슈나이더프로펠러

기화성부식억제제volatile matter 휘발성물질

휘발성유기화합물volatile solvent 휘발성용매제volatility 휘발도voltage drop 전압강하전압변동률전압조정기volume capturing method 체적포착법volume loss 부피손실volume modulus 체적탄성계수volume of displacement 배수용적volumetric efficiency 체적효율

체적팽창계수 

vibration reducer       

vibratory hammer      vibrometer     

victualler       

바이킹선 vinyl tile       

virtual mass    virtual moment of inertia        가상현실viscoelasticity   점도계viscosimeter   

viscosity controller     viscosity index 

viscous pressure resistance    viscous resistance     

가시도visible air whistle  

voice tube (pipe)  

Volatile Corrosion Inhibitor (VCI)

Volatile Organic Compounds (VOC)

voltage regulation      voltage regulator       

volumetric expansion coefficient

Page 539: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

volumetric flow meter 용적식유량계volute chamber 와류실volute pump 볼류트펌프volute spring 벌류트스프링vortex 보텍스vortex cavitation 보텍스캐비테이션vortex modeling 보텍스모델링vortex shedding 보텍스박리voyage charter 항해용선항해자료기록장치

항해종합관리시스템voyage plan 항해계획V-shaped sectionV-type enginevulcan gear 벌컨장치vulcanized rubber 가황고무wagon deck 차량갑판waist deck 중앙부상갑판waiting time 작업대기시간wake 반류wake equalizing duct 프로펠라측덕트wake factor 반류비wake field measurement 반류계측wake fraction 반류비Walkie-Talkie 워키토키walking level 보행면건조중통로wall crane 벽걸이크레인wall effect 측벽효과 wall lamp 벽붙이 등wall light 벽붙이 등wall nuclear 벽면핵벽걸이레이디얼드릴기계wall sided 연직현측wall ventilator 벽붙이통풍통wandering sequence 널뜀용접법Ward-Leonard system 워드레오나르드방식wardrobe 옷장warehousewarming steam pipe 가온 증기관warming up 예열warning 경고warning light 경계등warning signal light 경고신호등warp 뒤틀림warped blade 비틀린날개warping drum 당김줄드럼warping end 당김줄감개warping winch 당김줄윈치warps 배를 끄는 밧줄warship 군함wash back 날개날올림wash basinwash board 물막이판wash bulkhead 제수격벽wash cement 겉바르기시멘트wash plate 제수격벽

Voyage Data Recorder (VDR) Voyage Management System (VMS)

브이(V)형 단면브이(V)형 기관

walkway during construction

wall radial drilling machine

창고

세면기

Page 540: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

wash port 방수구wash-down 날개날내림washer 와셔wash-up 날개날올림wastage allowance 허용쇠모한도waste heat 폐열보일러폐열회수시스템waste oil 폐유폐유소각장치waste oil pump 폐유펌프폐유탱크

폐유처리장치폐유처리선폐증기관

watch 당직시보종water ballast 물밸러스트water ballast 물밸러스트물밸러스트관

물밸러스트관장치Water Ballast Tank (WBT) 물밸러스트탱크water barge 청수부선급수선water breaker 물결막이water closetwater content 수냉배수로물실린더주수관물여과기water fog applicator 물분무방사기수면계유리수면계water hammering 수두수마력water ingress alarm 침수경보장치물흡입관물재킷water jet 물분사water jet craft 물분사추진선물분사 이젝터물분사장치water jet propulsion 물분사추진

누수감지장치 water line 수선수선길이수선부페인트

물윤활식선미관베어링수량계물모니터

water plane 수선면

폐열waste heat boiler      waste heat recovery system   

waste oil incinerator   

waste oil tank waste oil treating device       waste oil treating ship waste steam pipe      

watch bell     

water ballast pipe      water ballast piping system    

water boat     

화장실수분함량water cooling  water course   water cylinder water filling pipe       water filter    

water gauge glass     water gauge    수격water head     water horsepower    

water intake pipe      water jacket   

water jet ejector water jet equipment     

Water Leakage detection system

water line length water line paint water lubricated stern tube bearingwater meter   water monitor  

Page 541: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

수선면적수선면계수수선면관성계수

water pollution 수압물저항기수냉벽물봉쇄급수관급수관장치연수장치물분무펌프물여과기청소선수관식보일러수관벽현측물고랑

water-air couplingwaterproof 방수waterproof electric torch 수밀전기등

수밀형식통수시험watertight 수밀수밀격벽

갑판수밀전선관통쇠붙이수밀구획

watertight deck 수밀갑판수밀문수밀마루수밀늑판수밀이음수밀미닫이문수밀시험watertight transom floor 수밀트랜섬늑판수밀공사Watt-Hour Meter 적산전력계전력계wave 파wave absorber 소파기wave absorber 파동 흡수 장치파진폭wave breaking 쇄파

쇄파저항파속력

wave coefficient 파랑계수wave crest 파정파정선wave drift damping 파랑감쇠력wave drift force 파랑표류력파랑기진력파진동수파전면

water plane area water plane coefficient  water plane inertia coefficients   수질오염water pressure water rheostats water screen   water seal     water service pipe     water service system  water softener  water spray pump      water strainer  water surface cleaning ship    water tube boiler      water wall     water way      해수-공기 연성waterproof type water-supply test      

watertight bulkhead    watertight cable gland for deck watertight compartment 

watertight door watertight flat  watertight floor watertight joint watertight sluice door  watertight test 

watertight work 

wattmeter      

wave amplitude 

wave breaking resistance      wave celerity  

wave crest line 

wave exciting force    wave frequency wave front     

Page 542: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

도파관wave height 파고파저wave induced load 파랑 유기 하중wave interaction 파간섭파장wave load 파랑하중wave maker 조파기조파저항파수wave pattern 파형파형저항파주기파랑관통형 쌍동선wave pressure 파랑압력파형풍랑등급파전단력파경사파수스펙트럼파속력파기울기진파장치파면wave torsional moment 파랑비틀림모멘트wave trough 파저파반류wavelet transform 웨이브렛변환밀납본weak link 위크링크

쇠모wear down 마모wear down gauge 마모량계측기wear resistant steel 내마모성 강wear respirator 마스크 착용wearing 풍하측회두천후조정물막이판자노천갑판weather effectweather forecastweather helm 선수끌림노천사다리바람막이막비막이지붕weather side down 풍상측하강바람맞이쪽weather strength deck 노출강력갑판풍우밀정적방향안정성풍화작용weathertight 풍우밀풍우밀문

wave guide    

wave hollow   

wave length    

wave making resistance wave number  

wave pattern resistance wave period   Wave Piercing Catamaran (WPC)

wave profile   wave scale     wave shearing force   wave slope    wave spectrum wave speed    wave steepness ratio  wave subduer  wave surface  

wave wake     

wax pattern    

wear and tear  

weather adjustment    weather board weather deck   일기영향일기예보weather ladder weather screen      weather shed  

weather side   

weather tight  weathercock stability   weathering     

weathertight door      

Page 543: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

강제풍우밀창구덮개위빙

web 웨브특설보특설늑골web stiffener 웨브 보강재쐐기중량곡선중량밀도중량추정weight gain 무게변화툴무게손실적재중량weighted average method 가중평균법weighted index numberweighted mean 웨어식펌프weld 용접부용접비드weld conditionweld decay 용접부부식weld defect 용접결함weld detail 용접상세weld end 용접끝단부weld flaw 용접결함weld gap 용접간극용접게이지weld geometry 용접헤드용접길이용접선용착금속weld seam 용접선용접치수weld toe 용착금속끝단weld zone 용접부용접성welded construction 용접이음welder 용접공용접사기량시험welding 용접welding arc voltage 용접아크전압용접전선용접전류Welding Distortion 용접변형용접불꽃welding flux 용제용접열Welding Induced Crack 용접유기균열용접지그용접전선welding machine 용접기welding material 용접재료welding metallurgy 용접금속학맞대기용접플랜지

weathertight steel hatch cover weaving 

web beam      web fame      

wedge weight curve   weight density       weight estimation      

weight loss    weight on board       

가중지수가중평균Weir's pump  

weld bead      용접조건

weld gauge     용접형상weld head     weld length    weld line       weld metal     

weld size      

weldability      용접구조welded joint    

welder's qualification test 

welding cable  welding current 

welding flame  

welding heat   

welding jig     welding leads  

welding neck flange    

Page 544: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용접공welding pass sequencewelding position 용접자세용접압력welding procedure 용접시공법

용접법승인시험용접시공절차서용접시공시험용접법용접덧붙임

welding residual stress 용접잔류응력welding rod

용접봉자동피복기용접순서용접공장

welding shrinkage 용접전원용접장치용접응력용접기호welding table 용접대welding throat 용접시간용접불구멍용접토치용접변압기용접유니언용접물weldolet 용접식돌기물well 웰well 저장소well deck 웰갑판well deck 상륙정탑재갑판웰갑판선well decker 웰갑판선시유장치습식공기펌프

습연실식보일러습연실액체컴퍼스계류 독

wet drop test 습식 낙하시험Wet Film Thickness (WFT) 습식보존법wet provision 습증기침수표면적경배선포경선포경포포경모선탐경선포경윈치포경선

welding operator        용접순서welding pressure       

Welding Procedure Qualification Test (WPQT)Welding Procedure Specification (WPS)welding procedure test welding process welding reinforcement  

용접봉welding rod extrusion press    welding sequence      welding shop    용접수축welding source welding station welding stress welding symbols       

용접각목welding time   welding tip     welding torch  welding transformer    welding union  weldment      

well deck vessel       

well test unit  wet air pump  wet combustion chamber boiler wet combustion chamber       wet compass   wet dock      

습도막wet process     냉장부식wet steam     wetted surface area    whale back vessel     whale catcher boat     whale gun     whale mother ship     whale scouting vessel  whale winch   whaler 

Page 545: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

wharf 부두부두크레인부두사다리부두사용료부두관리인날개바퀴단wheelhouse 조타실wheelhouse top 조타실정부whip 위프whipping 휘핑whirling 휘둘림whirling vibration 휘둘림진동whistle 기적

기적제어장치백색다이아몬드형백연페인트백등화이트메탈백색잡음백색아연페인트위트워스나사홀타인형그래브버킷광역통신망광폭날개광폭라이너특설창내빔특설기둥체인홈바퀴

winch 윈치윈치대윈치갑판winch drum 윈치드럼윈치조종수윈치플랫폼바람막이풍동표면류바람막이wind direction 풍향

풍향영향계수표면류풍력

wind gradient 풍속변화도바람유기조류wind resistance 바람저항

공기저항계수바람받이바람막이막바람받이

wind triangle 풍향삼각형wind tunnel 풍동풍동시험wind vane 풍향날개풍속

wharf crane    wharf ladder   wharfage       wharfinger     wheel stage    

whistle and siren control systemwhite diamond shape   white lead paint white light     white metal    white noise    white zinc paint Whitworth screw thread whole-tine type grab bucket   Wide Area Network(WAN) wide blade     wide liner      widely spaced hold beam      widely spaced pillar    wildcat 

winch bed     winch deck    

winch man     winch platform wind breaker   wind channel   wind current   wind deflector 

wind direction effect coefficient wind drift      wind force     

wind induced current   

wind resistance coefficient     wind scooper  wind screen    wind shoe      

wind tunnel test        

wind velocity  

Page 546: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

wind wave 풍랑windage 풍압면적조풍손실풍랑나선계단권선양묘기풍차작용window 윈도윈도와이퍼범포환기통현측격벽측로Wing In Ground (WIG) Ship 수면효과익선

표면효과익선wing keel 날개용골날개펌프wing sail 날개 돛 현측나선프로펠러wing section 날개 단면현측축wing suction 측부흡수관현측탱크wing tip 날개 끝단winglet 윙렛동기건현동기만재흘수선

동기북대서양건현동기북대서양만재흘수선동기목재만재흘수선

winterizing 방한장치와이어브러시와이어클립신선wire feed motor 와이어 송급 모터와이어게이지가는눈철망와이어가이철망문와이어니퍼와이어릴wire rope 와이어로프wire rope grooving 와이어로프홈와이어로프니퍼와이어하역고리wire socket 와이어소켓무선제어

무선방위측정기무선장치무선국통신사무전실무선국무선전신기

windage loss   wind-generated wave  winding stairs  winding windlass       windmilling     

window wiper  windsail wing bulkhead wing furnace   

Wing In Surface Effect (WISE) Ship

wing pump     

wing screw propeller   

wing shaft     

wing tank      

winter freeboard       winter load line Winter North Atlantic freeboard Winter North Atlantic load line winter timber load line 

wire brush     wire clip       wire drawing   

wire gauge     wire gauze     wire guy       wire net door     wire nipper    wire reel       

wire rope nipper       wire sling      

wireless control wireless direction finder       wireless installation    wireless office wireless operator      wireless room  wireless station wireless telegraph     

Page 547: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

무선전화무전당직원배선기구배선도탈급목재저장소

wood deck 목공선반나무못목침나무피복목재저장소목제갑판실목갑판목제방파벽wooden dunnage 목재받침목제방현재목제페룰목제가구목제기둥wooden plug 목재플러그목제칸막이목나사목선목선조선소wooden support 목재받침목공사목공장가공경화work loadwork managementwork measurementwork orderwork package 일비단계별공사요령서작업대working conditions 작동실린더제작도헐거운맞춤working lampworking pressure 사용압력Working Space 작업공간working stress 작용응력작용응력설계 방법작업행정작업대공원workshop 공작실공장용구공작실냉방장치

세계보건기구

wireless telephone     wireless watcher       wiring accessories     wiring diagram withdrawal of classification    wood bay       목갑판wood lathe     wood nail      wood pad      wood sheathing wood yard     wooden deck house    wooden deck   wooden dodger 

wooden fender wooden ferrule wooden furniture       wooden pillar  

wooden screen wooden screw wooden ship   wooden shipyard       

woodwork      woodworker's shop   work hardening  작업부하작업관리작업측정작업지시작업단위work ratio     Work Sequence Diagram (WSD)workbench      작업여건working cylinder       working drawing       working fit      작업등

working stress design method working stroke working table  workman       

workshop appliance    workshop unit cooler   World Health Organization (WHO)

Page 548: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

세계무선항행경보구역웜기어웜축웜휠워싱턴펌프권선형회전자측판페어리더

wreck 난파선장애부표조난선등불부표렌치리스트핀오작동경보추종착오경보연철X-form vibration

X-Ray radiographyX-ray room 요트yard 야드선번yarn 꼰실꼰실 시험기선수동요각yaw balance 선수균형요힐요미터yaw moment 선수동요 모멘트yawingyawl 욜yawl rig 욜범장

검역기황색등항복점항복강도yield surface 항복면 yielding check 항복 평가yoke 요크영률와이형여과기Z plate

zero defect 무결점지그재그조임지그재그 단속용접zigzag joint 지그재그형 이음지그재그조종시험지그재그리베팅지그재그조정zinc 아연zinc anode 방식아연

world-wide NAVigational warning service AREA (NAVAREA)worm gear     worm shaft    worm wheel   Worthington pump      wound rotor   wrapper plate  wrapping chock 

wreck buoy    wreck light buoy       wrench wrist pin       wrong operation alarm wrong way alarm      wrought iron    엑스(X)형 진동X-ray inspection apparatus      엑스(X)선장치

엑스(X)선 투과시험엑스(X)선실yacht  

yard number   

yarn tester     yaw angle      

yaw heel       yaw meter     

선수동요Y-connection    와이(Y)결선yellow flag     yellow light    yield point     yield strength  

Young's modulus      Y-type strainer 

Z 판 Z-bar   제트(Z)형강zigzag fastening      zigzag intermittent weld 

zigzag maneuvering test zigzag riveting zigzagging     

Page 549: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

용융아연조zinc phosphating 아연 인산염피막 처리아연판zinc protector 보호아연zone by area by stage 구역별공정단계별 구역zone outfitting 구획의장방식구획도장방식zone-oriented work 구획중심작업

zinc bath       

zinc plate      

구획의장Zone OutFitting Method (ZOFM)Zone Painting Method (ZPTM)

Page 550: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 551: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 552: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 553: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 554: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 555: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 556: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 557: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 558: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 559: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 560: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 561: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 562: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 563: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 564: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 565: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 566: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 567: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 568: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 569: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 570: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 571: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 572: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 573: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

AA/BA/CA/CA/FA/HA/TAAAAVABLABSAbt ACACAC ACBACCACCACC.ACCTACRACT.ACVADFAEAETAFRAAFRAMAXAFTAHAHTAHUAHWPAIAIDAIMSAIPAISAISIALAL.Q.ALARPAMAMPAMPAMRAMSAMVERANSI

Page 574: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

ANTSAPAPAPIAPTAPTARPAASASASAASCASCIIASHRAE ASIASMASMEASNTASRASTASTASTMASWATATTCATXAUS AUVAV AVRAWBAWGAWSAWWFB(MLD)B.L.B/CB/LBABBCBBCHPBCBCBCCBCRBEMBFBFEBFIbhd

Page 575: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

BHDBHPBHTBHWPBHWSBIMBIMCOBISBKTBLBMEPBMPBMSBMSBODBOGBOMBOQBRBSBSBSIBSRABSTBTBTUBVBWBWTBWTC.B.C.GC/DC/HC/LC/NC/OC/PCA CAACECACCCAD CADAMCADRA(CEQ)CAMCAPPCARCASCAS

Page 576: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

CASCbCBTCCCCICCRCCSCCTVCCUCEQCESACFDCFMCFRCFSCFWCGCGFCGRTCGSCGTCHCHSCICCIFCIMCIMSCIQCIRRCITESCIWSCJPCLCLCmCMSCNCCNGCNGCCOACODCODADCODAGCODLAGCODOGCODOGCOFF'DAMCOGAGCOGAS

Page 577: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

COGOGCOGOGCOLREGCONASCOPTCOSAGCOTCOTCOVCOWCpCPCPCPACPDFCPPCPUCR CRICRPCRPCRTCS CSCCSDPCSMCSPCSRCSRcStCTCTCTODCTSCuCu-NiCVHCVNCvpCVSCWCwCWCDD(mld)D/BD/GD/HD/H

Page 578: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

D/LD/MD/ND/OD/PD/PDA da, DaDAPDBdBDB DBMSDBWBTDCDCBDCFWDCPADCRPDCSPDDAMDDGdf, DfDFDEDFLDFTDFTDGDGPSDHPDIADIMDINDK.DLCFDLWLdm, dMDMTDNSDNVDODOTDOTDOTDPDP DP DPSDS

Page 579: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

DSRVDSVDTRCDUR.DWTDWT.E/IE/P CONV.E/REAEAEABEAPSEBWECEC ECCECDISECPECRECSEDWEEZEFTEG EGBEGREGWEGWEHPEIAPP ELELELEV.EMCEMIEMLOGEMPEMSEMSAEOQEOSEPAEPEEPIRBEPMEPPEQERWESBESCR

Page 580: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

ESSDESWETETETAETAETDEUEWSEXWFF.POSITIONF.SF/TFAFAFABFASFASFATFCAWFCBf'cleF'CLE DECKFCSFCUFDFFDMFDN.FEFCFEMFEUFFFFFFGFFTFIFIOFMFMEAFMQFMSFOFOFO/DOFOBFOCFOCFOCFOTFP

Page 581: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

FPPFPSOFPTFPUFRFR#FRPFSFSDFSOFSRUFSSFSUFSWFTCFVMFWFWDFWTGG/AG/BG/BG/TGATTGBSGEGIR.GLGLOVANGMGMAWGMDSSGNPGNWGPSGRPGRQGSIGSPGSPCOGTGT GTAWGXWHH.H/CH/COAMINGHAZHAZID

Page 582: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

HAZOPHBCMHBLHFHFOHFOTHIPOHNSHPHPHPMMHSLAHTHT HTCW systemHVHVACHWHY STEELHYD. P/PHzI/CI/EIAIACSIAEAIAMSARIAPHIAPPIAS

IBCIBCIBMIBSICAOICCICCASICCPICLLICSIDIECIEEEIEEPIETMIFFIGCIGGIGPPIHO

Page 583: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

IHOPIIWILLCILOILSIMCOIMDGIMIFIMOIMPAIMTINCOTERMSINMARSATINN.BTMINSINSAINT/EXTINTASCALEINTERTANKOINVARIOPPIPIQAIRSIRSTISISISM ISMAISOISPPISPSISSCIT

ITCWITFITTCITUIZJISJSAJSEAJSMSJSWJVK/L KBKDBKEDOKG/VCG

Page 584: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

KLKMTKRKSKSKSQSKTS.KTTCKWSLL/CL/CLA LABLANLASHLBPLC LCALCBLCCLCDLCFLCFLCGLCLLCMLCPLCULCVLEDLELLFLfLFLLFTLGLGSPLHDLIBO RATESLLLMELNGLNG-FPSOLNG-RVLOLO/LOLOALOCLOILONGL

Page 585: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

LORANLOTLPDLPGLPHLRLRITLSALSDLSTLSTLTLTFOCLWLLWLLWT (L/T)M/EM/HM/VMAMARADMARPOLMBMBOMCMCRMCRMDOMEPMEPCMGPSMGTMHCMICMIGMILMIOMIPMIPSMISCMLMLFMMMMMSI MODEMMODUMPCMPCMPIMRPMRS

Page 586: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

MSBMSCMSCMSRMTMTMTMT (MPI)MTBFMTCMTCMTTRNN/TNAFTANASNAVAREANAVCNAVTEXNCNCNCRNCRNDENDTNFNFBNICSNKNMNMDNNSSNOxNPSHNPTNRNRNNSNSCNSWCNUC lightNWTOO (OH)OAOBOBOOCIMFOCVOD ODME

Page 587: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

OECDOEMOFEOHOHQOJTONROP. TESTOPAOPVOSOSOSHAOTP & I ClubP & IDP STRP.P/BP/BP/CP/HP/NP/RMPAPABPanamax PBPBMPBSPCP-CADAMPCBPCCPCCPCGPCTCPDFPERTPFCPIPICPIVPJT.PLPLPLCPMAPMEPMLPMM

Page 588: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

PMSPMSPMSPNDPOPOMPOQPORPOROPOSPPBPPMPPMSPPPPPPPQRPRQPRUPRUPSPSPSPSAFPSCPSPCPSRPTPTPTPTPTOP-V ValvePWBSPWHTPWTQAQCQCVQISSPQMQTYR & DR/GR/HR/WRARAORBRBRBDORCMS

Page 589: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

RCSRCV. QTYRDDRDFREF.REV.RFIDRINRINARLQRMRMSRORO/ROROIROMROPAXRo-PaxROVRPBRPMRQRSRTRVSS/BS/CS/CS/G RMS/OS/TSAESAGESAMSATSATCOMSAWSBDSBGSBTSCSCSCSCSCCSCCSCFSCH.SCRSCR

Page 590: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

SCSISCSLSDSDNRSDNR ValveSESE SEASECASEMSESSESSFSFSFSFCSGSGPSGPSHPSIBSINAVALSISSISSLWLSMAWSNAKSNAMESOSOCSOHSPSOLASSONARSOPEPSOxSPSPASPCSPHTSPLTSPMSPMSPPSPPHSPPSSPWSQCSQLSRSRSR

Page 591: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

SRCSRVSSSSSSSSASSSBSSMSSPCSTASTBSTBSTB'DSTCSTCSTFTSTHASTHGSTIFF.STKMSTLTSTOSTSSTSSTSSUSSWSW SWATHSWBDSWBMSWGSWLSYM.tT. BHDT/ET/GT/UTATBTTCTCGTDCTEMTEUTG TGZTHK.THPTHP

Page 592: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

TIGTKTLTLVTMCPTMHDTPTPCTPMTQCTRANS.TSTSTSTSCFTSRTTTWIUAUAVUCLUHFULCCUMAUMSUNCTADUNEPUOMUPP.DKUPSURNUSCGUTUVUVPUVRVV/LVANVCGVCIV-DOWNVDRVDUVEVENTVERT.VHFVITVLVLBC

Page 593: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

VLCCVLFSVLOCVMSVOCVOFVOLTSVPMMVPPVRVRCVSTOLVTVTSV-UPW/C W/C W/HW/OWAWANWBWBTWDWFTWFTWHWHOWIGWIGWOWPWPCWPQTWPSWQTWRCWSDWT BHDWT.WT.WTOXFMRX-MTRY.S.ZDZOFMZPTM

Page 594: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

(Welding) AmpereAbove Base LineAir ConditionerAnticorrosiveAnti FoulingAir HoleAir TestAutomatic ApprovalAmphibious Assault VehicleAbove Base LineAmerican Bureau of ShippingaboutAlternating CurrentAccept with CommentAcetyleneAir Circuit BreakerAutomatic Combustion ControlAuxiliary Control ConsoleAccommodationAutomation Combustion Control TestApproach Control RadarActivityAir Cushion VehicleAutomatic Direction FinderAuxiliary EngineAcoustic Emission TestAverage Freight Rate AssessmentAverage Freight Rate Assessment at the maximum of DeadweightAftwardHospital ShipAcceptance Harbor TrialAir Handling UnitActual Hours of Work PerformedAllocated ItemAgency for International DevelopmentAmerican Institute of Merchant ShippingAir Independent PropulsionAutomatic Identification SystemAmerican Iron & Steel InstituteAlkyd PaintAllocation QuantityAs Low As Reasonably PracticableAmplitude ModulationAmpereAmplifierAuxiliary Machinery RoomAlarm & Monitoring SystemAutomated Mutual-Assistance Vessel Rescue SystemAmerican National Standards Institute

Page 595: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Automatic Navigation and Track-keeping SystemAfter PerpendicularAft PerpendicularAmerican Petroleum InstituteAfter Peak TankAft Peak TankAutomatic Rader Plotting AidsAnnual SurveySubmarine TenderAmerican Standard AssociationAutomatic Start ControlAmerican Standard Code For Information InterchangeAmerican Society of Heating, Refrigeration and Air Conditioning EngineersAllocated Stock ItemAir-to-Surface MissileAmerican Society of Mechanical EngineersAmerican Society of Nondestructive TestingSubmarine rescue shipAnti-Suction TunnelAcceptance Sea TrialAmerican Society for Testing MaterialsAnti-Submarine WarfareAcceptance TrialAmerican Towing Tank ConferenceTraining TenderAuto Unloading SystemAutonomous Underwater VehicleAir VentAutomatic Voltage RegulatorAirway BillAmerican Wire GaugeAmerican Welding SocietyAustralian Waterside Workers FederationBreadth (Moulded)baselineBulk CarrierBill of LadingBallastBare Boat CharterBare Boat Charter with Hire PurchaseBronze CastingBulk CarrierBridge Control ConsoleBallast Control RoomBoundary Element MethodButterflyBuilder Furnished EquipmentBaltic Freight Indexbulkhead

Page 596: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

BulkheadBrake Horse PowerBuilder's Harbor TrialBudgeted Hours of Work PerformedBudgeted Hours of Work ScheduledBoundary Integral MethodThe Baltic and Internation Maritime CouncilBuilt for In-Water SurveyBracketBase LineBrake Mean Effective PressureBarge Mounted PlantBridge Maneuvering SystemBurner Management SystemBiochemical Oxygen DemandBoiled Off GasBill of MaterialBack Order QuantityBrineBritish StandardsBoiler SurveyBritish Standard InstitutionBritish Ship Research AssociationBuilder's Sea TrialBuilder's TrialBritish Thermal UnitBureau VeritasBilge WellBallast Water TankBonded Warehouse TransactionChartered BaseCenter of GravitycofferdamCargo HoldCenter LineCredit NoteCertificate of OriginCapacity PlanControl AirComite Des Association D'Armateurs Des Communautes EuropeennesCentralized Administration & Control CenterComputer Aided DesignComputer Aided Design And ManufacturingCad-AdraComputer Aided ManufacturingComputer Aided Process PlanningCorrective Action RequestComponent Assembly ShopCondition Assessment Scheme

Page 597: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Canadian Standards AssociationBlock CoefficientClean Ballast TankCorvetteClass Comment ItemCargo Control RoomChina Classification SocietyClosed Circuit TelevisionCentral Control UnitCarbon EquivalentCommunity of European Shipyards' AssociationsComputational Fluid DynamicsConfirm CodeCode of Federal RegulationsContainer Freight StationCooling Fresh WaterGuided Missile CruiserContinuous Grain FlowCompensated Gross Rated TonnageCargo Gear SurveyCompensated Gross TonnageCargo HoldContinuous Hull SurveyCombat Information CenterCost, Insurance and FreightComputer Integrated ManufacturingComputer Integrated Manufacturing SystemCumulate Issue QuantityCommercial Interest Reference RatesConvention of the International Trade of Endangered SpeciesClose-In Weapon SystemComplete Joint PenetrationCenter LineChain LockerMidship Section CoefficientContinuous Machinery SurveyComputerized Numerical ControlCompressed Natural GasCompressed Natural Gas CarrierContract Of AffreightmentChemical Oxygen DemandCOmbined Diesel And DieselCOmbined Diesel And GasCOmbined Diesel-electric And GasCOmbined Diesel Or GasCombined Diesel Or Gas turbineCofferdamCombined Gas turbine And Gas turbineCOmbined gas and steam

Page 598: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

combined gas or gasCombined Gas turbine Or Gas turbineInternational Regulations for Preventing Collisions at Seacombined nuclear and steamCargo Oil Pump Turbinecombined steam and gasCrude Oil TankerCargo Oil Tank Coefficient of VariationCrude Oil WashingPrismatic CoefficientCollar PlateCommercial PaperClosest Point of ApproachCumulative Probability Density FunctionControllable Pitch PropellerCentral Processing UnitChinese Register Of ShippingClient Request ItemContra Rotating PropellerCarbon-glass Reinforced PlasticCathod Ray TubeConversion SurveyContainer Safety CodeComputerized Ship Design & Production System Cargo Securing ManualConcurrent Spare PartCommon Structural RulesContinuous Synopsis RecordCentistocksCargo TankCurrent TransformerCrack Tip Opening DisplacementCustody Transfer SystemCopperCopper NikelHelicopter Carriernuclear-powered Aircraft carrierVertical Prismatic CoefficientClear View ScreenCold WaterWater Plane CoefficientCirculating Water ChannelDepthMolded DepthDouble BottomDiesel GeneratorDehumidifierDrain Hole

Page 599: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Delivery Deadweight MeasurementDebit NoteDelivery OrderDelivery Against PaymentDown PaymentDocument Against AcceptanceAft Draft At A.P.Detailed Assembly ProcedureData BaseDecibelDry BulbData Base Management SystemDouble Bottom Water Ballast TankDirect CurrentDamage Control BookDouble Continuous Fillet WeldingDistance at Closest Point of ApproachD.C Reversed PolarityD.C Straight PolarityDynamic Design Analysis MethodGuided Missile DestroyerFore Draft At F.P.Dual Fuel Diesel EngineDesign Fatigue LifeDry Film ThicknessDiscrete Fourier TransformDiesel GeneratorDifferential Global Positioning SystemDelivered Horse PowerDiameterDimensionDeutsche Industrie NormenDeckDynamic Load Combination FactorDesign Load Water LineMean DraftDemand Type CodeDirect Numerical SimulationDet Norske VeritasDiesel OilDepartment of TradeDepartment of TransportationDiesel Oil TankDew PointDelivery PointDesign PressureDynamic Positioning SystemDocking Survey

Page 600: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Deep Submarine Rescue VehicleDeep Submergence VehicleDavid Tailor Research CenterDurationDeadweight Drinking WaterErection InspectionElectro Pneumatic ConverterEngine RoomEnvironmental AuditingEqual AngleFlexible Adhesive BackingEnvironmental Aspects In Product StandardsElectron Beam WeldingEuropean CommunitiesElectric Cable ProtectionEmergency Control ConsoleElectronic Chart Display and Information systemElectric Cable PipeEngine Control RoomElectronic Chart SystemEquivalent Design WaveExclusive Economic ZoneEarly Finish DateExhaust GasExhausted Gas BoilerExhaust gas recirculationElectro Gas WeldingElectro Gas WeldingEffective Horse PowerEngine International Air Pollution Prevention Environmental LabellingElongationElevationElectromagnetic Compatibility ElectroMagnetic InterferenceElectro Magnetic Speed LogElectroMagnetic PulseEnvironmental Management SystemEuropean Maritime Safety AgencyEconomic Order QuantityEngine Operating StationEnvironmental Protection AgencyEnvironmental Performance EvaluationEmergency Position Indicating Radio BeaconElectro Photo MarkingElementary Plate PanelEqual Electric Resistance WeldingEmergency Switch BoardEngine Sub Control Room

Page 601: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Environmentally Sound and Sustainable DevelopmentElectro Slag WeldingEddy Current TestElectromagnetic TestEvent Tree AnalysisEstimated Time of ArrivalEstimated Time of DepartureEuropean UnionEngineering Work StationEx. WorksFlat Position WeldingFlat PositionFrame SpaceFloatingFactory AutomationFoamFlux Asbestos BackingFree Alongside ShipFueling At SeaFactory Acceptance TrialFlux Cored Arc WeldingFlex Copper BackingforecastleForecastle DeckFire Control SystemFan Coil UnitForced Draft FanFinite Difference MethodFoundationFar Eastern Freight ConferenceFinite Element MethodForty-Feet Equivalent UnitFinish To FinishFrigateGuided Missile FrigateFast Fourier TransformFree InFree In And OutFrequency ModulationFailure Mode and Effects AnalysisForced Monthly Consumption QuantityFlexible Manufacturing SystemFree OutFuel Oil Fuel Oil & Diesel OilFree on-BoardFuel Oil ConsumptionFree Of ChargeFuel Oil ConsumptionFuel Oil TankFore Perpendicular

Page 602: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Fixed Pitch PropellerFloating Production,Storage and OffloadingForepeak TankFloating Production UnitFreonFrame No.Fiberglass Reinforced PlasticFinish To StartFabrication Sequence DiagramFloating Storage and OffloadingFloating Storage Regasification UnitFire Safety SystemFloating Storage UnitFriction Stir WeldingFast Time ControlFinite Volume MethodFresh WaterForwardFresh Water TankGalvanizeGeneral ArrangementGear BoxGrit BlastingGross TonnageGeneral Agreement Of Tariffs And TradeGoal Based StandardsGenerator EngineGirderGermanisher LloydGlobal Local Area NetworkMetacentric HeightGas Metal Arc WeldingGlobal Maritime Distress and Safety SystemGross National ProductGross National WelfareGlobal Positioning SystemGlass Reinforced PlasticsGross Requirement QuantityGeneral Stock ItemGroup Starter PanelGeneralized System of Preferences Certificate of OriginGross TonnageGaz TransportGas Tungsten Arc WeldingGouging & WeldingHorizontal PositionHorizontal Position WeldingHatch CoverHatch CoamingHeat Affected ZoneHazard Identification

Page 603: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Hazard and OperabilityHull Block Construction MethodHydrostatically Balanced LoadingHigh FrequencyHeavy Fuel OilHeavy Fuel Oil TankHierarchy and Input-Process-Output chartHazardous and Noxious SubstancesHorse PowerHydraulic PressureHorizontal Planar Motion MechanismHigher Strength Low Alloied SteelHydro TestHigher Tensile Steelhigh temperature cooling water systemVickers HardnessHeating, Ventilating and Air ConditioningHot WaterHigh Yield Strength SteelHydraulic PumpHertzInter CoatingInclining ExperimentInverted AngleInternational Association of Classification SocitiesInternational Atomic Energy AgencyInternational Aeronautical & Maritime Search & RescueInternational Association of Ports and HarborsInternational Air Pollution PreventionIntegrated Automation System

International Bulk Chemical CodeImmersed-Boundary MethodIntegrated Bridge SystemInternational Civil Aviation OrganizationInstitute Cargo ClausesInternational Conference On Computer Application In ShipbuildingImpressed Cathodic Current ProtectionInternational Convention on Load Lines International Chamber of ShippingInternal DiameterInternational Electrotechnical CommissionInstitute of Electrical and Electronic EngineersThe International Environmental Education ProgramInteractive Electronic Technical ManualIdentification Friend or FoeInternational Gas CodeInert Gas GeneratorInternational Garbage Pollution PreventionInternational Hygrographic Office

International Code for the Construction and Equipment of Ships Carrying Dangerous Chemicals in Bulk 

Page 604: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Integrated Hull, Outfitting and PaintingInternational Institute of WeldingInternational Load Line ConventionInternational Labor OrganizationIntegrated Logistic SupportIntergovernmental Maritime Consultative OrganizationInternational Maritime Dangerous GoodsInternational Maritime Industry ForumInternational Maritime OrganizationInternational Maritime Pilots' AssociationInternational Multimodal TransportInternational Rules For The Interpretation Of Trade TermsInternational Maritime SatelliteInner BottomIntegrated Navigation SystemInternational Shipowners' AssociationInternal/ExternalThe International Tanker Nominal Freight Scale Association Ltd.International Association of Independent Tanker Ownersinvariable steelInternational Oil Pollution PreventionIncomplete PenetrationInternal Quality AuditIndian StandardInfra-Red Search and TrackIntermediate Surveyintrinsically safety barrierInternational Safety ManagementInternational Ship Managers' AssociationInternational Organization for StandardizationInternational Sewage Pollution PreventionInternational Ship and Port Facility SecurityInternational Ship and Offshore Structures CongressInterpass Temperature

International Trade FederationInternational Towing Tank ConferenceInternational Telecommunication UnionInorganic ZincJapanese Industrial StandardThe Japanese Shipowner's AssociationJapan Ship Exporter's AssociationJapanese Society of Materials & ScienceJapan Welding SocietyJoint VentureKeel LayingVertical Center of Buoyancy above Base LineKorean Development BankKorea Energy Development OrganizationVertical Center Of Gravity Above Base Line

International Convention on Standards of Training Certification and Watchkeeping for Seafarers

Page 605: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Knuckle LineTransverse Metacenter Above Base LineKorean Register of ShippingKorean Industrial StandardKorean (Industrial) StandardKorea Shipbuilding Quality StandardsKnotsKorean Towing Tank ConferenceKorean Welding SocietyLubrication OilLetter of CreditLaunchingLicence AgreementLaboratoryLocal Area NetworkLighter Aboard ShipLength Between PerpendicularsLetter Of CreditLife Cycle AnalysisLongitudinal Center of BuoyancyAmphibious Command ShipLiquid Crystal DisplayLongitudinal Center of FloatationLoad Combination FactorLongitudinal Center of GravityLess Than Container / Car Load Cargo / LotsLanding Craft, MechanisedLoad Calculation PointLanding Craft, Utilitylower calorific valueLight Emitting Diodelower explosion limitLack of FusionFreeboard Lengthlower flammable limitLatest Finish DateLetter of GuaranteeLocal Group Start PanelLanding Helicopter DockLondon Interbank Offered RatesLoad LineLondon Metal ExchangeLiquified Natural GasLNG-Floating Production Storage OffloadingLNG-Regasification VesselLubricant OilLift on / Lift offLength OverallLetter of CreditLetter of IntentLongitudinal

Page 606: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Long Range NavigationLubricant Oil TankLanding Platform DockLiquified Petroleum GasLanding Platform HelicopterLloyd's Register of ShippingLong - Range Identification and Tracking systemLife Saving ApplianceLanding Ship DockLanding Ship TankLatest DateLeak TestAmpibious Task Force Operating CenterLength of Water LineLoad Water LineLight WeightMain EngineMan HoleMotor VesselMachinery ArrangementMaritime Administration of Department of TransportationInternational Convention for the Prevention of Marine Pollution from ShipMega ByteManagement by ObjectivesManufacturing CollaborationMaximum Continuous RatingMachinery Control RoomMarine Diesel OilMean Effective PressureMaritime Environment Protection CommitteeMarine Growth Preventing SystemMetallographic TestMinehunter, CoastalMicronsMetal Inert Gas Arc WeldingMilitary Specifications and StandardMicaceous (Sparkling) Iron OxideMean Indicating PressureMillion Intructions Per SecondMalaysian International Shipping CorporationMine LayerMaterial List of FittingThousand Million (Ton-Miles)Maritime Mobile Service Identification NumberModulator - DemodulatorMobile Offshore Drilling UnitMulti Purpose CarrierMulti-purpose Cargo shipMagnetic Particle InspectionMaterial Requirement PlanningMaterial Requirement Sheet

Page 607: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Main Switch BoardMaritime Safety CommitteeMaterial Specification CodeMechanical Stress RelievingMail TransferMetric TonMooring Trial / Main TurbineMagnetic Particle Test (Inspection)Mean Time Between FailureMoment to Change One Centimeter TrimMaritime Transport CommitteeMean Time To RepairNitrogenNet TonnageNorth American Free Trade AgreementNational Aerospace Standardworld-wide NAVigational warning service AREANavigation ConsoleNAVigational information TEleXNumerical ControlNoise CriteriaNormal Continuous RatingNon-Conformity ReportNon Destructive ExaminationNondestructive TestNorme FramaiseNo Fuse BreakerNewly Industrializing EconomicsNippon Kaiji KyokaiNautical MileNorwegian Maritime DirectorateNavy Navigation Satellite SystemNitrogen Oxidesnet positive suction headNonproliferation TreatyNoise ReductionNoise Rating NumberNorske StandardNorwegian Shipping Control ActNaval Ship Warfare Center Non-Under Command lightNon Water TightOxygenOverhead PositionOffice AutomationOiling BareOre-Bulk-Oil CarrierOil Companies' International Maritime ForumOpen Circuit VoltageOuter DiameterOil Discharge Monitoring Equipment

Page 608: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Organization for Economic Cooperation and DevelopmentOriginal Equipment ManufacturerOwner Furnished EquipmentOverhead Position WeldingOn Hand QuantityOn the Job TrainingOffice of Naval ResearchOperating TestOil Pollution ActOffshore Patrol VesselOccasional SurveyOperating SystemOccupational Safety Health AdministrationOil TightProtection and Indemnity ClubPiping and Instrumentation DiagramPanting StringerPenetrationPower BrushingPower BrushingProduct CarrierPilot HousePart NumberPump RoomPublic Adress Projector Available BalancePanama Canal transit Maximum SizePatrol BoatPackage Blasting MachinePush Button SwitchProduct CarrierProfessional CadamPrinted Circuit BoardPure Car CarrierPropulsion Control ConsoleProductivity Control GroupPure Car Truck CarrierProbability Density FunctionProgram Evaluation and Review TechniqueperfluorocarbonPressure IndicatorPressure Indicating ControllerParticle Image VelocimetryProject Product LiabilityPlateProgrammable Logic ControllerPermanent Means of AccessPrecision Measuring EquipmentPallet Material ListPlanar Motion Mechanism

Page 609: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Power Management SystemPlanned Maintenance SchemePreventive Maintenance ScheduleProduction Need DatePurchase OrderPrince Ocean ModelPurchase Order QuantityPurchase Order RequestPorosityPurchase Order SpecificationParts per BillionParts per MillionProcesses and Production MethodsPolluter Pays PrinciplePurchasing Power ParityProcedure Qualification Test RecordPurchase Requision QuantityPurchase RequestPower Related UnbalancePropeller Shaft SurveyPferd StarkePressure SwitchPortside Starboardside. Aft. ForePort State ControlPerformance Standards for Protective CoatingsPractical Spreading Ratedye penetrant testliquid penetrant testpressure transmitterPenetrant TestPower Take-offPressure-Vacuum ValveProduct Work Breakdown StructurePost Weld Heat TreatmentPotable Water TankQuality AssuranceQuality ControlQuick Closing ValveQuality and Inspection Standards for Ships PaintingQuality ManagementQuantityResearch and DevelopmentReduction GearRelative HumidityRound WeldingReduction Of AreaResponse Amplitude OperatorRound BarResistance BulbReliability Based Design Optimimization)Reefer Container Monitoring System

Page 610: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Radar Cross SectionReceiving QuantityRequest Delivery DateRadio Direction FinderReferenceRevisionRadio Frequency IdentificationReaction Influence NumberRegistro Italiano NavaleReorder Level QuantityRoomRoot Mean SquareRecognized OrganizationRoll on / Roll offReturn on InvestRead Only MemoryRO-RO Passenger VesselRoll-on Roll-off PassengerRemotely Operated VehicleRemote Start/Stop Push ButtonRevolutions per MinuteRe-Qualification TestRussian Maritime Register of ShippingRadiographic testRegasification VesselStbd Starboard SideSand BlastingSea ChestSteel CuttingSteering Gear RoomShipping OrderSea TrialSociety of Automotive EngineersStrategic Advisory Group on EnvironmentSurface-to-Air MissileSea Acceptance TrialSatellite CommunicationSubmerged Arc WeldingSimulation Based DesignSee-Beufs GenossenschaftSegregated Ballast TankCargo Ship Safety Construction CertificateSafety ConstructionCasting steelWater ScupperShip Control ConsoleStress Corosion CrackingStress Concentration FactorSchduleSilicon Controlled Rectifierselective catalytic reduction

Page 611: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Small Computer System InterfaceSuez Canal SearchlightSoundingScrew Down Non ReturnScrew Down Non-Return ValveCargo Ship Safety Equipment CertificateSafety EquipmentStatistical Energy AnalysisSulphur Emission Control AreasScanning Electron MicroscopeShip Earth StationSurface Effect ShipStart to FinishSteel ForgingStowage FactorSpecific Fuel ConsumptionSteering GearSteel Gas PipeSteel Pipe For Ordinary PipingShaft Horse PowerShip Information BookBrazilian Shipbuilding AssociationSvensk StandardSwedish Standard InstructionSummer Load Water LineShielded Metal Arc WeldingSociety of Naval Architects of KoreaSociety of Naval Architects & Marine EngineersShipping OrderSocial Overhead CapitalShipboard Occupational Health and Safety ProgramInternational Convention for the Safety of Life at SeaSound Navigation and RangingShipboard Oil Pollution Emergency PlanSulphur OxidesSoil PipeAlloy Steel PipesSelf Polishing CopolymerCarbon Steel Pipes for High Temperature ServiceSteel Pipes for Low Temperature ServiceShock Pulse Monitoring Single Point MooringCarbon Steel Pipes for Orinary PipingCarbon Steel Pipes for High Pressure ServiceCarbon Steel Pipe for Pressure ServiceArc Welded Carbon Steel PipeStatistical Quality ControlStructured Query LanguageCargo Ship Safety Radiotelegraphy CertificateSafety RadioStress Relieving

Page 612: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Stress Relieving CrackingShuttle and Regasification VesselSpecial SurveyStart To StartSuspended SolidShip Security Alert SystemSingle-Side -BandSurface-to-Surface MissileSteel Structure Painting CouncilAlloy Steel Tubes For Structural PurposeSeamless Bearing Steel TubeStainless Steel Boiler And Heat Exchanger TubesStarboardSensitivity Time ControlSound Transmission ClassShort Time Fourier TransformAlloy Steel Boiler And Heat Exchanger TubesSeamless Steel Tubes For High Pressure Gas CylinderStiffenerCarbon Steel Tubes For Machine Structural PurposeSteel Heat Exchanger Tubes For Low Temperature ServiceSeamless Steel Oil Well Casing / Tubing And Drill PipeSteel Tubing SpecialStainless Steel PipesStainless SteelStainless SteelStud WeldingSea WaterSmall Water Plane Area Twin HullSwitchboardStill Water Bending MomentStandard Wire GaugeSafe Working LoadSymmetricalThicknessTransverse BulkheadTar Epoxy PaintTurbogeneratorTouch-UpTechnical AssistanceTributyl-TinTurbo ChargerTransverse Center of GravityTop Dead CenterTransient Electro MagneticTwenty-Feet Equivalent UnitTurbine GeneratorTechni-GazThicknessThrust Horse Powerthrust horse power

Page 613: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Tungsten Inert Gas Arc WeldingTank Test LoadThreshold Limit ValueThermo Mechanical Controlled ProcessTransmitting Magnetic Heading DeviceTest PressureTonnes per Centimeter ImmersionTotal Productive maintenanceTotal Quality ControlTransverse, Transverse BulkheadTensile StrengthTravel SpeedTarget StrengthTanker Structure Cooperative ForumTheory Spray RatioTelegraphic TransferThe Welding InstituteUnequal AngleUnmanned Aerial VehicleUpper Control LimitUltra High FrequencyUltra Large Crude Oil CarrierUnattended Machinery AutomationUnattended Machinery SpaceUnited Nations Conference on Trad and DevelopmentUnited Nations Environmental ProgramUnit of MeasurementUpper DeckUninterruptable Power SupplyUnderwater Radiated NoiseUnited States Coast GuardUltrasonic TestUltra VioletUnder voltage ProtectionUnder voltage ReleaseVertical Positionvertical ladderValue Added NetworkVertical Center of GravityVolatile Corrosion InhibitorVertical DownwardVoyage Data RecorderVisual Display UnitValue EngineeringVentilation, VentilatorVerticalVery High FrequencyVariable Injection TimingVertical LadderVery Large Bulk Carrier

Page 614: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

Very Large Crude Oil CarrierVery Large Floating StructureVery Large Ore CarrierVoyage Management SystemVolatile Organic CompoundsVolume of FluidVoltageVertical Planar Motion MechanismVelocity Prediction ProgramVirtual RealityValve Remote ControlVertical or Short Take-Off/LandingVisual TestVessel Traffic ServiceVertical UpwardWall & CeilingWater ClosetWheel HouseWork OrderWith AverageWide Area NetworkWet BulbWater Ballast TankFire & Wash DeckWet Film ThicknessWet Film ThicknessWorking HoleWorld Health OrganizationWing in Ground-effect Wing in Ground-Effectwaste oilWorking PressWave Piercing CatamaranWelding Procedure Qualification TestWelding Procedure SpecificationWelder Qualfification TestWelding Research CouncilWork Sequence DiagramWater Tight BulkheadWater Tight or Weather TightWeightWorld Trade OrganizationTransformerTransmitterYield StrengthZero DefectZone Outfitting MethodZone Painting Method

Page 615: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram
Page 616: kemco.or.krkemco.or.kr/up_load/blog/조선표준용어.xls · XLS file · Web view통합약어 통합용어(영-한) 통합용어(한-영) polarity Pressure -Volume (PV) diagram

International Convention for the Prevention of Marine Pollution from Ship