of 27 /27
BAB I PENDAHULUAN 1.1 Latar Belakang Sejak lahirnya kurikulum PPSP (Proyek Perintis Sekolah Pembangunan) yang kemudian disusul oleh lahirnya kurikulum tahun 1975, telah tertanam kesadaran pada para guru bahwa tujuan pelaajaran harus dirumuskan sebelum proses belajar- mengajar berlangsung. Tujuan tersebut harus diberitahukan kepada para siswa. Jadi, tujuan tersebut bukanlah sesuatu yang perlu dirahasiakan. Apabila dalam pengajaran tidak disebutkan tujuannya, siswa tidak akan tahu mana pelajaran yang penting dan mana yang tiak. Tujuan pendidikan dapat dirumuskan pada tiga tingkatan. Pertama, tujuan umum pendidikan. Tujuan ini menentukan perlu dan tidaknyasesuatu program diadakan. Di dalam praktek sehari- hari di sekolah, tujuan ini dikenal sebagai TIU (Tujuan Instruksional Umum). Kedua, tujuan yang disadarkan atas tingkah laku yang dimaksud adalah berhasilnya pendidikan dalam bentuk tingkah laku. Inilah yang dimaksud taksonomi (taxonomy). Ada 3 macam tingkah laku yang dikenal umum, yaitu kognitif, afektif, dan psikomotor (keterampilan). Ketiga, tujuan yang lebih jelas yang dirumuskan secara operasional. Kaum behavioris (kaum yang mengutamakan tingkah laku), berpendapat bahwa taksonomi yang dikemukakan oleh Bloom dan kawan-kawan, adalah sangat bersifat mental. Mereka tidak menjelaskan kepada para pendidik secara konkret dan dapat diamati. Dalam pelaksanaa pendidikan di sekolah, ketiga tujuan ini harus ada. Tetapi prakteknya memang sulit karena dalam beberapa hal, penafsirannya lalu menjadi subjektif. Kesulitan lain adalah bahwa sulit untuk menjabarkan tujuan umum ini menjadi tujuan yang lebih terperinci. Beberapa ahli telah mencoba memberika cara bagaimana menyebut ketiga tingkatan tujuan ini, yang akhirnya oleh (Viviane De Landsheere) dismpulkan bahwa ada 3 tingkat tujuan (termasuk taksonomi), yaitu: 1. Tujuan akhir atau tujuan umum pendidikan. 1

Makalah Evaluasi Taksonomi Bloom

Embed Size (px)

DESCRIPTION

makalah

Text of Makalah Evaluasi Taksonomi Bloom

1 BAB I PENDAHULUAN 1.1 Latar Belakang SejaklahirnyakurikulumPPSP(ProyekPerintisSekolahPembangunan)yang kemudiandisusulolehlahirnyakurikulumtahun1975,telahtertanamkesadaranpadapara gurubahwatujuanpelaajaranharusdirumuskansebelumprosesbelajar-mengajar berlangsung.Tujuantersebutharusdiberitahukankepadaparasiswa.Jadi,tujuantersebut bukanlahsesuatuyangperludirahasiakan.Apabiladalampengajarantidakdisebutkan tujuannya, siswa tidak akan tahu mana pelajaran yang penting dan mana yang tiak. Tujuanpendidikandapatdirumuskanpadatigatingkatan.Pertama,tujuanumum pendidikan.Tujuaninimenentukanperludantidaknyasesuatuprogramdiadakan.Didalam praktek sehari-hari di sekolah, tujuan ini dikenal sebagai TIU (Tujuan Instruksional Umum). Kedua,tujuanyangdisadarkanatastingkahlakuyangdimaksudadalahberhasilnya pendidikandalambentuktingkahlaku.Inilahyangdimaksudtaksonomi(taxonomy).Ada3 macamtingkahlakuyangdikenalumum,yaitukognitif,afektif,danpsikomotor (keterampilan).Ketiga,tujuanyanglebihjelasyangdirumuskansecaraoperasional.Kaum behavioris(kaumyangmengutamakantingkahlaku),berpendapatbahwataksonomiyang dikemukakanolehBloomdankawan-kawan,adalahsangatbersifatmental.Merekatidak menjelaskan kepada para pendidik secara konkret dan dapat diamati. Dalampelaksanaapendidikandisekolah,ketigatujuaniniharusada.Tetapi prakteknyamemangsulitkarenadalambeberapahal,penafsirannyalalumenjadisubjektif. Kesulitanlainadalahbahwasulituntukmenjabarkantujuanumuminimenjaditujuanyang lebih terperinci. Beberapaahlitelahmencobamemberikacarabagaimanamenyebutketigatingkatan tujuanini,yangakhirnyaoleh(VivianeDeLandsheere)dismpulkanbahwaada3tingkat tujuan (termasuk taksonomi), yaitu: 1.Tujuan akhir atau tujuan umum pendidikan. 2.Taksonomi. 3.Tujuan yang operasional (Arikunto, 2009). Untuk lebih lanjut, kami akan membahas secara khusus mengenai taksonomi bloom. 1.2 Rumusan Masalah 1.Apa yang dimaksud dengan taksonomi bloom? 2.Bagaimana ranah kognitif dalam taksonomi bloom? 3.Bagaimana ranah afektif dalam taksonomi bloom? 4.Bagaimana ranah psikomotor dalam taksonomi bloom? 5.Bagaimana revisi taksonomi bloom? 2 1.3 Tujuan 1.Menyebutkan pengertian taksonomi bloom. 2.Mengetahui tentang ranah kognitif dalam taksonomi bloom. 3.Mengetahui tentang ranah afektif dalam taksonomi bloom. 4.Mengetahui tentang ranah psikomotor dalam taksonomi bloom. 5.Mengetahui revisi taksonomi bloom. 3 BAB II PEMBAHASAN 2.1 Taksonomi Bloom Kata taksonomi diambildaribahasaYunani tassein yangberarti untuk mengelompokkan dan nomos yangberarti aturan.Taksonomidapatdiartikansebagai pengelompokan suatu hal berdasarkan hierarki (tingkatan) tertentu. Di mana taksonomi yang lebih tinggi bersifat lebih umum dan taksonomi yang lebih rendah bersifat lebih spesifik. TaksonomiPembelajarandapatdidefinisikanberdasarkanpadaasumsi,bahwa programpendidikandapatdipandangsebagaisuatuusahamengubahtingkahlakusiswa denganmenggunakanbeberapamatapelajaran.Bilakitauraikantingkahlakudanmata pelajaran,kitamembuatsuatutujuanpendidikan.Sebagaicontoh:siswaakandapat mengingat kembali tokoh-tokoh sejarah perjuangan kemerdekaaan Indonesia. Taksonomi juga mempunyai arti klasifikasi berhirarkhi dari sesuatu atau prinsip yang mendasariklasifikasi.Semuahalyangbergerak,bendadiam,tempat,dankejadiansampai padakemampuanberpikirdapatdiklasifikasikanmenurutbeberapaskemataksonomi.Suatu kegiatanpembelajarandilakukanuntukmencapaitujuantertentu,yaituhasilbelajarberupa perubahantingkah-lakumahasiswa.Tanpaadanyatujuanpembelajaranyangjelas, pembelajaranakanmenjaditanpaarahdanmenjaditidakefektif.Untukdapatmenentukan tujuanpembelajaranyangdiharapkan,pemahamantaksonomitujuanatauhasilbelajar menjadisangatpentingbagiguru(pendidik).Denganpemahamaniniguruakandapat menentukan dengan lebih jelas dan tegas apakah tujuan pembelajaranlebih bersifat kognitif, dan mengacu kepada tingkat intelektual tertentu, atau lebih bersifat afektif atau psikomotor. TaksonomiBloommerujukpadataksonomiyangdibuatuntuktujuanpendidikan. TaksonomiinipertamakaliolehBenjaminS.Bloomdankawan-kawanpadatahun1956. Dalamhalini,tujuanpendidikandibagimenjadibeberapa domain (ranah,kawasan)dan setiapdomaintersebutdibagikembalikedalampembagianyanglebihrinciberdasarkan hirarkinya. Tujuan pendidikan dibagi ke dalam tiga domain, yaitu: 1.CognitiveDomain (RanahKognitif),yangberisiperilaku-perilakuyangmenekankan aspek intelektual, seperti pengetahuan, pengertian, dan keterampilan berpikir. 2.AffectiveDomain (RanahAfektif)berisiperilaku-perilakuyangmenekankanaspek perasaan dan emosi, seperti minat, sikap, apresiasi, dan cara penyesuaian diri. 3.Psychomotor Domain (Ranah Psikomotor) berisiperilaku-perilakuyangmenekankan aspekketerampilanmotoriksepertitulisantangan,mengetik,berenang,dan mengoperasikan mesin. 2.2 Ranah Kognitif 4 Ranah kognitif adalah ranah yang mencakup kegiatan mental (otak). Menurut Bloom, segala upayayang menyangkut aktivitas otak adalah termasuk dalamranah kognitif.Ranah kognitifberhubungandengankemampuanberfikir,termasukdidalamnyakemampuan menghafal,memahami,mengaplikasi,menganalisis,mensintesis,dankemampuan mengevaluasi.Dalamranahkognitifituterdapatenamaspekataujenjangprosesberfikir, mulai dari jenjang terendah sampai dengan jenjangyang paling tinggi. Keenam jenjang atau aspek yang dimaksud adalah: Pengetahuan/hafalan/ingatan (knowledge) Adalah kemampuan seseorang untuk mengingat-ingat kembali (recall) atau mengenali kembalitentangnama,istilah,ide,rumus-rumus,dansebagainya,tanpamengharapkan kemampuanuntukmenggunkannya.Pengetahuanatauingatanadalahmerupakanproses berfikir yang paling rendah. Salahsatucontohhasilbelajarkognitifpadajenjangpengetahuanadalahdapat menghafalsuratal-Ashar,menerjemahkandanmenuliskannyasecarabaikdanbenar, sebagai salah satu materi pelajaran kedisiplinan yang diberikan oleh guru Pendidikan Agama Islam di sekolah. Pemahaman (comprehension) Adalah kemampuan seseorang untuk mengerti atau memahami sesuatu setelah sesuatu itudiketahuidandiingat.Dengankatalain,memahamiadalahmengetahuitentangsesuatu dandapatmelihatnyadariberbagaisegi. Seseorangpesertadidikdikatakanmemahami sesuatu apabila ia dapat memberikan penjelasan atau memberi uraian yang lebih rinci tentang halitudenganmenggunakankata-katanyasendiri.Pemahamanmerupakanjenjang kemampuan berfikir yang setingkat lebih tinggi dari ingatan atau hafalan. Salah satu contoh hasil belajar ranah kognitif pada jenjang pemahaman ini misalnya: PesertadidikataspertanyaanGuruPendidikanAgamaIslamdapatmenguraikantentang makna kedisiplinan yang terkandung dalam surat al-Ashar secara lancar dan jelas. Penerapan (application) Adalah kesanggupan seseorang untuk menerapkan atau menggunakan ide-ide umum, tatacaraataupunmetode-metode,prinsip-prinsip,rumus-rumus,teori-teoridansebagainya, dalamsituasiyangbarudankongkret.Penerapaniniadalahmerupakanprosesberfikir setingkat lebih tinggi ketimbang pemahaman. Salahsatucontohhasilbelajarkognitifjenjangpenerapanmisalnya:Pesertadidik mampumemikirkantentangpenerapankonsepkedisiplinanyangdiajarkanIslamdalam kehidupan sehari-hari baik dilingkungan keluarga, sekolah, maupun masyarakat. Analisis (analysis) 5 Adalahkemampuanseseoranguntukmerinciataumenguraikansuatubahanatau keadaan menurut bagian-bagianyang lebih kecil dan mampu memahami hubungan di antara bagian-bagianataufaktor-faktoryangsatudenganfaktor-faktorlainnya.Jenjanganalisis adalah setingkat lebih tinggi ketimbang jenjang aplikasi. Contoh:Pesertadidikdapatmerenungdanmemikirkandenganbaiktentangwujud nyata dari kedisiplinan seorang siswa dirumah, disekolah, dan dalam kehidupan sehari-hari di tengah-tengah masyarakat, sebagai bagian dari ajaran Islam. Sintesis (syntesis) Adalahkemampuanberfikiryangmerupakankebalikandariprosesberfikiranalisis. Sisntesismerupakansuatuprosesyangmemadukanbagian-bagianatauunsur-unsursecara logis,sehinggamenjelmamenjadisuatupolayangyangberstrukturataubebrbentukpola baru.Jenjangsintesiskedudukannyasetingkatlebihtinggidaripadajenjanganalisis.Salah satujasilbelajarkognitifdarijenjangsintesisiniadalah:pesertadidikdapatmenulis karangan tentang pentingnya kedisiplinan sebagiamana telah diajarkan oleh islam. Penilaian/penghargaan/evaluasi (evaluation) Adalahmerupakanjenjangberpikirpalingtinggidalamranahkognitifdalam taksonomi Bloom. Penilian/evaluasi disini merupakan kemampuan seseorang untuk membuat pertimbangan terhadap suatu kondisi, nilai atau ide, misalkan jika seseorang dihadapkan pada beberapapilihanmakaiaakanmampumemilihsatupilihanyangterbaiksesuaidengan patokan-patokan atau kriteria yang ada. Salah satu contoh hasil belajar kognitif jenjang evaluasi adalah: peserta didik mampu menimbang-nimbangtentangmanfaatyangdapatdipetikolehseseorangyangberlaku disiplindandapatmenunjukkanmudharatatauakibat-akibatnegatifyangakanmenimpa seseorangyangbersifatmalasatautidakdisiplin,sehinggapadaakhirnyasampaipada kesimpulanpenilaian,bahwakwdisiplinanmerupakanperintahAllahSWTyangwaji dilaksanakan dalam sehari-hari. KeenamjenjangberpikiryangterdapatpadaranahkognitifmenurutTaksonomi Bloom itu, jika diurutkan secara hirarki piramidal adalah sebagai tertulis padagambar 1. Keenamjenjangberpikirranahkognitifbersifatkontinumdanoverlap(tumpangtindih), dimanaranahyanglebihtinggimeliputisemuaranahyangadadibawahnya.Overlapdi antara enam jenjang berfikir itu akan lebih jelas terlihat pada gambar. 6 GAMBAR 1. Enam jenjang berpikir pada ranah kognitif GAMBAR 2. Overlap antara enam jenjang pada ranah kognitif. Keterangan:Pengetahuan(1)adalahmerupakanjenjangberpikirpalingdasar.Pemahaman (2)mencakuppengetahuan(1).Aplikasiataupenerapan(3)mencakuppemahaman(2)dan pengetahuan(1).Sintesis(5)meliputijugaanalisis(4),aplikasi(3),pemahaman(2)dan pengetahuan (1). Evaluasi (6) meliputi juga sintesis (5) , analisis (4), aplikasi (3), pemahaman (2) dan pengetahuan (1). Tujuanaspekkognitifberorientasipadakemampuanberfikiryangmencakup kemampuanintelektualyanglebihsederhana,yaitumengingat,sampaipadakemampuan memecahkanmasalahyangmenuntutsiswauntukmenghubungakandanmenggabungkan beberapaide,gagasan,metodeatauproseduryangdipelajariuntukmemecahkanmasalah tersebut. Dengan demikian aspek kognitif adalah subtaksonomi yang mengungkapkan tentang kegiatan mental yang sering berawal dari tingkat pengetahuan sampai ke tingkat yang paling tinggi yaitu evaluasi (Sudijono. 1995;49-53). Ciri-ciri Ranah Penilaian Kognitif Aspekkognitifberhubungandengankemampuanberfikirtermasukdidalamnya kemampuanmemahami,menghafal,mengaplikasi,menganalisis,mensistesisdan kemampuanmengevaluasi.MenurutTaksonomiBloom(Sax1980),kemampuankognitif adalahkemampuanberfikirsecarahirarkiyangterdiridaripengetahuan,pemahaman, aplikasi, analisis, sintesis dan evaluasi. Padatingkatpengetahuan,pesertadidikmenjawabpertanyaanberdasarkanhafalan saja.Padatingkatpemahamanpesertadidikdituntutjuntukmenyatakanmasalahdengan kata-katanyasendiri,membericontohsuatukonsepatauprinsip.Padatingkataplikasi, pesertadidikdituntutuntukmenerapkanprinsipdankonsepdalamsituasiyangbaru.Pada tingkat analisis, peserta didik diminta untuk untuk menguraikan informasi ke dalam beberapa bagian,menemukanasumsi,membedakanfaktadanpendapatsertamenemukanhubungan sebabakibat.Padatingkatsintesis,pesertadidikdituntutuntukmenghasilkansuatucerita, komposisi,hipotesisatauteorinyasendiridanmensintesiskanpengetahuannya.Padatingkat 7 evaluasi,pesertadidikmengevaluasiinformasisepertibukti,sejarah,editorial,teori-teori yang termasuk di dalamnya judgement terhadap hasil analisis untuk membuat kebijakan. Tujuanaspekkognitifberorientasipadakemampuanberfikiryangmencakup kemampuanintelektualyanglebihsederhana,yaitumengingat,sampaipadakemampuan memecahkanmasalahyangmenuntutsiswauntukmenghubungkandanmenggabungkan beberapaide,gagasan,metodeatauproseduryangdipelajariuntukmemecahkanmasalah tersebut. Apabilamelihatkenyataanyangadadalamsistempendidikanyangdiselenggarakan, padaumumnyabarumenerapkanbeberapaaspekkognitiftingkatrendah,seperti pengetahuan,pemahamandansedikitpenerapan.Sedangkantingkatanalisis,sintesisdan evaluasijarangsekaliditerapkan.Apabilasemuatingkatkognitifditerapkansecaramerata dan terus-menerus maka hasil pendidikan akan lebih baik. Alat Ukur Kognitif a. Lisan Pertanyaan lisan dapat digunakan untuk mengetahui daya serap siswa untuk masalah yang berkaiatan dengan aspek kognitif. Petunjuk yang perlu diperhatikan dalam penggunaan tes lisan: Ingatkansiswasejakawalbahwatujuanteslisanadalahmengumpulkan informasi tentang pencapaian mereka. Selamateslisan.Gurumengambiltempatduduksedemikianrupasehinggadapat berpandangantetapisiswatidakdapatmelihatapayanggurutuliskanpadalembar jawaban. Hindarimembuatkomentar,gerakan,ungkapanwajah,atausuarayangbias ditafsirkan oleh siswa sebagai menyetujui atau tidak jawaban yang diberikan. Hindari penyimpangan dari catatan tes lisan yang sudah disiapkan ketika menyusun soal. b.Pilihan ganda, Soalyangmenugasisiswauntukmemilihsalahsatujawabandaridaftarpilihanyang disediakan. Pilihangandabiasaataumelengkapisoaldalambentukiniterdiriataskalimatpokok yang berupa pertanyaan yang belum lengkap diikuti dengan 4 atau 5 alternatif jawaban. Hubungan Antarhal atau hubungan sebab akibat: Soal ini terdiri atas dua pernyataan yang dihubungkan dengan katasebab 8 Keduapernyataandapatbernilaibenaratausalahataudapatpulahanyasatuyang benar. Jika kedua pernyataaan benar, maka yang perlu diperhatikan adalah apakah keduanya memilki hubungan sebab akibat atau tidak. Analisis kasus atau tinjauan Kasus ikanbiasanyaberupasoalceritaatauuraiantaentangkejadian, situasi,proses,hasilpercobaan,hasilsurvey,yangadahubungannyadenganmateri pelajaran yang akan diujikan. Assosiasi Pilihan atau Pilihan Ganda Kompleks A. Jika (1), (2), dan (3) benar B. Jika (1) dan (3) benar C. Jika (2) dan (4) benar D. Jika hanya (4) yang benar E. Jika semuanya benar Petujuk dalam Membuat soal Pilihan Ganda Pangkal(pokok) soal harus jelas Pilihan jawaban homogeny dalam arti isi Panjang kalimat pilihan relatifsama Tidak ada petunjuk jawaban yang benar Hindari menggunakan pilihan jawabansemua benar atau semua salah Pilihan jawaban angka, diurutkan Semua pilihan jawaban harus logis Jangan menggunakan bentuk negative ganda Kaliamat yang digunakan sesuai dengan tinkat perkembangan peserta tes 9 Menggunakan bahasa yang baku Tempatkan pilihan jawaban benar secara acak c. Objektif Padabentuktesini,siswadiarahkanuntuk mengerjakansoalmelaluisuatuprosedur atau langkah-langkah tertentu Setipa langkah diberikan skor tertentu Disebutobjektifdalampengertianapabiladiperiksaolehbebrapagurudalmbidang tersebut, hasil penskorannya akan relatif sama. d. Non-objektif Tes ini dikatakan non- objektif karena penilaian yang dilakuakan cendrung dipengaruhi oleh subjekvitas penilai. Bentuktesinimenuntutsiswauntukmenyampaikan,memilih,menyusun,dan memadukan ide yang dimilikinya dengan menggunakan kata-kata sendiri. Keunggulannya,dapatmengukurtingkatberpikirsiswadariterendahsampai tertinggi(ingatan sampai evaluasi) e. Jawaban singkat Bentuk jawanban singkat ditandai dengan adanya tempat kosongyang disediakan bagi peserta untuk menuliskan jawabannya sesuai dengan petujuk Jawaban harus sesuai dengan indicator Jawaban yang benar hanya satu Rumusan kalimat soal harus komutatif Butir soal menggunakan bahasa Indonesia yang baik dan benar Tidak menggunakan bahasa lokal f.Menjodohkan Soal bentuk mejodohkan terdiri dari suatu premis, suatu daftar kemungkinan jawaban, dansuatupetunjukuntukmenjodohkanmasing-masingpremisitudengansatu kemungkinan jawaban. Soal harus sesuai dengan indikator Jumlah alternative jawaban lebih banyak daripada premis 10 Alternativejawabanharusnyambungatauberhubungansecaralogisdengan premisnya. Rumusan kalimat soal harus komikatif Butir soal mennggunakan bahasa Indonesia yang baik dan benar Tidak menggunakan bahasa lokal g. UraianSoal-soaluraianmenututkemampuansiswauntukmengorganisasikandan merumuskan jawaban dengan menggunakan kata-kata sendiri. Soal-soalbentukuraianterdiriatasduaragamyaitu:bentukuraianbebasdanbentuk uraian terbatas(berstruktur) Soal-soalbentukuraiantepatdigunakanuntukmengukurkecakapansiswadalam mengerjakan / menjawab soal-soal yang menuntut kemampuan berpikir tinggi seperti kecakapandalammemecahkansoal,menganalisa,menarikkesimpulan,membut contoh, dan menjelaskan hubungan sebab akaibat. 2.3 Ranah Afektif Ranahafektifadalahranahyangberkaitandengansikapdannilai.Ranahafektif mencakupwatakperilakusepertiperasaan,minat,sikap,emosi,dannilai.Beberapapakar mengatakanbahwasikapseseorangdapatdiramalkanperubahannyabilaseseorangtelah memilikikekuasaankognitiftingkattinggi.Ciri-cirihasilbelajarafektifakantampakpada pesertadidikdalamberbagaitingkahlaku.Seperti:perhatiannnyaterhadapmatapelajaran, kedisiplinannyadalammengikutimatapelajarandisekolah,motivasinyayangtinggiuntuk tahulebihbanyakmengenaipelajaranyangditerimanya,penghargaanataurasahormatnya terhadap guru dan sebagainya. Ranah afektif menjadi lebih rinci lagi ke dalam lima jenjang,yaitu:(1) receiving (2) responding (3) valuing (4) organization (5) characterization by evalue or calue complex Receivingatauattending(=menerimaatuamemperhatikan),adalahkepekaan seseorang dalam menerima rangsangan (stimulus) dari luar yang datang kepada dirinya dalam bentukmasalah,situasi,gejaladanlain-lain.Termasukdalamjenjanginimisalnyaadalah: kesadaran dan keinginan untuk menerima stimulus, mengontrol dan menyeleksi gejala-gejala atau rangsangan yang datang dari luar. Receiving atau attenting juga sering di beri pengertian sebagaikemauanuntukmemperhatikansuatukegiatanatausuatuobjek.Padajenjangini pesertadidikdibinaagarmerekabersediamenerimanilaiataunilai-nilaiyangdiajarkan kepadamereka,danmerekamaumenggabungkandirikedalamnilaiituataumeng-identifikasikan diri dengan nilai itu. Contoh hasil belajar afektif jenjang receiving , misalnya: 11 pesertadidikbahwadisiplinwajibditegakkan,sifatmalasdantidakdisiplinharus disingkirkan jauh-jauh. Responding(=menanggapi)mengandungartiadanyapartisipasiaktif.Jadi kemampuanmenanggapiadalahkemampuanyangdimilikiolehseseoranguntukmengikut sertakan dirinya secara aktif dalam fenomena tertentu dan membuat reaksi terhadapnya salah satucara.Jenjanginilebihtinggidaripadajenjangreceiving.Contohhasilbelajarranah afektifrespondingadalahpesertadidiktumbuhhasratnyauntukmempelajarinyalebihjauh atau menggeli lebih dalam lagi, ajaran-ajaran Islam tentang kedisiplinan. Valuing(menilai=menghargai).Menilaiataumenghargaiartinyamem-berikannilai atau memberikan penghargaan terhadap suatu kegiatan atau obyek, sehingga apabila kegiatan itutidakdikerjakan,dirasakanakanmembawakerugianataupenyesalan.Valuingadalah merupakantingkatafektifyanglebihtinggilagidaripadareceivingdanresponding.Dalam kaitandalamprosesbelajarmengajar,pesertadidikdisinitidakhanyamaumenerimanilai yangdiajarkantetapimerekatelahberkemampuanuntukmenilaikonsepatau fenomena, yaitubaikatauburuk.Bilasuatuajaranyangtelahmampumerekanilaidan mampuuntukmengatakanituadalahbaik,makainiberartibahwapesertadidiktelah menjalaniprosespenilaian.Nilaiitumulaidicamkan(internalized)dalamdirinya.Dengan demikiannilaitersebuttelahstabildalampesertadidik.Contohhasilbelajarefektifjenjang valuingadalahtumbuhnyakemampuanyangkuatpadadiripesetadidikuntukberlaku disiplin, baik disekolah, dirumah maupun di tengah-tengah kehidupan masyarakat.Organization(=mengaturataumengorganisasikan),artinyamemper-temukan perbedaan nilai sehingga terbentuk nilai baru yang universal, yang membawa pada perbaikan umum. Mengatur atau mengorganisasikan merupakan pengembangan dari nilai kedalam satu sistem organisasi, termasuk didalamnya hubungan satu nilai denagan nilailain., pemantapan danperioritasnilaiyangtelahdimilikinya.Contohnilaiefektifjenjangorganizationadalah pesertadidikmendukungpenegakandisiplinnasionalyangtelahdicanangkanolehbapak presiden Soeharto pada peringatan hari kemerdekaan nasional tahun 1995. Characterization by evalue or calue complex (=karakterisasi dengansuatu nilai atau kompleknilai),yakniketerpaduansemuasistemnilaiyangtelahdimilikiolehseseorang, yangmempengaruhipolakepribadiandantingkahlakunya.Disiniprosesinternalisasinilai telahmenempatitempattertinggidalalsuatuhirarkinilai.Nilaiitutelahtertanamsecara konsistenpadasistemnyadantelahmempengaruhiemosinya.Iniadalahmerupakantingkat efektiftertinggi,karenasikapbatinpesertadidiktelahbenar-benarbijaksana.Iatelah memiliki phyloshopphy of life yang mapan. Jadi pada jenjang ini peserta didik telah memiliki sistemnilaiyangtelahmengontroltingkahlakunyauntuksuatuwaktuyanglama,sehingga membentukarakteristikpolahiduptingkahlakunyamenetap,konsistendandapat diramalkan.Contohhasilbelajarafektifpadajenjanginiadalahsiswatelahmemiliki kebulatansikapwujudnyapesertadidikmenjadikanperintahAllahSWT yangterteradiAl-Quranmenyangkutdisiplinan,baikkedisiplinansekolah,dirumahmaupunditengah-tengan kehidupan masyarakat.12 Ranahafektiftidakdapatdiukursepertihalnyaranahkognitif,karenadalamranah afektifkemampuanyangdiukuradalah:Menerima(memperhatikan), Merespon,Menghargai, Mengorganisasi, dan Karakteristik suatu nilai. Skalayangdigunakanuntukmengukurranahafektif seseorangterhadapkegiatan suatuobjekdiantaranyaskalasikap.Hasilnyaberupakategorisikap,yaknimendukung (positif), menolak (negatif), dan netral Ada5tipekarakteristikafektifyangpentingberdasarkantujuannya,yaitusikap, minat, konsep diri, nilai, dan moral. 1.Sikap Sikapmerupakansuatukencendrunganuntukbertindaksecarasukaatautidaksuka terhadapsuatuobjek.Sikapdapatdibentukmelaluicaramengamatidanmenirukansesuatu yang positif, kemudian melalui penguatan serta menerima informasi verbal. Perubahan sikap dapatdiamatidalamprosespembelajaran,tujuanyangingindicapai,keteguhan,dan konsistensiterhadapsesuatu.Penilaiansikapadalahpenilaianyangdilakukanuntuk mengetahui sikap peserta didik terhadap mata pelajaran, kondisi pembelajaran, pendidik, dan sebagainya. 2.Minat MenurutGetzel(1966),minatadalahsuatudisposisiyangterorganisirmelalui pengalamanyangmendorongseseoranguntukmemperolehobjekkhusus,aktivitas, pemahaman,danketerampilanuntuktujuanperhatianataupencapaian.Sedangkanmenurut kamus besar bahasaIndonesia (1990: 583), minat atau keinginanadalahkecenderungan hati yangtinggiterhadapsesuatu.Halpentingpadaminatadalahintensitasnya.Secaraumum minat termasuk karakteristik afektif yang memiliki intensitas tinggi. 3.Konsep Diri MenurutSmith,konsepdiriadalahevaluasiyangdilakukanindividuterhadap kemampuandankelemahanyangdimiliki.Target,arah,danintensitaskonsepdiripada dasarnyasepertiranahafektifyanglain.Targetkonsepdiribiasanyaorangtetapibisajuga institusisepertisekolah.Arahkonsepdiribisapositifataunegatif,danintensitasnyabisa dinyatakan dalam suatu daerah kontinum, yaitu mulai dari rendah sampai tinggi. 4.Nilai NilaimenurutRokeach(1968)merupakansuatukeyakinantentangperbuatan, tindakan, atau perilaku yang dianggap baik dan yang dianggap buruk. Selanjutnya dijelaskan bahwasikapmengacupadasuatuorganisasisejumlahkeyakinansekitarobjekspesifikatau situasi, sedangkan nilai mengacu pada keyakinan. 13 5.Moral Moralberkaitandenganperasaansalahataubenarterhadapkebahagiaanoranglain atauperasaanterhadaptindakanyangdilakukandirisendiri.Misalnyamenipuoranglain, membohongi orang lain, atau melukai orang lain baik fisik maupun psikis. Moral juga sering dikaitkan dengan keyakinan agama seseorang,yaitu keyakinan akan perbuatanyang berdosa dan berpahala. Jadi moral berkaitan dengan prinsip, nilai, dan keyakinan seseorang. Ranah afektif lain yang penting adalah: Kejujuran:pesertadidikharusbelajarmenghargaikejujurandalamberinteraksi dengan orang lain. Integritas:pesertadidikharusmengikatkandiripadakodenilai,misalnyamoraldan artistik. Adil:pesertadidikharusberpendapatbahwasemuaorangmendapatperlakuanyang sama dalam memperoleh pendidikan. Kebebasan:pesertadidikharusyakinbahwanegarayangdemokratismemberi kebebasan yang bertanggung jawab secara maksimal kepada semua orang. Kompetensi siswa dalam ranah afektif yang perlu dinilai utamanya menyangkut sikap danminatsiswadalambelajar.Secarateknispenilaianranahafektifdilakukanmelaluidua halyaitu:a)laporandiriolehsiswayangbiasanyadilakukandenganpengisianangket anonim,b)pengamatansistematisolehguruterhadapafektifsiswadanperlulembar pengamatan. Skalayangseringdigunakandalaminstrumen(alat)penilaianafektifadalahSkala Thurstone, Skala Likert, dan Skala Beda Semantik. Contoh Skala Thurstone: Minat terhadap pelajaran Biologi 7654321 Saya senang balajar biologiPelajaran biologi bermanfaat Pelajaran biologi membosankan Dst. Contoh Skala Likert: Minat terhadap pelajaran biologi Pelajaran biologi bermanfaatSSSTSSTS Pelajaran biologi sulit Tidak semua harus belajar biologi Sekolah saya menyenangkan Keterangan:14 SS : Sangat setuju S : Setuju TS : Tidak setuju STS : Sangat tidak setuju Contoh Lembar Penilaian Diri Siswa Minat Membaca Nama Pembelajar:_____________________________ NoDeskripsiYa/Tidak 1Sayalebihsukamembacadibandingkandengan melakukan hal-hal lain

2Banyakyangdapatsayaambilhikmahdaribukuyang saya baca

3Saya lebih banyak membaca untuk waktu luang saya4Dst.. 2.4 Ranah Psikomotor Perkataan psikomotor berhubungan dengan kata motor, sensori motor atau perceptual motor. Jadi ranah psikomotor berhubungan erat dengan kerjaan otot sehingga menyebabkan geraknyatubuhataubagian-bagiannya.Yangtermasukdalamklasifikasigerakdisinimulai darigerakyangpalingsederhanayaitumelipatkertassampaidenganmerakitsukucadang televisisertakomputer.Secaramendasarperludibedakanantara2halyaitu keterampilan (skills) dan kemampuan (abilities) Contoh: seberapa terampil para siswa dalam menyiapkan alat alat. seberapa terampil para siswa menggunakan alat-alat . DalamrangkaiankategorisasitaksonomipendidikanBloomsebenarnya bukanlah utuhpemikiranBloomsemua.Akantetapiadanyasumbanganpemikirandan gagasancemerlanglaindariparapemikirdanparaahlipendidikanlainnya.Haliniterlihat ketikapadaranahafektifdalamtaksonomiBloom,BloombekerjasamadenganKratwohl. Begitu juga dengan karakteristik yang dimunculkan pada ranah psikomotorik, di sana Bloom hanyasebagaipeletakdasartaksonomiakantetapilebihjauhtelahdikembangkanoleh Simpson, Dave, dan lain-lain.. Meski demikian, tetap saja taksonomi ini begitu kental dengan peletakdasargagasannya,yaituBenjaminS.Bloom,sehinggatidakheranjikasampaidetik ini taksonomi tersebut terkenal dengan sebutan Taksonomi Bloom. Ranahpsikomotoradalahkemampuanyangdihasilkan olehfungsimotorikmanusia yaituberupaketerampilan untukmelakukansesuatu. Keterampilanmelakukansesuatu 15 tersebut,meliputiketerampilanmotorik,keterampilanintelektual,danketerampilan sosial. Rincian dalam domain ini tidak dibuat oleh Bloom, namun dibuat oleh ahli lain tetapi tetapberdasarkanpadadomainyangdibuatBloom. Ranahpsikomotorikinidikembangkan oleh Simpson, dan klasifikasi ranah psikomotorik tersebut adalah: 1)Persepsi (Perception) Penggunaanalatinderauntukmenjadipegangandalammembantugerakan. Persepsi ini mencakup kemampuan untuk mengadakan diskriminasi yang tepat antara dua perangsang ataulebih,berdasarkanpembedaanantaraciri-cirifisikyangkhaspadamasing-masing rangsangan.Adanyakemampuaninidinyatakandalamsuatureaksiyangmenunjukkan kesadaranakanhadirnyaransangan(stimulasi)danperbedaanantaraseluruhrangsangan yang ada. 2)Kesiapan (Set) Kesiapan fisik, mental, dan emosional untuk melakukan gerakan. Kesiapan mencakup kemampuanuntukmenempatkandirinyadalamkeadaanakanmemulaisuatugerakanatau rangakaian gerakan. Kemampuan ini dinyatakan dalam bentuk kesiapan jasmani dan rohani. 3)Guided Response (Respon Terpimpin) Tahapawaldalammempelajariketerampilanyangkompleks,termasukdidalamnya imitasi dan gerakan coba-coba. 4)Mekanisme (Mechanism) Membiasakangerakan-gerakanyangtelahdipelajarisehinggatampildengan meyakinkandancakap. Inimencakupkemampuanuntukmelakukansuaturangakaian gerakandenganlancerkarenasudahdilatihsecukupnyatanpamemperhatikancontohyang diberikan. 5)Respon Tampak Yang Kompleks (Complex Overt Response) Gerakan motoris yang terampil yang di dalamnya terdiri dari pola-pola gerakanyang kompleks. Gerakan kompleks mencakup kemampuan untuk melaksanakan suatu ketrampilan, yangterdiriatasbeberapakomponen,denganlancar,tepatdanefisien.Adanyakemampuan inidinyatakandalamsuaturangkaianperbuatanyangberurutandanmenggabungkan beberapa subketrampilan menjadi suatu keseluruhan gerak-gerik yang teratur. 6)Penyesuaian (Adaptation) Keterampilanyangsudahberkembangsehinggadapatdisesuaikandalamberbagai situasi. Adaptasi ini mencakup kemampuan untuk mengadakan perubahan dan menyesuaikan poila gerak-gerik dengan kondisi setempat atau dengan menunjukkan taraf ketrampilan yang telah mencapai kemahiran. 7)Penciptaan (Origination) Membuatpolagerakanbaruyangdisesuaikandengansituasiataupermasalahan tertentu.Penciptaanataukreativitasadalahmencakupkemampuanuntukmelahirkananeka pola gerak-gerik yang baru, seluruhnya atas dasar prakarsa dan inisiatif sendiri. SelainSympson,Davejugamengemukakanpendapatterkaitdomainpsikomotor, Khusus keterampilan motorik Dave (1967), membaginya dalam lima jenjang, yaitu: peniruan, penggunaan,ketepatan,perangkaian,dannaturalisasi.Secaravisualjenjangketerampilan motorik tersebut dapat digambarkan sebagai berikut. 16 Klasifikasi ranah psikomotor dijabarkan sebagai berikut. 1.Peniruan(Imitation)adalahmengamatiperilakudanpolasetelahoranglain.Kinerja mungkin kualitas rendah. 2.Penggunaan(Manipulation)adalahmampumelakukantindakantertentudengan mengikuti instruksi dan berlatih. 3.Ketepatan (Precision) adalah mengulangi pengalaman serupa agar menuju perubahan yang ke arah yang lebih baik. 4.Perangkaian(Articulation)adalahkoordinasiserangkaiantindakan,mencapai keselarasan dan konsistensi internal. 5.Naturalisasi (Naturalitation): Setelah kinerja tingkat tinggi menjadi alami, tanpa perlu berpikir banyak tentang hal itu. 2.5 Revisi Taksonomi Bloom Tingkatan-tingkatandalamTaksonomiBloomtersebuttelahdigunakanhampir setengahabadsebagaidasaruntukpenyusunantujuan-tujuanpendidikan,penyusunantes, dankurikulumdiseluruhdunia.Kerangkapikirinimemudahkangurumemahami,menata, danmengimplementasikantujuan-tujuanpendidikan.BerdasarkanhaltersebutTaksonomi Bloom menjadi sesuatu yang penting dan mempunyai pengaruh yang luas dalam waktu yang lama. Namun salah seorang murid Bloom yang bernama Lorin W Andersonbeserta rekannya merevisitaksonomiBloompadatahun1990.Hasilperbaikannyadipublikasikanpadatahun 2001dengannamaRevisiTaksonomiBloomdalambentuksebuahbukuyangberjudul A TaxonomyforLearning,Teaching,andAssesing:ARevisionofBloomsTaxonomyof Educatioanl Objectives yang disusun oleh Lorin W. Anderson dan David R. Krathwohl. Dalamrevisiiniadaperubahankatakunci,masing-masingkategorimasihdiurutkan secarahirarkidariurutanterendahkeyanglebihtinggi.Padaranahkognitifkemampuan berpikir analisis dan sintesis diintegrasikan menjadi analisis saja. Dari jumlah enam kategori pada konsep terdahulu tidak berubah jumlahnya karena Lorin memasukan kategori baru yaitu creating yang sebelumnya tidak ada. TaksonomiHasil revisi Anderson pada Ranah Kognitif adalah:Mengingat, Kata-kataoperasionalyangdigunakanadalahmengurutkan, menjelaskan, mengidentifikasi, menamai, menempatkan, mengulangi, menemukan kembali. Memahami, Kata-kataoperasionalyangdigunakanadalahmenafsirkan, meringkas mengklasifikasikan, membandingkan, menjelaskan, membeberkan. Menerapkan, Kata-kataoperasionalyangdigunakanadalahmelaksanakan, menggunakan, menjalankan,melakukan,mempraktekan,memilih,menyusun,memulai, menyelesaikan, mendeteksi.17 Menganalisis, Kata-kataoperasionalyangdigunakanadalahmenguraikan, membandingkan, mengorganisir,menyusunulang,mengubahstruktur,mengkerangkakan, menyusunoutline, mengintegrasikan,membedakan,menyamakan,membandingkan, mengintegrasikan. Mengevaluasi, Kata-kataoperasionalyangdigunakanadalahmenyusunhipotesi, mengkritik, memprediksi, menilai, menguji, membenarkan, menyalahkan. Berkreasi, Kata-kataoperasionalyangdigunakanadalahmerancang,membangun, merencanakan, memproduksi,menemukan,membaharui,menyempurnakan,memperkuat, memperindah, menggubah. Dalamberbagaiaspekdansetelahmelaluirevisi,taksonomiBloomtetap menggambarkansuatuprosespembelajaran,carakitamemprosessuatuinformasisehingga dapatdimanfaatkandalamkehidupansehari-hari.Beberapaprinsipdidalamnyaadalah (1)Sebelumkitamemahamisebuahkonsepmakakitaharusmengingatnyaterlebihdahulu, (2) Sebelumkitamenerapkanmakakitaharusmemahaminyaterlebihdahulu,(3) Sebelum kitamengevaluasidampaknyamakakitaharusmengukurataumenilai,(4) Sebelumkita berkreasisesuatumakakitaharusmengingat,memahami,mengaplikasikan,menganalisis dan mengevaluasi, serta memperbaharui. Pentahapanberpikirsepertiitubisajadimendapatsanggahandarisebagianorang. Alasannya,dalambeberapajeniskegiatan,tidaksemuatahapsepertiitudiperlukan. Contohnyadalammenciptakansesuatutidakharusmelaluipentahapanitu.Halitukembali padakreativitasindividu.Prosespembelajarandapatdimulaidaritahapmanasaja.Namun, modelpentahapanitusebenarnyamelekatpadasetiapprosespembelajaransecara terintegrasi. Sebagianorangjugamenyanggahpembagianpentahapanberpikirsepertiitu karena dalam kenyataannya siswa seharusnya berpikir secara holistik. Ketika kemampuan itu dipisah-pisahmakasiswadapatkehilangankemampuannyauntukmenyatukankembali komponen-komponenyangsudahterpisah.Modelpenciptaaansuatuprodukbaruatau menyelesaiansuatuproyektertentulebihbaikdalammemberikantantanganterpaduyang mendorong siswa untuk berpikir secara kritis. Perbandingan Taksonomi Bloom dan Hasil revisinya untuk ranah kognitif dapat dilihat pada tabel berikut ini. 18 (1)Tingkatantingkahlakupadataksonomibloomyanglamamenggunakankatasifat sedangkan Anderson mengubahnya dengan menggunakan kata kerja. (2) Tingkatan terendah (C1)PengetahuandigantidenganMengingat.(3) TingkatanC5SintesadantingkatanC6 EvaluasidileburmenjadiMengevaluasiyangberkedudukanpadatingkatanC5. (4) Tingkatan C6 digantikan menjadi Berkreasi. 19 BAB III PENUTUP 3.1 Simpulan 1.KatataksonomidiambildaribahasaYunanitasseinyangberartiuntuk mengelompokkan dan nomos yang berarti aturan. Taksonomi dapat diartikan sebagai pengelompokansuatuhalberdasarkanhierarki(tingkatan)tertentu.Taksonomi Bloom merujuk pada taksonomi yang dibuat untuk tujuan pendidikan. 2.Ranahkognitifadalahranahyangmembahastujuanpembelajarandenganproses mentalyangberawaldaritingkatpengetahuanketingkatyanglebihtinggiyakni evaluasi. 3.Ranahafektifadalahsatudomainyangberkaitandengansikap,nilai-nilaiinterest, apresiasi atau penghargaan dan penyesuaian perasaan sosial. 4.Ranah psikomotor berkaitan dengan ketrampilan atau skill yang bersikap manual atau motorik.5.Dalamrevisitaksonomibloomterdapatperubahankatakunci,masing-masing kategorimasihdiurutkansecarahirarkisdariurutanterendahkeyanglebihtinggi. Pada ranah kognitif kemampuan berpikir analisis dan sintesis diintegrasikan menjadi analisissaja.Darijumlahenamkategoripadakonsepterdahulutidakberubah jumlahnyakarenaLorinmemasukankategoribaruyaitucreating yangsebelumnya tidak ada. 20 DAFTAR PUSTAKA Anonim.2012.PengukuranRanahKognitif,Afektif,danPsikomotor.http://simbahstress1987.blogspot.com/2012/11/pengukuran-ranah-kognitif-afektif-dan.html diakses pada 31 Oktober 2013. Arifin, Zainal. 2012. Evaluasi Pembelajaran. Bandung: Remaja Rosdakarya. Arikunto, Suharsimi. 2009. Dasar-Dasar Evaluasi Pendidikan. Jakarta: Bumi Aksara. Daryanto. 2001. Evaluasi Pendidikan. Jakarta: Asdi Mahasatya. Sadono, Tri. 2013. Taksonomi-Taksonomi Pembelajaran. http://trigurumetri.blogspot.com/2013/08/taksonomi-taksonomi-pembelajaran.htmldiakses pada 31 Oktober 2013. Sudijono, Anas. 1996. Pengantar Evaluasi Pendidikan. Jakarta: RajaGrafindo Persada. Sukardi. 2011. Evaluasi Pendidikan Prinsip dan Operasionalnya. Jakarta: Bumi Aksara. Yanti, Irma. 2012. Pengukuran Ranah Kognitif. http://imma-irmayantihusnulkhatimah.blogspot.com/2012/02/pengukuran-ranah-kognitif.html diakses pada 31 Oktober 2013.